F397642
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 148 | 304 | 158 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10139574|Ga0265338_101395742 |
| Length | 170 |
| Sequence | MALIGSKMIIALATDHAGFTQAAELEEYLKSLGYGCRSFGPKTLDPQDDYPDFIKPAAKAVASGECQKGIILGGSGQGEAMAANRVHGVRCAVFYGPAVPRRVVDAEGRTSHDPYEIVRLSRQHNDANMLSLAARFVSFKDMKQVIKLWLDTPFSDESRHQRRIKELDEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 26 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 27 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 28 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 29 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 30 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 31 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 38 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 92 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 93 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 95 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 96 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 97 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 98 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 100 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 101 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 103 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 104 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 106 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 108 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 111 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 113 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 114 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 116 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 117 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 118 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 119 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 122 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 123 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 124 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 125 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 126 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 127 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 128 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 129 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 133 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 137 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 138 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 139 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 142 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 143 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 144 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 145 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 147 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 148 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.62 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 96.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10250567 | 3300005290 | Unclassified | 918 |
| 2 | Ga0065715_10152739 | 3300005293 | Unclassified | 1710 |
| 3 | Ga0070658_10072089 | 3300005327 | Bacteria | 2830 |
| 4 | Ga0070683_100167041 | 3300005329 | Bacteria | 2088 |
| 5 | Ga0070683_101202777 | 3300005329 | Unclassified | 728 |
| 6 | Ga0070660_100000565 | 3300005339 | Bacteria | 24858 |
| 7 | Ga0070674_100875533 | 3300005356 | Bacteria | 781 |
| 8 | Ga0070673_101034304 | 3300005364 | Unclassified | 766 |
| 9 | Ga0070688_101180121 | 3300005365 | Bacteria | 614 |
| 10 | Ga0070667_100558679 | 3300005367 | Unclassified | 1052 |
| 11 | Ga0070714_100000374 | 3300005435 | Bacteria | 33426 |
| 12 | Ga0070714_100014460 | 3300005435 | Bacteria | 6340 |
| 13 | Ga0070705_100159283 | 3300005440 | Bacteria | 1507 |
| 14 | Ga0070694_100431375 | 3300005444 | Bacteria | 1037 |
| 15 | Ga0070708_100021994 | 3300005445 | Bacteria | 5405 |
| 16 | Ga0070708_100031588 | 3300005445 | Bacteria | 4585 |
| 17 | Ga0070708_100059770 | 3300005445 | Unclassified | 3399 |
| 18 | Ga0070708_100479620 | 3300005445 | Bacteria | 1173 |
| 19 | Ga0070708_100797640 | 3300005445 | Bacteria | 888 |
| 20 | Ga0070681_10172057 | 3300005458 | Bacteria | 2088 |
| 21 | Ga0070706_100353653 | 3300005467 | Unclassified | 1369 |
| 22 | Ga0070706_100486102 | 3300005467 | Bacteria | 1149 |
| 23 | Ga0070707_100012728 | 3300005468 | Bacteria | 7853 |
| 24 | Ga0070707_100056316 | 3300005468 | Bacteria | 3771 |
| 25 | Ga0070707_100402162 | 3300005468 | Bacteria | 1329 |
| 26 | Ga0070707_100496239 | 3300005468 | Bacteria | 1182 |
| 27 | Ga0070698_100008134 | 3300005471 | Bacteria | 11337 |
| 28 | Ga0070698_100055513 | 3300005471 | Unclassified | 4016 |
| 29 | Ga0070698_100523158 | 3300005471 | Bacteria | 1125 |
| 30 | Ga0070699_100188166 | 3300005518 | Bacteria | 1833 |
| 31 | Ga0070699_101688277 | 3300005518 | Unclassified | 580 |
| 32 | Ga0070679_100000652 | 3300005530 | Bacteria | 29531 |
| 33 | Ga0070679_100000876 | 3300005530 | Bacteria | 26140 |
| 34 | Ga0070679_100117587 | 3300005530 | Unclassified | 2643 |
| 35 | Ga0070679_100311006 | 3300005530 | Bacteria | 1525 |
| 36 | Ga0070679_100499687 | 3300005530 | Unclassified | 1160 |
| 37 | Ga0070679_101016071 | 3300005530 | Unclassified | 773 |
| 38 | Ga0070684_100091583 | 3300005535 | Bacteria | 2705 |
| 39 | Ga0070684_101451018 | 3300005535 | Unclassified | 646 |
| 40 | Ga0070697_100004034 | 3300005536 | Bacteria | 11263 |
| 41 | Ga0070697_100984233 | 3300005536 | Bacteria | 749 |
| 42 | Ga0068853_100029637 | 3300005539 | Bacteria | 4616 |
| 43 | Ga0070686_100086588 | 3300005544 | Bacteria | 2086 |
| 44 | Ga0070686_100136287 | 3300005544 | Bacteria | 1704 |
| 45 | Ga0070696_100494161 | 3300005546 | Bacteria | 972 |
| 46 | Ga0068855_100011595 | 3300005563 | Bacteria | 10648 |
| 47 | Ga0068855_100016848 | 3300005563 | Bacteria | 8791 |
| 48 | Ga0068855_100054831 | 3300005563 | Bacteria | 4685 |
| 49 | Ga0068855_100137462 | 3300005563 | Bacteria | 2787 |
| 50 | Ga0068855_100383926 | 3300005563 | Bacteria | 1542 |
| 51 | Ga0068857_100004295 | 3300005577 | Bacteria | 12019 |
| 52 | Ga0068857_100045243 | 3300005577 | Bacteria | 3904 |
| 53 | Ga0068857_100131698 | 3300005577 | Bacteria | 2255 |
| 54 | Ga0068856_100037200 | 3300005614 | Unclassified | 4775 |
| 55 | Ga0068856_100053736 | 3300005614 | Unclassified | 3972 |
| 56 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 57 | Ga0068852_100059093 | 3300005616 | Bacteria | 3324 |
| 58 | Ga0068861_100367854 | 3300005719 | Bacteria | 1266 |
| 59 | Ga0068858_100035290 | 3300005842 | Bacteria | 4639 |
| 60 | Ga0068860_100256173 | 3300005843 | Bacteria | 1705 |
| 61 | Ga0081539_10001746 | 3300005985 | Bacteria | 34691 |
| 62 | Ga0070717_10003528 | 3300006028 | Bacteria | 11213 |
| 63 | Ga0070717_10021890 | 3300006028 | Bacteria | 5043 |
| 64 | Ga0070717_10141295 | 3300006028 | Bacteria | 2077 |
| 65 | Ga0075365_10029697 | 3300006038 | Bacteria | 3497 |
| 66 | Ga0075364_10567702 | 3300006051 | Bacteria | 775 |
| 67 | Ga0070716_100081028 | 3300006173 | Unclassified | 1937 |
| 68 | Ga0075366_10000044 | 3300006195 | Bacteria | 45021 |
| 69 | Ga0075366_10354867 | 3300006195 | Bacteria | 900 |
| 70 | Ga0075436_100028465 | 3300006914 | Unclassified | 3844 |
| 71 | Ga0105240_10013363 | 3300009093 | Bacteria | 11278 |
| 72 | Ga0105240_10064650 | 3300009093 | Bacteria | 4545 |
| 73 | Ga0105240_10289760 | 3300009093 | Bacteria | 1877 |
| 74 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 75 | Ga0105245_10048498 | 3300009098 | Bacteria | 3799 |
| 76 | Ga0105245_10086634 | 3300009098 | Bacteria | 2873 |
| 77 | Ga0105241_10023216 | 3300009174 | Bacteria | 4599 |
| 78 | Ga0105241_10253580 | 3300009174 | Bacteria | 1493 |
| 79 | Ga0105241_10380755 | 3300009174 | Bacteria | 1233 |
| 80 | Ga0105241_10910055 | 3300009174 | Bacteria | 817 |
| 81 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 82 | Ga0105238_10003523 | 3300009551 | Bacteria | 15595 |
| 83 | Ga0105238_10038386 | 3300009551 | Bacteria | 4864 |
| 84 | Ga0105238_10160480 | 3300009551 | Bacteria | 2224 |
| 85 | Ga0105238_11074049 | 3300009551 | Unclassified | 827 |
| 86 | Ga0105239_10004097 | 3300010375 | Bacteria | 17527 |
| 87 | Ga0105239_11334434 | 3300010375 | Unclassified | 828 |
| 88 | Ga0157370_10617294 | 3300013104 | Bacteria | 992 |
| 89 | Ga0157370_10836093 | 3300013104 | Unclassified | 837 |
| 90 | Ga0157369_10136313 | 3300013105 | Bacteria | 2599 |
| 91 | Ga0157369_10152376 | 3300013105 | Bacteria | 2443 |
| 92 | Ga0157369_10180338 | 3300013105 | Bacteria | 2222 |
| 93 | Ga0157369_10194668 | 3300013105 | Bacteria | 2129 |
| 94 | Ga0157369_10305663 | 3300013105 | Bacteria | 1654 |
| 95 | Ga0157378_10062734 | 3300013297 | Bacteria | 3319 |
| 96 | Ga0157378_10081209 | 3300013297 | Bacteria | 2930 |
| 97 | Ga0163162_10500196 | 3300013306 | Bacteria | 1346 |
| 98 | Ga0157372_10432924 | 3300013307 | Bacteria | 1533 |
| 99 | Ga0157379_10248204 | 3300014968 | Bacteria | 1615 |
| 100 | Ga0163161_10040972 | 3300017792 | Bacteria | 3327 |
| 101 | Ga0207666_1005428 | 3300025271 | Bacteria | 1629 |
| 102 | Ga0207697_10002964 | 3300025315 | Bacteria | 8569 |
| 103 | Ga0207688_10060689 | 3300025901 | Bacteria | 2130 |
| 104 | Ga0207680_10243705 | 3300025903 | Bacteria | 1239 |
| 105 | Ga0207647_10489286 | 3300025904 | Unclassified | 687 |
| 106 | Ga0207705_10107304 | 3300025909 | Bacteria | 2060 |
| 107 | Ga0207654_10007261 | 3300025911 | Bacteria | 5584 |
| 108 | Ga0207654_10124777 | 3300025911 | Bacteria | 1621 |
| 109 | Ga0207654_10398304 | 3300025911 | Bacteria | 956 |
| 110 | Ga0207654_10735958 | 3300025911 | Bacteria | 710 |
| 111 | Ga0207707_10046886 | 3300025912 | Bacteria | 3764 |
| 112 | Ga0207695_10085923 | 3300025913 | Bacteria | 3174 |
| 113 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 114 | Ga0207693_10013742 | 3300025915 | Bacteria | 6522 |
| 115 | Ga0207693_10141902 | 3300025915 | Bacteria | 1888 |
| 116 | Ga0207663_10130086 | 3300025916 | Bacteria | 1738 |
| 117 | Ga0207660_10001756 | 3300025917 | Bacteria | 14531 |
| 118 | Ga0207662_10003795 | 3300025918 | Bacteria | 7838 |
| 119 | Ga0207657_10000309 | 3300025919 | Bacteria | 51811 |
| 120 | Ga0207652_10000906 | 3300025921 | Bacteria | 28011 |
| 121 | Ga0207652_10004857 | 3300025921 | Bacteria | 10886 |
| 122 | Ga0207652_10251815 | 3300025921 | Bacteria | 1593 |
| 123 | Ga0207652_10382836 | 3300025921 | Bacteria | 1269 |
| 124 | Ga0207652_10496524 | 3300025921 | Unclassified | 1099 |
| 125 | Ga0207652_10865105 | 3300025921 | Unclassified | 800 |
| 126 | Ga0207646_10014338 | 3300025922 | Bacteria | 7532 |
| 127 | Ga0207646_10043209 | 3300025922 | Bacteria | 4048 |
| 128 | Ga0207646_10116601 | 3300025922 | Unclassified | 2398 |
| 129 | Ga0207646_10123370 | 3300025922 | Unclassified | 2328 |
| 130 | Ga0207646_10211255 | 3300025922 | Bacteria | 1752 |
| 131 | Ga0207646_10243830 | 3300025922 | Bacteria | 1623 |
| 132 | Ga0207681_10014846 | 3300025923 | Bacteria | 4850 |
| 133 | Ga0207694_10000890 | 3300025924 | Bacteria | 26483 |
| 134 | Ga0207694_10074130 | 3300025924 | Bacteria | 2664 |
| 135 | Ga0207687_10000030 | 3300025927 | Bacteria | 155548 |
| 136 | Ga0207664_10000269 | 3300025929 | Bacteria | 39220 |
| 137 | Ga0207664_10257825 | 3300025929 | Bacteria | 1524 |
| 138 | Ga0207664_11002019 | 3300025929 | Unclassified | 749 |
| 139 | Ga0207706_10011823 | 3300025933 | Bacteria | 7949 |
| 140 | Ga0207670_10069921 | 3300025936 | Bacteria | 2423 |
| 141 | Ga0207691_10270795 | 3300025940 | Bacteria | 1462 |
| 142 | Ga0207689_10256121 | 3300025942 | Unclassified | 1447 |
| 143 | Ga0207661_10336417 | 3300025944 | Unclassified | 1360 |
| 144 | Ga0207661_10432235 | 3300025944 | Bacteria | 1197 |
| 145 | Ga0207667_10002118 | 3300025949 | Bacteria | 24862 |
| 146 | Ga0207667_10006467 | 3300025949 | Bacteria | 14176 |
| 147 | Ga0207667_10021272 | 3300025949 | Bacteria | 7190 |
| 148 | Ga0207667_10140042 | 3300025949 | Bacteria | 2491 |
| 149 | Ga0207667_10367933 | 3300025949 | Bacteria | 1465 |
| 150 | Ga0207712_10029860 | 3300025961 | Bacteria | 3661 |
| 151 | Ga0207668_10200820 | 3300025972 | Unclassified | 1587 |
| 152 | Ga0207658_10032506 | 3300025986 | Bacteria | 3713 |
| 153 | Ga0207658_10529778 | 3300025986 | Unclassified | 1052 |
| 154 | Ga0207677_10016569 | 3300026023 | Bacteria | 4370 |
| 155 | Ga0207703_10033671 | 3300026035 | Bacteria | 4064 |
| 156 | Ga0207702_10087897 | 3300026078 | Unclassified | 2714 |
| 157 | Ga0207702_10237360 | 3300026078 | Unclassified | 1706 |
| 158 | Ga0207648_10513420 | 3300026089 | Bacteria | 1097 |
| 159 | Ga0207674_10008732 | 3300026116 | Bacteria | 11666 |
| 160 | Ga0207674_10011447 | 3300026116 | Bacteria | 9968 |
| 161 | Ga0207674_10057197 | 3300026116 | Bacteria | 3954 |
| 162 | Ga0207675_100199074 | 3300026118 | Bacteria | 1924 |
| 163 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 164 | Ga0207698_10735489 | 3300026142 | Unclassified | 984 |
| 165 | Ga0268265_10063717 | 3300028380 | Bacteria | 2837 |
| 166 | Ga0268264_10233173 | 3300028381 | Bacteria | 1701 |
| 167 | Ga0265337_1000001 | 3300028556 | Bacteria | 140973 |
| 168 | Ga0265337_1001897 | 3300028556 | Bacteria | 9949 |
| 169 | Ga0265337_1001932 | 3300028556 | Bacteria | 9853 |
| 170 | Ga0265337_1002922 | 3300028556 | Bacteria | 7591 |
| 171 | Ga0265337_1005837 | 3300028556 | Unclassified | 4825 |
| 172 | Ga0265326_10000303 | 3300028558 | Bacteria | 21740 |
| 173 | Ga0265326_10001540 | 3300028558 | Bacteria | 8064 |
| 174 | Ga0265326_10004220 | 3300028558 | Unclassified | 4629 |
| 175 | Ga0265326_10037183 | 3300028558 | Unclassified | 1384 |
| 176 | Ga0265326_10050454 | 3300028558 | Bacteria | 1178 |
| 177 | Ga0265319_1008118 | 3300028563 | Bacteria | 4634 |
| 178 | Ga0265319_1030009 | 3300028563 | Bacteria | 1904 |
| 179 | Ga0265334_10000049 | 3300028573 | Bacteria | 89091 |
| 180 | Ga0265334_10003511 | 3300028573 | Bacteria | 7110 |
| 181 | Ga0265334_10004026 | 3300028573 | Bacteria | 6596 |
| 182 | Ga0265334_10025136 | 3300028573 | Bacteria | 2412 |
| 183 | Ga0265334_10038813 | 3300028573 | Bacteria | 1871 |
| 184 | Ga0265334_10095985 | 3300028573 | Unclassified | 1077 |
| 185 | Ga0265318_10003578 | 3300028577 | Bacteria | 7775 |
| 186 | Ga0265318_10011506 | 3300028577 | Bacteria | 3806 |
| 187 | Ga0265318_10116134 | 3300028577 | Bacteria | 983 |
| 188 | Ga0265323_10005117 | 3300028653 | Bacteria | 5589 |
| 189 | Ga0265322_10001961 | 3300028654 | Bacteria | 6509 |
| 190 | Ga0265322_10083645 | 3300028654 | Bacteria | 906 |
| 191 | Ga0265336_10000047 | 3300028666 | Bacteria | 123576 |
| 192 | Ga0265336_10002635 | 3300028666 | Bacteria | 7288 |
| 193 | Ga0265336_10002777 | 3300028666 | Bacteria | 7074 |
| 194 | Ga0265336_10005536 | 3300028666 | Bacteria | 4651 |
| 195 | Ga0265338_10000003 | 3300028800 | Bacteria | 733923 |
| 196 | Ga0265338_10000039 | 3300028800 | Bacteria | 236135 |
| 197 | Ga0265338_10000054 | 3300028800 | Bacteria | 207383 |
| 198 | Ga0265338_10000178 | 3300028800 | Bacteria | 118345 |
| 199 | Ga0265338_10000482 | 3300028800 | Bacteria | 71209 |
| 200 | Ga0265338_10002389 | 3300028800 | Bacteria | 28280 |
| 201 | Ga0265338_10013060 | 3300028800 | Bacteria | 9413 |
| 202 | Ga0265338_10030929 | 3300028800 | Bacteria | 5259 |
| 203 | Ga0265338_10076270 | 3300028800 | Bacteria | 2840 |
| 204 | Ga0265338_10090631 | 3300028800 | Unclassified | 2530 |
| 205 | Ga0265338_10100438 | 3300028800 | Bacteria | 2360 |
| 206 | Ga0265338_10139574 | 3300028800 | Unclassified | 1900 |
| 207 | Ga0265338_10149692 | 3300028800 | Unclassified | 1815 |
| 208 | Ga0265338_10182989 | 3300028800 | Bacteria | 1595 |
| 209 | Ga0265338_10242244 | 3300028800 | Unclassified | 1335 |
| 210 | Ga0265338_10350161 | 3300028800 | Unclassified | 1062 |
| 211 | Ga0265324_10011104 | 3300029957 | Unclassified | 3444 |
| 212 | Ga0265324_10023814 | 3300029957 | Bacteria | 2178 |
| 213 | Ga0265324_10025215 | 3300029957 | Bacteria | 2108 |
| 214 | Ga0265330_10009761 | 3300031235 | Bacteria | 4547 |
| 215 | Ga0265330_10081468 | 3300031235 | Bacteria | 1394 |
| 216 | Ga0265332_10003382 | 3300031238 | Bacteria | 7722 |
| 217 | Ga0265332_10174258 | 3300031238 | Bacteria | 897 |
| 218 | Ga0265332_10233944 | 3300031238 | Bacteria | 761 |
| 219 | Ga0265328_10012928 | 3300031239 | Bacteria | 3314 |
| 220 | Ga0265320_10009368 | 3300031240 | Bacteria | 5912 |
| 221 | Ga0265320_10020970 | 3300031240 | Bacteria | 3526 |
| 222 | Ga0265320_10093688 | 3300031240 | Bacteria | 1389 |
| 223 | Ga0265320_10132006 | 3300031240 | Bacteria | 1134 |
| 224 | Ga0265325_10014388 | 3300031241 | Bacteria | 4473 |
| 225 | Ga0265325_10018573 | 3300031241 | Bacteria | 3857 |
| 226 | Ga0265325_10139795 | 3300031241 | Bacteria | 1153 |
| 227 | Ga0265325_10162559 | 3300031241 | Unclassified | 1049 |
| 228 | Ga0265329_10008151 | 3300031242 | Bacteria | 3993 |
| 229 | Ga0265340_10019710 | 3300031247 | Bacteria | 3472 |
| 230 | Ga0265340_10079875 | 3300031247 | Unclassified | 1541 |
| 231 | Ga0265340_10239722 | 3300031247 | Bacteria | 809 |
| 232 | Ga0265339_10052767 | 3300031249 | Bacteria | 2213 |
| 233 | Ga0265339_10059147 | 3300031249 | Bacteria | 2067 |
| 234 | Ga0265331_10003494 | 3300031250 | Bacteria | 10117 |
| 235 | Ga0265327_10017578 | 3300031251 | Bacteria | 4479 |
| 236 | Ga0265327_10033859 | 3300031251 | Bacteria | 2841 |
| 237 | Ga0265327_10067732 | 3300031251 | Bacteria | 1797 |
| 238 | Ga0265327_10070631 | 3300031251 | Bacteria | 1749 |
| 239 | Ga0265327_10157489 | 3300031251 | Unclassified | 1051 |
| 240 | Ga0265316_10050602 | 3300031344 | Bacteria | 3266 |
| 241 | Ga0265316_10085616 | 3300031344 | Bacteria | 2411 |
| 242 | Ga0265316_10279838 | 3300031344 | Bacteria | 1219 |
| 243 | Ga0265316_10348382 | 3300031344 | Bacteria | 1072 |
| 244 | Ga0265313_10005537 | 3300031595 | Bacteria | 9258 |
| 245 | Ga0265313_10007292 | 3300031595 | Bacteria | 7591 |
| 246 | Ga0265313_10034726 | 3300031595 | Bacteria | 2546 |
| 247 | Ga0265313_10074012 | 3300031595 | Bacteria | 1562 |
| 248 | Ga0265313_10128406 | 3300031595 | Bacteria | 1100 |
| 249 | Ga0265313_10334902 | 3300031595 | Bacteria | 602 |
| 250 | Ga0265314_10007161 | 3300031711 | Bacteria | 9714 |
| 251 | Ga0265314_10019396 | 3300031711 | Bacteria | 5269 |
| 252 | Ga0265314_10111998 | 3300031711 | Bacteria | 1732 |
| 253 | Ga0265314_10272428 | 3300031711 | Bacteria | 961 |
| 254 | Ga0265314_10469608 | 3300031711 | Unclassified | 667 |
| 255 | Ga0265342_10005380 | 3300031712 | Bacteria | 9777 |
| 256 | Ga0265342_10215193 | 3300031712 | Bacteria | 1037 |
| 257 | Ga0307406_10116453 | 3300031901 | Bacteria | 1849 |
| 258 | Ga0307409_100091047 | 3300031995 | Bacteria | 2498 |
| 259 | Ga0307411_10120043 | 3300032005 | Bacteria | 1900 |
| 260 | Ga0307415_100023226 | 3300032126 | Bacteria | 3845 |
| 261 | Ga0373944_0135418 | 3300035089 | Unclassified | 859 |
| 262 | Ga0395900_0005281 | 3300037418 | Bacteria | 13540 |
| 263 | Ga0395900_0157148 | 3300037418 | Bacteria | 2322 |
| 264 | Ga0395898_0059724 | 3300037466 | Bacteria | 3708 |
| 265 | Ga0395898_0158574 | 3300037466 | Bacteria | 2164 |
| 266 | Ga0395905_0062800 | 3300037471 | Bacteria | 3474 |
| 267 | Ga0395901_0002456 | 3300038443 | Bacteria | 18794 |
| 268 | Ga0395901_0093963 | 3300038443 | Bacteria | 3141 |
| 269 | Ga0451577_0114423 | 3300042876 | Bacteria | 2415 |
| 270 | Ga0453683_0288198 | 3300044673 | Bacteria | 1049 |
| 271 | Ga0453683_1097914 | 3300044673 | Bacteria | 530 |
| 272 | Ga0453684_0011100 | 3300044712 | Bacteria | 15200 |
| 273 | Ga0453684_0559872 | 3300044712 | Bacteria | 1258 |
| 274 | Ga0451576_0036414 | 3300045051 | Bacteria | 5217 |
| 275 | Ga0451576_0059644 | 3300045051 | Bacteria | 3983 |
| 276 | Ga0466958_0354566 | 3300045836 | Bacteria | 945 |
| 277 | Ga0495628_0028531 | 3300046516 | Bacteria | 4533 |
| 278 | Ga0495674_0717544 | 3300047319 | Unclassified | 783 |
| 279 | Ga0501032_0215077 | 3300049569 | Bacteria | 1252 |
| 280 | Ga0501034_0002581 | 3300049571 | Bacteria | 21539 |
| 281 | Ga0501034_0010282 | 3300049571 | Bacteria | 9757 |
| 282 | Ga0501034_0083345 | 3300049571 | Bacteria | 3199 |
| 283 | Ga0501036_0068508 | 3300049572 | Bacteria | 3003 |
| 284 | Ga0501038_0264351 | 3300049574 | Bacteria | 1358 |
| 285 | Ga0501038_0564584 | 3300049574 | Bacteria | 864 |
| 286 | Ga0501041_0169311 | 3300049577 | Bacteria | 1367 |
| 287 | Ga0501047_0000397 | 3300049581 | Bacteria | 48886 |
| 288 | Ga0501047_0018551 | 3300049581 | Bacteria | 6671 |
| 289 | Ga0501047_0117084 | 3300049581 | Bacteria | 2546 |
| 290 | Ga0501073_0113640 | 3300049589 | Bacteria | 1878 |
| 291 | Ga0501083_0005553 | 3300049744 | Bacteria | 8941 |
| 292 | Ga0501083_0169109 | 3300049744 | Bacteria | 1429 |
| 293 | Ga0501035_0000033 | 3300049822 | Bacteria | 175087 |
| 294 | Ga0501044_0165989 | 3300049823 | Bacteria | 2182 |
| 295 | nmdc:mga0yw44_29003_c1 | 3300050492 | Bacteria | 3190 |
| 296 | nmdc:mga0k408_114_c1 | 3300050493 | Bacteria | 39328 |
| 297 | nmdc:mga08y16_634194_c1 | 3300050511 | Bacteria | 1074 |
| 298 | nmdc:mga08x19_27202_c1 | 3300050514 | Unclassified | 3576 |
| 299 | Ga0495601_0098796 | 3300053077 | Bacteria | 1884 |
| 300 | Ga0500556_0001728 | 3300053104 | Bacteria | 8249 |
| 301 | Ga0500556_0005758 | 3300053104 | Bacteria | 3507 |
| 302 | Ga0500556_0108950 | 3300053104 | Unclassified | 1073 |
| 303 | Ga0500628_167022 | 3300053129 | Unclassified | 623 |
| 304 | Ga0500588_0056581 | 3300053146 | Bacteria | 1242 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028577 | Ga0265318_10011506 | Ga0265318_100115064 | 118 |
| 2 | 3300028800 | Ga0265338_10090631 | Ga0265338_100906314 | 118 |
| 3 | 3300031240 | Ga0265320_10093688 | Ga0265320_100936883 | 118 |
| 4 | 3300031344 | Ga0265316_10348382 | Ga0265316_103483822 | 118 |
| 5 | 3300031595 | Ga0265313_10007292 | Ga0265313_1000729210 | 118 |
| 6 | 3300031711 | Ga0265314_10019396 | Ga0265314_100193962 | 118 |
| 7 | 3300031238 | Ga0265332_10174258 | Ga0265332_101742581 | 131 |
| 8 | 3300031247 | Ga0265340_10239722 | Ga0265340_102397222 | 131 |
| 9 | 3300053104 | Ga0500556_0005758 | Ga0500556_0005758_1739_2173 | 139 |
| 10 | 3300031595 | Ga0265313_10128406 | Ga0265313_101284063 | 140 |
| 11 | 3300031711 | Ga0265314_10469608 | Ga0265314_104696081 | 140 |
| 12 | 3300053104 | Ga0500556_0108950 | Ga0500556_0108950_155_637 | 140 |
| 13 | 3300005339 | Ga0070660_100000565 | Ga0070660_1000005658 | 141 |
| 14 | 3300005435 | Ga0070714_100000374 | Ga0070714_10000037427 | 141 |
| 15 | 3300005444 | Ga0070694_100431375 | Ga0070694_1004313752 | 141 |
| 16 | 3300005530 | Ga0070679_100311006 | Ga0070679_1003110062 | 141 |
| 17 | 3300005563 | Ga0068855_100054831 | Ga0068855_1000548313 | 141 |
| 18 | 3300025919 | Ga0207657_10000309 | Ga0207657_1000030919 | 141 |
| 19 | 3300025921 | Ga0207652_10251815 | Ga0207652_102518152 | 141 |
| 20 | 3300025929 | Ga0207664_10000269 | Ga0207664_1000026927 | 141 |
| 21 | 3300025949 | Ga0207667_10367933 | Ga0207667_103679332 | 141 |
| 22 | 3300049577 | Ga0501041_0169311 | Ga0501041_0169311_307_744 | 141 |
| 23 | 3300005327 | Ga0070658_10072089 | Ga0070658_100720892 | 142 |
| 24 | 3300005458 | Ga0070681_10172057 | Ga0070681_101720571 | 142 |
| 25 | 3300005530 | Ga0070679_100000652 | Ga0070679_1000006523 | 142 |
| 26 | 3300005544 | Ga0070686_100086588 | Ga0070686_1000865882 | 142 |
| 27 | 3300005544 | Ga0070686_100136287 | Ga0070686_1001362872 | 142 |
| 28 | 3300009093 | Ga0105240_10013363 | Ga0105240_100133638 | 142 |
| 29 | 3300009174 | Ga0105241_10380755 | Ga0105241_103807551 | 142 |
| 30 | 3300010375 | Ga0105239_10004097 | Ga0105239_1000409716 | 142 |
| 31 | 3300013105 | Ga0157369_10136313 | Ga0157369_101363133 | 142 |
| 32 | 3300013105 | Ga0157369_10152376 | Ga0157369_101523762 | 142 |
| 33 | 3300025909 | Ga0207705_10107304 | Ga0207705_101073042 | 142 |
| 34 | 3300025911 | Ga0207654_10124777 | Ga0207654_101247772 | 142 |
| 35 | 3300025921 | Ga0207652_10382836 | Ga0207652_103828362 | 142 |
| 36 | 3300044673 | Ga0453683_1097914 | Ga0453683_1097914_75_518 | 142 |
| 37 | 3300044712 | Ga0453684_0559872 | Ga0453684_0559872_359_805 | 142 |
| 38 | 3300049571 | Ga0501034_0083345 | Ga0501034_0083345_1479_1919 | 142 |
| 39 | 3300049581 | Ga0501047_0018551 | Ga0501047_0018551_4484_4924 | 142 |
| 40 | 3300005290 | Ga0065712_10250567 | Ga0065712_102505672 | 143 |
| 41 | 3300005293 | Ga0065715_10152739 | Ga0065715_101527392 | 143 |
| 42 | 3300005329 | Ga0070683_100167041 | Ga0070683_1001670413 | 143 |
| 43 | 3300005329 | Ga0070683_101202777 | Ga0070683_1012027771 | 143 |
| 44 | 3300005356 | Ga0070674_100875533 | Ga0070674_1008755331 | 143 |
| 45 | 3300005364 | Ga0070673_101034304 | Ga0070673_1010343042 | 143 |
| 46 | 3300005365 | Ga0070688_101180121 | Ga0070688_1011801211 | 143 |
| 47 | 3300005367 | Ga0070667_100558679 | Ga0070667_1005586792 | 143 |
| 48 | 3300005435 | Ga0070714_100014460 | Ga0070714_1000144607 | 143 |
| 49 | 3300005440 | Ga0070705_100159283 | Ga0070705_1001592832 | 143 |
| 50 | 3300005445 | Ga0070708_100021994 | Ga0070708_1000219944 | 143 |
| 51 | 3300005445 | Ga0070708_100031588 | Ga0070708_1000315882 | 143 |
| 52 | 3300005445 | Ga0070708_100059770 | Ga0070708_1000597701 | 143 |
| 53 | 3300005445 | Ga0070708_100479620 | Ga0070708_1004796202 | 143 |
| 54 | 3300005445 | Ga0070708_100797640 | Ga0070708_1007976401 | 143 |
| 55 | 3300005467 | Ga0070706_100353653 | Ga0070706_1003536532 | 143 |
| 56 | 3300005467 | Ga0070706_100486102 | Ga0070706_1004861022 | 143 |
| 57 | 3300005468 | Ga0070707_100012728 | Ga0070707_1000127282 | 143 |
| 58 | 3300005468 | Ga0070707_100056316 | Ga0070707_1000563162 | 143 |
| 59 | 3300005468 | Ga0070707_100402162 | Ga0070707_1004021621 | 143 |
| 60 | 3300005468 | Ga0070707_100496239 | Ga0070707_1004962392 | 143 |
| 61 | 3300005471 | Ga0070698_100008134 | Ga0070698_1000081345 | 143 |
| 62 | 3300005471 | Ga0070698_100055513 | Ga0070698_1000555135 | 143 |
| 63 | 3300005471 | Ga0070698_100523158 | Ga0070698_1005231581 | 143 |
| 64 | 3300005518 | Ga0070699_100188166 | Ga0070699_1001881661 | 143 |
| 65 | 3300005518 | Ga0070699_101688277 | Ga0070699_1016882771 | 143 |
| 66 | 3300005530 | Ga0070679_100000876 | Ga0070679_10000087623 | 143 |
| 67 | 3300005530 | Ga0070679_100117587 | Ga0070679_1001175872 | 143 |
| 68 | 3300005530 | Ga0070679_100499687 | Ga0070679_1004996872 | 143 |
| 69 | 3300005530 | Ga0070679_101016071 | Ga0070679_1010160712 | 143 |
| 70 | 3300005535 | Ga0070684_100091583 | Ga0070684_1000915832 | 143 |
| 71 | 3300005535 | Ga0070684_101451018 | Ga0070684_1014510181 | 143 |
| 72 | 3300005536 | Ga0070697_100004034 | Ga0070697_1000040347 | 143 |
| 73 | 3300005536 | Ga0070697_100984233 | Ga0070697_1009842331 | 143 |
| 74 | 3300005539 | Ga0068853_100029637 | Ga0068853_1000296373 | 143 |
| 75 | 3300005546 | Ga0070696_100494161 | Ga0070696_1004941612 | 143 |
| 76 | 3300005563 | Ga0068855_100011595 | Ga0068855_10001159511 | 143 |
| 77 | 3300005563 | Ga0068855_100016848 | Ga0068855_1000168484 | 143 |
| 78 | 3300005563 | Ga0068855_100137462 | Ga0068855_1001374624 | 143 |
| 79 | 3300005563 | Ga0068855_100383926 | Ga0068855_1003839262 | 143 |
| 80 | 3300005577 | Ga0068857_100004295 | Ga0068857_1000042958 | 143 |
| 81 | 3300005577 | Ga0068857_100045243 | Ga0068857_1000452434 | 143 |
| 82 | 3300005577 | Ga0068857_100131698 | Ga0068857_1001316983 | 143 |
| 83 | 3300005614 | Ga0068856_100037200 | Ga0068856_1000372003 | 143 |
| 84 | 3300005614 | Ga0068856_100053736 | Ga0068856_1000537362 | 143 |
| 85 | 3300005616 | Ga0068852_100000001 | Ga0068852_100000001491 | 143 |
| 86 | 3300005616 | Ga0068852_100059093 | Ga0068852_1000590933 | 143 |
| 87 | 3300005719 | Ga0068861_100367854 | Ga0068861_1003678542 | 143 |
| 88 | 3300005842 | Ga0068858_100035290 | Ga0068858_1000352905 | 143 |
| 89 | 3300005843 | Ga0068860_100256173 | Ga0068860_1002561732 | 143 |
| 90 | 3300005985 | Ga0081539_10001746 | Ga0081539_1000174625 | 143 |
| 91 | 3300006028 | Ga0070717_10003528 | Ga0070717_100035288 | 143 |
| 92 | 3300006028 | Ga0070717_10021890 | Ga0070717_100218904 | 143 |
| 93 | 3300006028 | Ga0070717_10141295 | Ga0070717_101412953 | 143 |
| 94 | 3300006038 | Ga0075365_10029697 | Ga0075365_100296975 | 143 |
| 95 | 3300006051 | Ga0075364_10567702 | Ga0075364_105677022 | 143 |
| 96 | 3300006173 | Ga0070716_100081028 | Ga0070716_1000810282 | 143 |
| 97 | 3300006195 | Ga0075366_10000044 | Ga0075366_1000004440 | 143 |
| 98 | 3300006195 | Ga0075366_10354867 | Ga0075366_103548672 | 143 |
| 99 | 3300006914 | Ga0075436_100028465 | Ga0075436_1000284651 | 143 |
| 100 | 3300009093 | Ga0105240_10064650 | Ga0105240_100646504 | 143 |
| 101 | 3300009093 | Ga0105240_10289760 | Ga0105240_102897602 | 143 |
| 102 | 3300009098 | Ga0105245_10000001 | Ga0105245_10000001410 | 143 |
| 103 | 3300009098 | Ga0105245_10048498 | Ga0105245_100484981 | 143 |
| 104 | 3300009098 | Ga0105245_10086634 | Ga0105245_100866344 | 143 |
| 105 | 3300009174 | Ga0105241_10023216 | Ga0105241_100232162 | 143 |
| 106 | 3300009174 | Ga0105241_10253580 | Ga0105241_102535802 | 143 |
| 107 | 3300009174 | Ga0105241_10910055 | Ga0105241_109100552 | 143 |
| 108 | 3300009545 | Ga0105237_10000002 | Ga0105237_10000002384 | 143 |
| 109 | 3300009551 | Ga0105238_10003523 | Ga0105238_100035232 | 143 |
| 110 | 3300009551 | Ga0105238_10038386 | Ga0105238_100383865 | 143 |
| 111 | 3300009551 | Ga0105238_10160480 | Ga0105238_101604803 | 143 |
| 112 | 3300009551 | Ga0105238_11074049 | Ga0105238_110740492 | 143 |
| 113 | 3300010375 | Ga0105239_11334434 | Ga0105239_113344342 | 143 |
| 114 | 3300013104 | Ga0157370_10617294 | Ga0157370_106172941 | 143 |
| 115 | 3300013104 | Ga0157370_10836093 | Ga0157370_108360932 | 143 |
| 116 | 3300013105 | Ga0157369_10180338 | Ga0157369_101803382 | 143 |
| 117 | 3300013105 | Ga0157369_10194668 | Ga0157369_101946683 | 143 |
| 118 | 3300013105 | Ga0157369_10305663 | Ga0157369_103056632 | 143 |
| 119 | 3300013297 | Ga0157378_10062734 | Ga0157378_100627342 | 143 |
| 120 | 3300013297 | Ga0157378_10081209 | Ga0157378_100812094 | 143 |
| 121 | 3300013306 | Ga0163162_10500196 | Ga0163162_105001962 | 143 |
| 122 | 3300013307 | Ga0157372_10432924 | Ga0157372_104329242 | 143 |
| 123 | 3300014968 | Ga0157379_10248204 | Ga0157379_102482042 | 143 |
| 124 | 3300017792 | Ga0163161_10040972 | Ga0163161_100409723 | 143 |
| 125 | 3300025271 | Ga0207666_1005428 | Ga0207666_10054282 | 143 |
| 126 | 3300025315 | Ga0207697_10002964 | Ga0207697_100029645 | 143 |
| 127 | 3300025901 | Ga0207688_10060689 | Ga0207688_100606892 | 143 |
| 128 | 3300025903 | Ga0207680_10243705 | Ga0207680_102437051 | 143 |
| 129 | 3300025904 | Ga0207647_10489286 | Ga0207647_104892861 | 143 |
| 130 | 3300025911 | Ga0207654_10007261 | Ga0207654_100072616 | 143 |
| 131 | 3300025911 | Ga0207654_10398304 | Ga0207654_103983042 | 143 |
| 132 | 3300025911 | Ga0207654_10735958 | Ga0207654_107359582 | 143 |
| 133 | 3300025912 | Ga0207707_10046886 | Ga0207707_100468864 | 143 |
| 134 | 3300025913 | Ga0207695_10085923 | Ga0207695_100859233 | 143 |
| 135 | 3300025914 | Ga0207671_10000008 | Ga0207671_10000008489 | 143 |
| 136 | 3300025915 | Ga0207693_10013742 | Ga0207693_100137425 | 143 |
| 137 | 3300025915 | Ga0207693_10141902 | Ga0207693_101419023 | 143 |
| 138 | 3300025916 | Ga0207663_10130086 | Ga0207663_101300862 | 143 |
| 139 | 3300025917 | Ga0207660_10001756 | Ga0207660_1000175615 | 143 |
| 140 | 3300025918 | Ga0207662_10003795 | Ga0207662_100037958 | 143 |
| 141 | 3300025921 | Ga0207652_10000906 | Ga0207652_1000090621 | 143 |
| 142 | 3300025921 | Ga0207652_10004857 | Ga0207652_100048578 | 143 |
| 143 | 3300025921 | Ga0207652_10496524 | Ga0207652_104965242 | 143 |
| 144 | 3300025921 | Ga0207652_10865105 | Ga0207652_108651052 | 143 |
| 145 | 3300025922 | Ga0207646_10014338 | Ga0207646_100143387 | 143 |
| 146 | 3300025922 | Ga0207646_10043209 | Ga0207646_100432095 | 143 |
| 147 | 3300025922 | Ga0207646_10116601 | Ga0207646_101166013 | 143 |
| 148 | 3300025922 | Ga0207646_10123370 | Ga0207646_101233704 | 143 |
| 149 | 3300025922 | Ga0207646_10211255 | Ga0207646_102112552 | 143 |
| 150 | 3300025922 | Ga0207646_10243830 | Ga0207646_102438302 | 143 |
| 151 | 3300025923 | Ga0207681_10014846 | Ga0207681_100148462 | 143 |
| 152 | 3300025924 | Ga0207694_10000890 | Ga0207694_1000089026 | 143 |
| 153 | 3300025924 | Ga0207694_10074130 | Ga0207694_100741303 | 143 |
| 154 | 3300025927 | Ga0207687_10000030 | Ga0207687_1000003029 | 143 |
| 155 | 3300025929 | Ga0207664_10257825 | Ga0207664_102578251 | 143 |
| 156 | 3300025929 | Ga0207664_11002019 | Ga0207664_110020192 | 143 |
| 157 | 3300025933 | Ga0207706_10011823 | Ga0207706_100118236 | 143 |
| 158 | 3300025936 | Ga0207670_10069921 | Ga0207670_100699212 | 143 |
| 159 | 3300025940 | Ga0207691_10270795 | Ga0207691_102707952 | 143 |
| 160 | 3300025942 | Ga0207689_10256121 | Ga0207689_102561212 | 143 |
| 161 | 3300025944 | Ga0207661_10336417 | Ga0207661_103364171 | 143 |
| 162 | 3300025944 | Ga0207661_10432235 | Ga0207661_104322352 | 143 |
| 163 | 3300025949 | Ga0207667_10002118 | Ga0207667_1000211810 | 143 |
| 164 | 3300025949 | Ga0207667_10006467 | Ga0207667_1000646715 | 143 |
| 165 | 3300025949 | Ga0207667_10021272 | Ga0207667_100212724 | 143 |
| 166 | 3300025949 | Ga0207667_10140042 | Ga0207667_101400422 | 143 |
| 167 | 3300025961 | Ga0207712_10029860 | Ga0207712_100298602 | 143 |
| 168 | 3300025972 | Ga0207668_10200820 | Ga0207668_102008202 | 143 |
| 169 | 3300025986 | Ga0207658_10032506 | Ga0207658_100325065 | 143 |
| 170 | 3300025986 | Ga0207658_10529778 | Ga0207658_105297782 | 143 |
| 171 | 3300026023 | Ga0207677_10016569 | Ga0207677_100165693 | 143 |
| 172 | 3300026035 | Ga0207703_10033671 | Ga0207703_100336712 | 143 |
| 173 | 3300026078 | Ga0207702_10087897 | Ga0207702_100878973 | 143 |
| 174 | 3300026078 | Ga0207702_10237360 | Ga0207702_102373603 | 143 |
| 175 | 3300026089 | Ga0207648_10513420 | Ga0207648_105134202 | 143 |
| 176 | 3300026116 | Ga0207674_10008732 | Ga0207674_100087327 | 143 |
| 177 | 3300026116 | Ga0207674_10011447 | Ga0207674_1001144710 | 143 |
| 178 | 3300026116 | Ga0207674_10057197 | Ga0207674_100571974 | 143 |
| 179 | 3300026118 | Ga0207675_100199074 | Ga0207675_1001990742 | 143 |
| 180 | 3300026142 | Ga0207698_10000001 | Ga0207698_10000001442 | 143 |
| 181 | 3300026142 | Ga0207698_10735489 | Ga0207698_107354892 | 143 |
| 182 | 3300028380 | Ga0268265_10063717 | Ga0268265_100637172 | 143 |
| 183 | 3300028381 | Ga0268264_10233173 | Ga0268264_102331733 | 143 |
| 184 | 3300028556 | Ga0265337_1000001 | Ga0265337_1000001161 | 143 |
| 185 | 3300028556 | Ga0265337_1001897 | Ga0265337_100189710 | 143 |
| 186 | 3300028556 | Ga0265337_1001932 | Ga0265337_100193211 | 143 |
| 187 | 3300028556 | Ga0265337_1002922 | Ga0265337_10029222 | 143 |
| 188 | 3300028556 | Ga0265337_1005837 | Ga0265337_10058374 | 143 |
| 189 | 3300028558 | Ga0265326_10000303 | Ga0265326_100003035 | 143 |
| 190 | 3300028558 | Ga0265326_10001540 | Ga0265326_100015402 | 143 |
| 191 | 3300028558 | Ga0265326_10004220 | Ga0265326_100042206 | 143 |
| 192 | 3300028558 | Ga0265326_10037183 | Ga0265326_100371833 | 143 |
| 193 | 3300028558 | Ga0265326_10050454 | Ga0265326_100504542 | 143 |
| 194 | 3300028563 | Ga0265319_1008118 | Ga0265319_10081184 | 143 |
| 195 | 3300028563 | Ga0265319_1030009 | Ga0265319_10300092 | 143 |
| 196 | 3300028573 | Ga0265334_10000049 | Ga0265334_1000004983 | 143 |
| 197 | 3300028573 | Ga0265334_10003511 | Ga0265334_100035112 | 143 |
| 198 | 3300028573 | Ga0265334_10004026 | Ga0265334_100040266 | 143 |
| 199 | 3300028573 | Ga0265334_10025136 | Ga0265334_100251361 | 143 |
| 200 | 3300028573 | Ga0265334_10038813 | Ga0265334_100388132 | 143 |
| 201 | 3300028573 | Ga0265334_10095985 | Ga0265334_100959852 | 143 |
| 202 | 3300028577 | Ga0265318_10003578 | Ga0265318_100035789 | 143 |
| 203 | 3300028577 | Ga0265318_10116134 | Ga0265318_101161342 | 143 |
| 204 | 3300028653 | Ga0265323_10005117 | Ga0265323_100051174 | 143 |
| 205 | 3300028654 | Ga0265322_10001961 | Ga0265322_100019619 | 143 |
| 206 | 3300028654 | Ga0265322_10083645 | Ga0265322_100836452 | 143 |
| 207 | 3300028666 | Ga0265336_10000047 | Ga0265336_1000004762 | 143 |
| 208 | 3300028666 | Ga0265336_10002635 | Ga0265336_100026357 | 143 |
| 209 | 3300028666 | Ga0265336_10002777 | Ga0265336_100027772 | 143 |
| 210 | 3300028666 | Ga0265336_10005536 | Ga0265336_100055362 | 143 |
| 211 | 3300028800 | Ga0265338_10000003 | Ga0265338_10000003435 | 143 |
| 212 | 3300028800 | Ga0265338_10000039 | Ga0265338_10000039228 | 143 |
| 213 | 3300028800 | Ga0265338_10000054 | Ga0265338_10000054223 | 143 |
| 214 | 3300028800 | Ga0265338_10000178 | Ga0265338_1000017835 | 143 |
| 215 | 3300028800 | Ga0265338_10000482 | Ga0265338_100004828 | 143 |
| 216 | 3300028800 | Ga0265338_10002389 | Ga0265338_1000238930 | 143 |
| 217 | 3300028800 | Ga0265338_10013060 | Ga0265338_100130603 | 143 |
| 218 | 3300028800 | Ga0265338_10030929 | Ga0265338_100309295 | 143 |
| 219 | 3300028800 | Ga0265338_10076270 | Ga0265338_100762703 | 143 |
| 220 | 3300028800 | Ga0265338_10100438 | Ga0265338_101004382 | 143 |
| 221 | 3300028800 | Ga0265338_10139574 | Ga0265338_101395742 | 143 |
| 222 | 3300028800 | Ga0265338_10149692 | Ga0265338_101496922 | 143 |
| 223 | 3300028800 | Ga0265338_10182989 | Ga0265338_101829893 | 143 |
| 224 | 3300028800 | Ga0265338_10242244 | Ga0265338_102422442 | 143 |
| 225 | 3300028800 | Ga0265338_10350161 | Ga0265338_103501611 | 143 |
| 226 | 3300029957 | Ga0265324_10011104 | Ga0265324_100111043 | 143 |
| 227 | 3300029957 | Ga0265324_10023814 | Ga0265324_100238143 | 143 |
| 228 | 3300029957 | Ga0265324_10025215 | Ga0265324_100252152 | 143 |
| 229 | 3300031235 | Ga0265330_10009761 | Ga0265330_100097613 | 143 |
| 230 | 3300031235 | Ga0265330_10081468 | Ga0265330_100814682 | 143 |
| 231 | 3300031238 | Ga0265332_10003382 | Ga0265332_100033822 | 143 |
| 232 | 3300031238 | Ga0265332_10233944 | Ga0265332_102339442 | 143 |
| 233 | 3300031239 | Ga0265328_10012928 | Ga0265328_100129283 | 143 |
| 234 | 3300031240 | Ga0265320_10009368 | Ga0265320_100093687 | 143 |
| 235 | 3300031240 | Ga0265320_10020970 | Ga0265320_100209702 | 143 |
| 236 | 3300031240 | Ga0265320_10132006 | Ga0265320_101320062 | 143 |
| 237 | 3300031241 | Ga0265325_10014388 | Ga0265325_100143883 | 143 |
| 238 | 3300031241 | Ga0265325_10018573 | Ga0265325_100185732 | 143 |
| 239 | 3300031241 | Ga0265325_10139795 | Ga0265325_101397952 | 143 |
| 240 | 3300031241 | Ga0265325_10162559 | Ga0265325_101625592 | 143 |
| 241 | 3300031242 | Ga0265329_10008151 | Ga0265329_100081513 | 143 |
| 242 | 3300031247 | Ga0265340_10019710 | Ga0265340_100197105 | 143 |
| 243 | 3300031247 | Ga0265340_10079875 | Ga0265340_100798753 | 143 |
| 244 | 3300031249 | Ga0265339_10052767 | Ga0265339_100527672 | 143 |
| 245 | 3300031249 | Ga0265339_10059147 | Ga0265339_100591473 | 143 |
| 246 | 3300031250 | Ga0265331_10003494 | Ga0265331_100034944 | 143 |
| 247 | 3300031251 | Ga0265327_10017578 | Ga0265327_100175784 | 143 |
| 248 | 3300031251 | Ga0265327_10033859 | Ga0265327_100338592 | 143 |
| 249 | 3300031251 | Ga0265327_10067732 | Ga0265327_100677322 | 143 |
| 250 | 3300031251 | Ga0265327_10070631 | Ga0265327_100706312 | 143 |
| 251 | 3300031251 | Ga0265327_10157489 | Ga0265327_101574892 | 143 |
| 252 | 3300031344 | Ga0265316_10050602 | Ga0265316_100506023 | 143 |
| 253 | 3300031344 | Ga0265316_10085616 | Ga0265316_100856162 | 143 |
| 254 | 3300031344 | Ga0265316_10279838 | Ga0265316_102798382 | 143 |
| 255 | 3300031595 | Ga0265313_10005537 | Ga0265313_1000553711 | 143 |
| 256 | 3300031595 | Ga0265313_10034726 | Ga0265313_100347262 | 143 |
| 257 | 3300031595 | Ga0265313_10074012 | Ga0265313_100740122 | 143 |
| 258 | 3300031595 | Ga0265313_10334902 | Ga0265313_103349021 | 143 |
| 259 | 3300031711 | Ga0265314_10007161 | Ga0265314_100071619 | 143 |
| 260 | 3300031711 | Ga0265314_10111998 | Ga0265314_101119982 | 143 |
| 261 | 3300031711 | Ga0265314_10272428 | Ga0265314_102724282 | 143 |
| 262 | 3300031712 | Ga0265342_10005380 | Ga0265342_100053809 | 143 |
| 263 | 3300031712 | Ga0265342_10215193 | Ga0265342_102151931 | 143 |
| 264 | 3300031901 | Ga0307406_10116453 | Ga0307406_101164533 | 143 |
| 265 | 3300031995 | Ga0307409_100091047 | Ga0307409_1000910473 | 143 |
| 266 | 3300032005 | Ga0307411_10120043 | Ga0307411_101200432 | 143 |
| 267 | 3300032126 | Ga0307415_100023226 | Ga0307415_1000232264 | 143 |
| 268 | 3300035089 | Ga0373944_0135418 | Ga0373944_0135418_117_611 | 143 |
| 269 | 3300037418 | Ga0395900_0005281 | Ga0395900_0005281_10882_11313 | 143 |
| 270 | 3300037418 | Ga0395900_0157148 | Ga0395900_0157148_1387_1881 | 143 |
| 271 | 3300037466 | Ga0395898_0059724 | Ga0395898_0059724_2666_3097 | 143 |
| 272 | 3300037466 | Ga0395898_0158574 | Ga0395898_0158574_450_944 | 143 |
| 273 | 3300037471 | Ga0395905_0062800 | Ga0395905_0062800_497_928 | 143 |
| 274 | 3300038443 | Ga0395901_0002456 | Ga0395901_0002456_16113_16544 | 143 |
| 275 | 3300038443 | Ga0395901_0093963 | Ga0395901_0093963_1825_2319 | 143 |
| 276 | 3300042876 | Ga0451577_0114423 | Ga0451577_0114423_455_904 | 143 |
| 277 | 3300044673 | Ga0453683_0288198 | Ga0453683_0288198_200_682 | 143 |
| 278 | 3300044712 | Ga0453684_0011100 | Ga0453684_0011100_6384_6833 | 143 |
| 279 | 3300045051 | Ga0451576_0036414 | Ga0451576_0036414_1230_1679 | 143 |
| 280 | 3300045051 | Ga0451576_0059644 | Ga0451576_0059644_1494_1961 | 143 |
| 281 | 3300045836 | Ga0466958_0354566 | Ga0466958_0354566_264_749 | 143 |
| 282 | 3300046516 | Ga0495628_0028531 | Ga0495628_0028531_1918_2391 | 143 |
| 283 | 3300047319 | Ga0495674_0717544 | Ga0495674_0717544_249_722 | 143 |
| 284 | 3300049569 | Ga0501032_0215077 | Ga0501032_0215077_197_691 | 143 |
| 285 | 3300049571 | Ga0501034_0002581 | Ga0501034_0002581_14700_15146 | 143 |
| 286 | 3300049571 | Ga0501034_0010282 | Ga0501034_0010282_6485_6979 | 143 |
| 287 | 3300049572 | Ga0501036_0068508 | Ga0501036_0068508_1945_2439 | 143 |
| 288 | 3300049574 | Ga0501038_0264351 | Ga0501038_0264351_745_1239 | 143 |
| 289 | 3300049574 | Ga0501038_0564584 | Ga0501038_0564584_213_659 | 143 |
| 290 | 3300049581 | Ga0501047_0000397 | Ga0501047_0000397_36298_36792 | 143 |
| 291 | 3300049581 | Ga0501047_0117084 | Ga0501047_0117084_1053_1499 | 143 |
| 292 | 3300049589 | Ga0501073_0113640 | Ga0501073_0113640_462_971 | 143 |
| 293 | 3300049744 | Ga0501083_0005553 | Ga0501083_0005553_738_1232 | 143 |
| 294 | 3300049744 | Ga0501083_0169109 | Ga0501083_0169109_15_509 | 143 |
| 295 | 3300049822 | Ga0501035_0000033 | Ga0501035_0000033_85412_85906 | 143 |
| 296 | 3300049823 | Ga0501044_0165989 | Ga0501044_0165989_1555_2049 | 143 |
| 297 | 3300050492 | nmdc:mga0yw44_29003_c1 | nmdc:mga0yw44_29003_c1_2434_2931 | 143 |
| 298 | 3300050493 | nmdc:mga0k408_114_c1 | nmdc:mga0k408_114_c1_13853_14350 | 143 |
| 299 | 3300050511 | nmdc:mga08y16_634194_c1 | nmdc:mga08y16_634194_c1_540_998 | 143 |
| 300 | 3300050514 | nmdc:mga08x19_27202_c1 | nmdc:mga08x19_27202_c1_2935_3366 | 143 |
| 301 | 3300053077 | Ga0495601_0098796 | Ga0495601_0098796_598_1071 | 143 |
| 302 | 3300053104 | Ga0500556_0001728 | Ga0500556_0001728_4236_4700 | 143 |
| 303 | 3300053129 | Ga0500628_167022 | Ga0500628_167022_81_584 | 143 |
| 304 | 3300053146 | Ga0500588_0056581 | Ga0500588_0056581_362_859 | 143 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ph4-assembly1.cif.gz_A | clostridium thermocellum ribose-5-phosphate isomerase b with d-allose | 0.9835 | 1 | 142 |
| 1nn4-assembly1.cif.gz_A | structural genomics, rpib/alsb | 0.9777 | 2 | 142 |
| 2vvr-assembly1.cif.gz_A | crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate | 0.9771 | 2 | 142 |
| 4lfk-assembly1.cif.gz_B | crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form | 0.9736 | 1 | 143 |
| 3ph4-assembly1.cif.gz_A | clostridium thermocellum ribose-5-phosphate isomerase b with d-allose | 0.97 | 1 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nn4D00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9772 | 2 | 142 | 3.40.1400.10 |
| 4lfkB00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9736 | 1 | 143 | 3.40.1400.10 |
| 4lfkB00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.967 | 1 | 143 | 3.40.1400.10 |
| 3s5pB00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9624 | 1 | 128 | 3.40.1400.10 |
| 1o1xA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9606 | 2 | 143 | 3.40.1400.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6JTY0-F1-model_v4 | Ribose-5-phosphate isomerase | 1.005 | 1 | 125 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A2V6B4V8-F1-model_v4 | Ribose-5-phosphate isomerase | 1.004 | 1 | 118 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A2V6HBS0-F1-model_v4 | Ribose 5-phosphate isomerase B | 1.003 | 1 | 143 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A2V6LHR3-F1-model_v4 | Ribose 5-phosphate isomerase B | 1.001 | 1 | 143 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-A0A2V6D0B3-F1-model_v4 | Ribose 5-phosphate isomerase B | 1 | 1 | 143 |
GO:0004751
GO:0009052 GO:0019316 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar