F397642

General Info

Members Datasets Scaffolds Average Seq Length
304 148 304 158

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10139574|Ga0265338_101395742
Length 170
Sequence MALIGSKMIIALATDHAGFTQAAELEEYLKSLGYGCRSFGPKTLDPQDDYPDFIKPAAKAVASGECQKGIILGGSGQGEAMAANRVHGVRCAVFYGPAVPRRVVDAEGRTSHDPYEIVRLSRQHNDANMLSLAARFVSFKDMKQVIKLWLDTPFSDESRHQRRIKELDEL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
97 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
98 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
107 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
126 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
142 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
147 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
148 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 0
Rhizosphere 96.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10250567 3300005290 Unclassified 918
2 Ga0065715_10152739 3300005293 Unclassified 1710
3 Ga0070658_10072089 3300005327 Bacteria 2830
4 Ga0070683_100167041 3300005329 Bacteria 2088
5 Ga0070683_101202777 3300005329 Unclassified 728
6 Ga0070660_100000565 3300005339 Bacteria 24858
7 Ga0070674_100875533 3300005356 Bacteria 781
8 Ga0070673_101034304 3300005364 Unclassified 766
9 Ga0070688_101180121 3300005365 Bacteria 614
10 Ga0070667_100558679 3300005367 Unclassified 1052
11 Ga0070714_100000374 3300005435 Bacteria 33426
12 Ga0070714_100014460 3300005435 Bacteria 6340
13 Ga0070705_100159283 3300005440 Bacteria 1507
14 Ga0070694_100431375 3300005444 Bacteria 1037
15 Ga0070708_100021994 3300005445 Bacteria 5405
16 Ga0070708_100031588 3300005445 Bacteria 4585
17 Ga0070708_100059770 3300005445 Unclassified 3399
18 Ga0070708_100479620 3300005445 Bacteria 1173
19 Ga0070708_100797640 3300005445 Bacteria 888
20 Ga0070681_10172057 3300005458 Bacteria 2088
21 Ga0070706_100353653 3300005467 Unclassified 1369
22 Ga0070706_100486102 3300005467 Bacteria 1149
23 Ga0070707_100012728 3300005468 Bacteria 7853
24 Ga0070707_100056316 3300005468 Bacteria 3771
25 Ga0070707_100402162 3300005468 Bacteria 1329
26 Ga0070707_100496239 3300005468 Bacteria 1182
27 Ga0070698_100008134 3300005471 Bacteria 11337
28 Ga0070698_100055513 3300005471 Unclassified 4016
29 Ga0070698_100523158 3300005471 Bacteria 1125
30 Ga0070699_100188166 3300005518 Bacteria 1833
31 Ga0070699_101688277 3300005518 Unclassified 580
32 Ga0070679_100000652 3300005530 Bacteria 29531
33 Ga0070679_100000876 3300005530 Bacteria 26140
34 Ga0070679_100117587 3300005530 Unclassified 2643
35 Ga0070679_100311006 3300005530 Bacteria 1525
36 Ga0070679_100499687 3300005530 Unclassified 1160
37 Ga0070679_101016071 3300005530 Unclassified 773
38 Ga0070684_100091583 3300005535 Bacteria 2705
39 Ga0070684_101451018 3300005535 Unclassified 646
40 Ga0070697_100004034 3300005536 Bacteria 11263
41 Ga0070697_100984233 3300005536 Bacteria 749
42 Ga0068853_100029637 3300005539 Bacteria 4616
43 Ga0070686_100086588 3300005544 Bacteria 2086
44 Ga0070686_100136287 3300005544 Bacteria 1704
45 Ga0070696_100494161 3300005546 Bacteria 972
46 Ga0068855_100011595 3300005563 Bacteria 10648
47 Ga0068855_100016848 3300005563 Bacteria 8791
48 Ga0068855_100054831 3300005563 Bacteria 4685
49 Ga0068855_100137462 3300005563 Bacteria 2787
50 Ga0068855_100383926 3300005563 Bacteria 1542
51 Ga0068857_100004295 3300005577 Bacteria 12019
52 Ga0068857_100045243 3300005577 Bacteria 3904
53 Ga0068857_100131698 3300005577 Bacteria 2255
54 Ga0068856_100037200 3300005614 Unclassified 4775
55 Ga0068856_100053736 3300005614 Unclassified 3972
56 Ga0068852_100000001 3300005616 Bacteria 716526
57 Ga0068852_100059093 3300005616 Bacteria 3324
58 Ga0068861_100367854 3300005719 Bacteria 1266
59 Ga0068858_100035290 3300005842 Bacteria 4639
60 Ga0068860_100256173 3300005843 Bacteria 1705
61 Ga0081539_10001746 3300005985 Bacteria 34691
62 Ga0070717_10003528 3300006028 Bacteria 11213
63 Ga0070717_10021890 3300006028 Bacteria 5043
64 Ga0070717_10141295 3300006028 Bacteria 2077
65 Ga0075365_10029697 3300006038 Bacteria 3497
66 Ga0075364_10567702 3300006051 Bacteria 775
67 Ga0070716_100081028 3300006173 Unclassified 1937
68 Ga0075366_10000044 3300006195 Bacteria 45021
69 Ga0075366_10354867 3300006195 Bacteria 900
70 Ga0075436_100028465 3300006914 Unclassified 3844
71 Ga0105240_10013363 3300009093 Bacteria 11278
72 Ga0105240_10064650 3300009093 Bacteria 4545
73 Ga0105240_10289760 3300009093 Bacteria 1877
74 Ga0105245_10000001 3300009098 Bacteria 939270
75 Ga0105245_10048498 3300009098 Bacteria 3799
76 Ga0105245_10086634 3300009098 Bacteria 2873
77 Ga0105241_10023216 3300009174 Bacteria 4599
78 Ga0105241_10253580 3300009174 Bacteria 1493
79 Ga0105241_10380755 3300009174 Bacteria 1233
80 Ga0105241_10910055 3300009174 Bacteria 817
81 Ga0105237_10000002 3300009545 Bacteria 702357
82 Ga0105238_10003523 3300009551 Bacteria 15595
83 Ga0105238_10038386 3300009551 Bacteria 4864
84 Ga0105238_10160480 3300009551 Bacteria 2224
85 Ga0105238_11074049 3300009551 Unclassified 827
86 Ga0105239_10004097 3300010375 Bacteria 17527
87 Ga0105239_11334434 3300010375 Unclassified 828
88 Ga0157370_10617294 3300013104 Bacteria 992
89 Ga0157370_10836093 3300013104 Unclassified 837
90 Ga0157369_10136313 3300013105 Bacteria 2599
91 Ga0157369_10152376 3300013105 Bacteria 2443
92 Ga0157369_10180338 3300013105 Bacteria 2222
93 Ga0157369_10194668 3300013105 Bacteria 2129
94 Ga0157369_10305663 3300013105 Bacteria 1654
95 Ga0157378_10062734 3300013297 Bacteria 3319
96 Ga0157378_10081209 3300013297 Bacteria 2930
97 Ga0163162_10500196 3300013306 Bacteria 1346
98 Ga0157372_10432924 3300013307 Bacteria 1533
99 Ga0157379_10248204 3300014968 Bacteria 1615
100 Ga0163161_10040972 3300017792 Bacteria 3327
101 Ga0207666_1005428 3300025271 Bacteria 1629
102 Ga0207697_10002964 3300025315 Bacteria 8569
103 Ga0207688_10060689 3300025901 Bacteria 2130
104 Ga0207680_10243705 3300025903 Bacteria 1239
105 Ga0207647_10489286 3300025904 Unclassified 687
106 Ga0207705_10107304 3300025909 Bacteria 2060
107 Ga0207654_10007261 3300025911 Bacteria 5584
108 Ga0207654_10124777 3300025911 Bacteria 1621
109 Ga0207654_10398304 3300025911 Bacteria 956
110 Ga0207654_10735958 3300025911 Bacteria 710
111 Ga0207707_10046886 3300025912 Bacteria 3764
112 Ga0207695_10085923 3300025913 Bacteria 3174
113 Ga0207671_10000008 3300025914 Bacteria 798229
114 Ga0207693_10013742 3300025915 Bacteria 6522
115 Ga0207693_10141902 3300025915 Bacteria 1888
116 Ga0207663_10130086 3300025916 Bacteria 1738
117 Ga0207660_10001756 3300025917 Bacteria 14531
118 Ga0207662_10003795 3300025918 Bacteria 7838
119 Ga0207657_10000309 3300025919 Bacteria 51811
120 Ga0207652_10000906 3300025921 Bacteria 28011
121 Ga0207652_10004857 3300025921 Bacteria 10886
122 Ga0207652_10251815 3300025921 Bacteria 1593
123 Ga0207652_10382836 3300025921 Bacteria 1269
124 Ga0207652_10496524 3300025921 Unclassified 1099
125 Ga0207652_10865105 3300025921 Unclassified 800
126 Ga0207646_10014338 3300025922 Bacteria 7532
127 Ga0207646_10043209 3300025922 Bacteria 4048
128 Ga0207646_10116601 3300025922 Unclassified 2398
129 Ga0207646_10123370 3300025922 Unclassified 2328
130 Ga0207646_10211255 3300025922 Bacteria 1752
131 Ga0207646_10243830 3300025922 Bacteria 1623
132 Ga0207681_10014846 3300025923 Bacteria 4850
133 Ga0207694_10000890 3300025924 Bacteria 26483
134 Ga0207694_10074130 3300025924 Bacteria 2664
135 Ga0207687_10000030 3300025927 Bacteria 155548
136 Ga0207664_10000269 3300025929 Bacteria 39220
137 Ga0207664_10257825 3300025929 Bacteria 1524
138 Ga0207664_11002019 3300025929 Unclassified 749
139 Ga0207706_10011823 3300025933 Bacteria 7949
140 Ga0207670_10069921 3300025936 Bacteria 2423
141 Ga0207691_10270795 3300025940 Bacteria 1462
142 Ga0207689_10256121 3300025942 Unclassified 1447
143 Ga0207661_10336417 3300025944 Unclassified 1360
144 Ga0207661_10432235 3300025944 Bacteria 1197
145 Ga0207667_10002118 3300025949 Bacteria 24862
146 Ga0207667_10006467 3300025949 Bacteria 14176
147 Ga0207667_10021272 3300025949 Bacteria 7190
148 Ga0207667_10140042 3300025949 Bacteria 2491
149 Ga0207667_10367933 3300025949 Bacteria 1465
150 Ga0207712_10029860 3300025961 Bacteria 3661
151 Ga0207668_10200820 3300025972 Unclassified 1587
152 Ga0207658_10032506 3300025986 Bacteria 3713
153 Ga0207658_10529778 3300025986 Unclassified 1052
154 Ga0207677_10016569 3300026023 Bacteria 4370
155 Ga0207703_10033671 3300026035 Bacteria 4064
156 Ga0207702_10087897 3300026078 Unclassified 2714
157 Ga0207702_10237360 3300026078 Unclassified 1706
158 Ga0207648_10513420 3300026089 Bacteria 1097
159 Ga0207674_10008732 3300026116 Bacteria 11666
160 Ga0207674_10011447 3300026116 Bacteria 9968
161 Ga0207674_10057197 3300026116 Bacteria 3954
162 Ga0207675_100199074 3300026118 Bacteria 1924
163 Ga0207698_10000001 3300026142 Bacteria 625389
164 Ga0207698_10735489 3300026142 Unclassified 984
165 Ga0268265_10063717 3300028380 Bacteria 2837
166 Ga0268264_10233173 3300028381 Bacteria 1701
167 Ga0265337_1000001 3300028556 Bacteria 140973
168 Ga0265337_1001897 3300028556 Bacteria 9949
169 Ga0265337_1001932 3300028556 Bacteria 9853
170 Ga0265337_1002922 3300028556 Bacteria 7591
171 Ga0265337_1005837 3300028556 Unclassified 4825
172 Ga0265326_10000303 3300028558 Bacteria 21740
173 Ga0265326_10001540 3300028558 Bacteria 8064
174 Ga0265326_10004220 3300028558 Unclassified 4629
175 Ga0265326_10037183 3300028558 Unclassified 1384
176 Ga0265326_10050454 3300028558 Bacteria 1178
177 Ga0265319_1008118 3300028563 Bacteria 4634
178 Ga0265319_1030009 3300028563 Bacteria 1904
179 Ga0265334_10000049 3300028573 Bacteria 89091
180 Ga0265334_10003511 3300028573 Bacteria 7110
181 Ga0265334_10004026 3300028573 Bacteria 6596
182 Ga0265334_10025136 3300028573 Bacteria 2412
183 Ga0265334_10038813 3300028573 Bacteria 1871
184 Ga0265334_10095985 3300028573 Unclassified 1077
185 Ga0265318_10003578 3300028577 Bacteria 7775
186 Ga0265318_10011506 3300028577 Bacteria 3806
187 Ga0265318_10116134 3300028577 Bacteria 983
188 Ga0265323_10005117 3300028653 Bacteria 5589
189 Ga0265322_10001961 3300028654 Bacteria 6509
190 Ga0265322_10083645 3300028654 Bacteria 906
191 Ga0265336_10000047 3300028666 Bacteria 123576
192 Ga0265336_10002635 3300028666 Bacteria 7288
193 Ga0265336_10002777 3300028666 Bacteria 7074
194 Ga0265336_10005536 3300028666 Bacteria 4651
195 Ga0265338_10000003 3300028800 Bacteria 733923
196 Ga0265338_10000039 3300028800 Bacteria 236135
197 Ga0265338_10000054 3300028800 Bacteria 207383
198 Ga0265338_10000178 3300028800 Bacteria 118345
199 Ga0265338_10000482 3300028800 Bacteria 71209
200 Ga0265338_10002389 3300028800 Bacteria 28280
201 Ga0265338_10013060 3300028800 Bacteria 9413
202 Ga0265338_10030929 3300028800 Bacteria 5259
203 Ga0265338_10076270 3300028800 Bacteria 2840
204 Ga0265338_10090631 3300028800 Unclassified 2530
205 Ga0265338_10100438 3300028800 Bacteria 2360
206 Ga0265338_10139574 3300028800 Unclassified 1900
207 Ga0265338_10149692 3300028800 Unclassified 1815
208 Ga0265338_10182989 3300028800 Bacteria 1595
209 Ga0265338_10242244 3300028800 Unclassified 1335
210 Ga0265338_10350161 3300028800 Unclassified 1062
211 Ga0265324_10011104 3300029957 Unclassified 3444
212 Ga0265324_10023814 3300029957 Bacteria 2178
213 Ga0265324_10025215 3300029957 Bacteria 2108
214 Ga0265330_10009761 3300031235 Bacteria 4547
215 Ga0265330_10081468 3300031235 Bacteria 1394
216 Ga0265332_10003382 3300031238 Bacteria 7722
217 Ga0265332_10174258 3300031238 Bacteria 897
218 Ga0265332_10233944 3300031238 Bacteria 761
219 Ga0265328_10012928 3300031239 Bacteria 3314
220 Ga0265320_10009368 3300031240 Bacteria 5912
221 Ga0265320_10020970 3300031240 Bacteria 3526
222 Ga0265320_10093688 3300031240 Bacteria 1389
223 Ga0265320_10132006 3300031240 Bacteria 1134
224 Ga0265325_10014388 3300031241 Bacteria 4473
225 Ga0265325_10018573 3300031241 Bacteria 3857
226 Ga0265325_10139795 3300031241 Bacteria 1153
227 Ga0265325_10162559 3300031241 Unclassified 1049
228 Ga0265329_10008151 3300031242 Bacteria 3993
229 Ga0265340_10019710 3300031247 Bacteria 3472
230 Ga0265340_10079875 3300031247 Unclassified 1541
231 Ga0265340_10239722 3300031247 Bacteria 809
232 Ga0265339_10052767 3300031249 Bacteria 2213
233 Ga0265339_10059147 3300031249 Bacteria 2067
234 Ga0265331_10003494 3300031250 Bacteria 10117
235 Ga0265327_10017578 3300031251 Bacteria 4479
236 Ga0265327_10033859 3300031251 Bacteria 2841
237 Ga0265327_10067732 3300031251 Bacteria 1797
238 Ga0265327_10070631 3300031251 Bacteria 1749
239 Ga0265327_10157489 3300031251 Unclassified 1051
240 Ga0265316_10050602 3300031344 Bacteria 3266
241 Ga0265316_10085616 3300031344 Bacteria 2411
242 Ga0265316_10279838 3300031344 Bacteria 1219
243 Ga0265316_10348382 3300031344 Bacteria 1072
244 Ga0265313_10005537 3300031595 Bacteria 9258
245 Ga0265313_10007292 3300031595 Bacteria 7591
246 Ga0265313_10034726 3300031595 Bacteria 2546
247 Ga0265313_10074012 3300031595 Bacteria 1562
248 Ga0265313_10128406 3300031595 Bacteria 1100
249 Ga0265313_10334902 3300031595 Bacteria 602
250 Ga0265314_10007161 3300031711 Bacteria 9714
251 Ga0265314_10019396 3300031711 Bacteria 5269
252 Ga0265314_10111998 3300031711 Bacteria 1732
253 Ga0265314_10272428 3300031711 Bacteria 961
254 Ga0265314_10469608 3300031711 Unclassified 667
255 Ga0265342_10005380 3300031712 Bacteria 9777
256 Ga0265342_10215193 3300031712 Bacteria 1037
257 Ga0307406_10116453 3300031901 Bacteria 1849
258 Ga0307409_100091047 3300031995 Bacteria 2498
259 Ga0307411_10120043 3300032005 Bacteria 1900
260 Ga0307415_100023226 3300032126 Bacteria 3845
261 Ga0373944_0135418 3300035089 Unclassified 859
262 Ga0395900_0005281 3300037418 Bacteria 13540
263 Ga0395900_0157148 3300037418 Bacteria 2322
264 Ga0395898_0059724 3300037466 Bacteria 3708
265 Ga0395898_0158574 3300037466 Bacteria 2164
266 Ga0395905_0062800 3300037471 Bacteria 3474
267 Ga0395901_0002456 3300038443 Bacteria 18794
268 Ga0395901_0093963 3300038443 Bacteria 3141
269 Ga0451577_0114423 3300042876 Bacteria 2415
270 Ga0453683_0288198 3300044673 Bacteria 1049
271 Ga0453683_1097914 3300044673 Bacteria 530
272 Ga0453684_0011100 3300044712 Bacteria 15200
273 Ga0453684_0559872 3300044712 Bacteria 1258
274 Ga0451576_0036414 3300045051 Bacteria 5217
275 Ga0451576_0059644 3300045051 Bacteria 3983
276 Ga0466958_0354566 3300045836 Bacteria 945
277 Ga0495628_0028531 3300046516 Bacteria 4533
278 Ga0495674_0717544 3300047319 Unclassified 783
279 Ga0501032_0215077 3300049569 Bacteria 1252
280 Ga0501034_0002581 3300049571 Bacteria 21539
281 Ga0501034_0010282 3300049571 Bacteria 9757
282 Ga0501034_0083345 3300049571 Bacteria 3199
283 Ga0501036_0068508 3300049572 Bacteria 3003
284 Ga0501038_0264351 3300049574 Bacteria 1358
285 Ga0501038_0564584 3300049574 Bacteria 864
286 Ga0501041_0169311 3300049577 Bacteria 1367
287 Ga0501047_0000397 3300049581 Bacteria 48886
288 Ga0501047_0018551 3300049581 Bacteria 6671
289 Ga0501047_0117084 3300049581 Bacteria 2546
290 Ga0501073_0113640 3300049589 Bacteria 1878
291 Ga0501083_0005553 3300049744 Bacteria 8941
292 Ga0501083_0169109 3300049744 Bacteria 1429
293 Ga0501035_0000033 3300049822 Bacteria 175087
294 Ga0501044_0165989 3300049823 Bacteria 2182
295 nmdc:mga0yw44_29003_c1 3300050492 Bacteria 3190
296 nmdc:mga0k408_114_c1 3300050493 Bacteria 39328
297 nmdc:mga08y16_634194_c1 3300050511 Bacteria 1074
298 nmdc:mga08x19_27202_c1 3300050514 Unclassified 3576
299 Ga0495601_0098796 3300053077 Bacteria 1884
300 Ga0500556_0001728 3300053104 Bacteria 8249
301 Ga0500556_0005758 3300053104 Bacteria 3507
302 Ga0500556_0108950 3300053104 Unclassified 1073
303 Ga0500628_167022 3300053129 Unclassified 623
304 Ga0500588_0056581 3300053146 Bacteria 1242

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028577 Ga0265318_10011506 Ga0265318_100115064 118
2 3300028800 Ga0265338_10090631 Ga0265338_100906314 118
3 3300031240 Ga0265320_10093688 Ga0265320_100936883 118
4 3300031344 Ga0265316_10348382 Ga0265316_103483822 118
5 3300031595 Ga0265313_10007292 Ga0265313_1000729210 118
6 3300031711 Ga0265314_10019396 Ga0265314_100193962 118
7 3300031238 Ga0265332_10174258 Ga0265332_101742581 131
8 3300031247 Ga0265340_10239722 Ga0265340_102397222 131
9 3300053104 Ga0500556_0005758 Ga0500556_0005758_1739_2173 139
10 3300031595 Ga0265313_10128406 Ga0265313_101284063 140
11 3300031711 Ga0265314_10469608 Ga0265314_104696081 140
12 3300053104 Ga0500556_0108950 Ga0500556_0108950_155_637 140
13 3300005339 Ga0070660_100000565 Ga0070660_1000005658 141
14 3300005435 Ga0070714_100000374 Ga0070714_10000037427 141
15 3300005444 Ga0070694_100431375 Ga0070694_1004313752 141
16 3300005530 Ga0070679_100311006 Ga0070679_1003110062 141
17 3300005563 Ga0068855_100054831 Ga0068855_1000548313 141
18 3300025919 Ga0207657_10000309 Ga0207657_1000030919 141
19 3300025921 Ga0207652_10251815 Ga0207652_102518152 141
20 3300025929 Ga0207664_10000269 Ga0207664_1000026927 141
21 3300025949 Ga0207667_10367933 Ga0207667_103679332 141
22 3300049577 Ga0501041_0169311 Ga0501041_0169311_307_744 141
23 3300005327 Ga0070658_10072089 Ga0070658_100720892 142
24 3300005458 Ga0070681_10172057 Ga0070681_101720571 142
25 3300005530 Ga0070679_100000652 Ga0070679_1000006523 142
26 3300005544 Ga0070686_100086588 Ga0070686_1000865882 142
27 3300005544 Ga0070686_100136287 Ga0070686_1001362872 142
28 3300009093 Ga0105240_10013363 Ga0105240_100133638 142
29 3300009174 Ga0105241_10380755 Ga0105241_103807551 142
30 3300010375 Ga0105239_10004097 Ga0105239_1000409716 142
31 3300013105 Ga0157369_10136313 Ga0157369_101363133 142
32 3300013105 Ga0157369_10152376 Ga0157369_101523762 142
33 3300025909 Ga0207705_10107304 Ga0207705_101073042 142
34 3300025911 Ga0207654_10124777 Ga0207654_101247772 142
35 3300025921 Ga0207652_10382836 Ga0207652_103828362 142
36 3300044673 Ga0453683_1097914 Ga0453683_1097914_75_518 142
37 3300044712 Ga0453684_0559872 Ga0453684_0559872_359_805 142
38 3300049571 Ga0501034_0083345 Ga0501034_0083345_1479_1919 142
39 3300049581 Ga0501047_0018551 Ga0501047_0018551_4484_4924 142
40 3300005290 Ga0065712_10250567 Ga0065712_102505672 143
41 3300005293 Ga0065715_10152739 Ga0065715_101527392 143
42 3300005329 Ga0070683_100167041 Ga0070683_1001670413 143
43 3300005329 Ga0070683_101202777 Ga0070683_1012027771 143
44 3300005356 Ga0070674_100875533 Ga0070674_1008755331 143
45 3300005364 Ga0070673_101034304 Ga0070673_1010343042 143
46 3300005365 Ga0070688_101180121 Ga0070688_1011801211 143
47 3300005367 Ga0070667_100558679 Ga0070667_1005586792 143
48 3300005435 Ga0070714_100014460 Ga0070714_1000144607 143
49 3300005440 Ga0070705_100159283 Ga0070705_1001592832 143
50 3300005445 Ga0070708_100021994 Ga0070708_1000219944 143
51 3300005445 Ga0070708_100031588 Ga0070708_1000315882 143
52 3300005445 Ga0070708_100059770 Ga0070708_1000597701 143
53 3300005445 Ga0070708_100479620 Ga0070708_1004796202 143
54 3300005445 Ga0070708_100797640 Ga0070708_1007976401 143
55 3300005467 Ga0070706_100353653 Ga0070706_1003536532 143
56 3300005467 Ga0070706_100486102 Ga0070706_1004861022 143
57 3300005468 Ga0070707_100012728 Ga0070707_1000127282 143
58 3300005468 Ga0070707_100056316 Ga0070707_1000563162 143
59 3300005468 Ga0070707_100402162 Ga0070707_1004021621 143
60 3300005468 Ga0070707_100496239 Ga0070707_1004962392 143
61 3300005471 Ga0070698_100008134 Ga0070698_1000081345 143
62 3300005471 Ga0070698_100055513 Ga0070698_1000555135 143
63 3300005471 Ga0070698_100523158 Ga0070698_1005231581 143
64 3300005518 Ga0070699_100188166 Ga0070699_1001881661 143
65 3300005518 Ga0070699_101688277 Ga0070699_1016882771 143
66 3300005530 Ga0070679_100000876 Ga0070679_10000087623 143
67 3300005530 Ga0070679_100117587 Ga0070679_1001175872 143
68 3300005530 Ga0070679_100499687 Ga0070679_1004996872 143
69 3300005530 Ga0070679_101016071 Ga0070679_1010160712 143
70 3300005535 Ga0070684_100091583 Ga0070684_1000915832 143
71 3300005535 Ga0070684_101451018 Ga0070684_1014510181 143
72 3300005536 Ga0070697_100004034 Ga0070697_1000040347 143
73 3300005536 Ga0070697_100984233 Ga0070697_1009842331 143
74 3300005539 Ga0068853_100029637 Ga0068853_1000296373 143
75 3300005546 Ga0070696_100494161 Ga0070696_1004941612 143
76 3300005563 Ga0068855_100011595 Ga0068855_10001159511 143
77 3300005563 Ga0068855_100016848 Ga0068855_1000168484 143
78 3300005563 Ga0068855_100137462 Ga0068855_1001374624 143
79 3300005563 Ga0068855_100383926 Ga0068855_1003839262 143
80 3300005577 Ga0068857_100004295 Ga0068857_1000042958 143
81 3300005577 Ga0068857_100045243 Ga0068857_1000452434 143
82 3300005577 Ga0068857_100131698 Ga0068857_1001316983 143
83 3300005614 Ga0068856_100037200 Ga0068856_1000372003 143
84 3300005614 Ga0068856_100053736 Ga0068856_1000537362 143
85 3300005616 Ga0068852_100000001 Ga0068852_100000001491 143
86 3300005616 Ga0068852_100059093 Ga0068852_1000590933 143
87 3300005719 Ga0068861_100367854 Ga0068861_1003678542 143
88 3300005842 Ga0068858_100035290 Ga0068858_1000352905 143
89 3300005843 Ga0068860_100256173 Ga0068860_1002561732 143
90 3300005985 Ga0081539_10001746 Ga0081539_1000174625 143
91 3300006028 Ga0070717_10003528 Ga0070717_100035288 143
92 3300006028 Ga0070717_10021890 Ga0070717_100218904 143
93 3300006028 Ga0070717_10141295 Ga0070717_101412953 143
94 3300006038 Ga0075365_10029697 Ga0075365_100296975 143
95 3300006051 Ga0075364_10567702 Ga0075364_105677022 143
96 3300006173 Ga0070716_100081028 Ga0070716_1000810282 143
97 3300006195 Ga0075366_10000044 Ga0075366_1000004440 143
98 3300006195 Ga0075366_10354867 Ga0075366_103548672 143
99 3300006914 Ga0075436_100028465 Ga0075436_1000284651 143
100 3300009093 Ga0105240_10064650 Ga0105240_100646504 143
101 3300009093 Ga0105240_10289760 Ga0105240_102897602 143
102 3300009098 Ga0105245_10000001 Ga0105245_10000001410 143
103 3300009098 Ga0105245_10048498 Ga0105245_100484981 143
104 3300009098 Ga0105245_10086634 Ga0105245_100866344 143
105 3300009174 Ga0105241_10023216 Ga0105241_100232162 143
106 3300009174 Ga0105241_10253580 Ga0105241_102535802 143
107 3300009174 Ga0105241_10910055 Ga0105241_109100552 143
108 3300009545 Ga0105237_10000002 Ga0105237_10000002384 143
109 3300009551 Ga0105238_10003523 Ga0105238_100035232 143
110 3300009551 Ga0105238_10038386 Ga0105238_100383865 143
111 3300009551 Ga0105238_10160480 Ga0105238_101604803 143
112 3300009551 Ga0105238_11074049 Ga0105238_110740492 143
113 3300010375 Ga0105239_11334434 Ga0105239_113344342 143
114 3300013104 Ga0157370_10617294 Ga0157370_106172941 143
115 3300013104 Ga0157370_10836093 Ga0157370_108360932 143
116 3300013105 Ga0157369_10180338 Ga0157369_101803382 143
117 3300013105 Ga0157369_10194668 Ga0157369_101946683 143
118 3300013105 Ga0157369_10305663 Ga0157369_103056632 143
119 3300013297 Ga0157378_10062734 Ga0157378_100627342 143
120 3300013297 Ga0157378_10081209 Ga0157378_100812094 143
121 3300013306 Ga0163162_10500196 Ga0163162_105001962 143
122 3300013307 Ga0157372_10432924 Ga0157372_104329242 143
123 3300014968 Ga0157379_10248204 Ga0157379_102482042 143
124 3300017792 Ga0163161_10040972 Ga0163161_100409723 143
125 3300025271 Ga0207666_1005428 Ga0207666_10054282 143
126 3300025315 Ga0207697_10002964 Ga0207697_100029645 143
127 3300025901 Ga0207688_10060689 Ga0207688_100606892 143
128 3300025903 Ga0207680_10243705 Ga0207680_102437051 143
129 3300025904 Ga0207647_10489286 Ga0207647_104892861 143
130 3300025911 Ga0207654_10007261 Ga0207654_100072616 143
131 3300025911 Ga0207654_10398304 Ga0207654_103983042 143
132 3300025911 Ga0207654_10735958 Ga0207654_107359582 143
133 3300025912 Ga0207707_10046886 Ga0207707_100468864 143
134 3300025913 Ga0207695_10085923 Ga0207695_100859233 143
135 3300025914 Ga0207671_10000008 Ga0207671_10000008489 143
136 3300025915 Ga0207693_10013742 Ga0207693_100137425 143
137 3300025915 Ga0207693_10141902 Ga0207693_101419023 143
138 3300025916 Ga0207663_10130086 Ga0207663_101300862 143
139 3300025917 Ga0207660_10001756 Ga0207660_1000175615 143
140 3300025918 Ga0207662_10003795 Ga0207662_100037958 143
141 3300025921 Ga0207652_10000906 Ga0207652_1000090621 143
142 3300025921 Ga0207652_10004857 Ga0207652_100048578 143
143 3300025921 Ga0207652_10496524 Ga0207652_104965242 143
144 3300025921 Ga0207652_10865105 Ga0207652_108651052 143
145 3300025922 Ga0207646_10014338 Ga0207646_100143387 143
146 3300025922 Ga0207646_10043209 Ga0207646_100432095 143
147 3300025922 Ga0207646_10116601 Ga0207646_101166013 143
148 3300025922 Ga0207646_10123370 Ga0207646_101233704 143
149 3300025922 Ga0207646_10211255 Ga0207646_102112552 143
150 3300025922 Ga0207646_10243830 Ga0207646_102438302 143
151 3300025923 Ga0207681_10014846 Ga0207681_100148462 143
152 3300025924 Ga0207694_10000890 Ga0207694_1000089026 143
153 3300025924 Ga0207694_10074130 Ga0207694_100741303 143
154 3300025927 Ga0207687_10000030 Ga0207687_1000003029 143
155 3300025929 Ga0207664_10257825 Ga0207664_102578251 143
156 3300025929 Ga0207664_11002019 Ga0207664_110020192 143
157 3300025933 Ga0207706_10011823 Ga0207706_100118236 143
158 3300025936 Ga0207670_10069921 Ga0207670_100699212 143
159 3300025940 Ga0207691_10270795 Ga0207691_102707952 143
160 3300025942 Ga0207689_10256121 Ga0207689_102561212 143
161 3300025944 Ga0207661_10336417 Ga0207661_103364171 143
162 3300025944 Ga0207661_10432235 Ga0207661_104322352 143
163 3300025949 Ga0207667_10002118 Ga0207667_1000211810 143
164 3300025949 Ga0207667_10006467 Ga0207667_1000646715 143
165 3300025949 Ga0207667_10021272 Ga0207667_100212724 143
166 3300025949 Ga0207667_10140042 Ga0207667_101400422 143
167 3300025961 Ga0207712_10029860 Ga0207712_100298602 143
168 3300025972 Ga0207668_10200820 Ga0207668_102008202 143
169 3300025986 Ga0207658_10032506 Ga0207658_100325065 143
170 3300025986 Ga0207658_10529778 Ga0207658_105297782 143
171 3300026023 Ga0207677_10016569 Ga0207677_100165693 143
172 3300026035 Ga0207703_10033671 Ga0207703_100336712 143
173 3300026078 Ga0207702_10087897 Ga0207702_100878973 143
174 3300026078 Ga0207702_10237360 Ga0207702_102373603 143
175 3300026089 Ga0207648_10513420 Ga0207648_105134202 143
176 3300026116 Ga0207674_10008732 Ga0207674_100087327 143
177 3300026116 Ga0207674_10011447 Ga0207674_1001144710 143
178 3300026116 Ga0207674_10057197 Ga0207674_100571974 143
179 3300026118 Ga0207675_100199074 Ga0207675_1001990742 143
180 3300026142 Ga0207698_10000001 Ga0207698_10000001442 143
181 3300026142 Ga0207698_10735489 Ga0207698_107354892 143
182 3300028380 Ga0268265_10063717 Ga0268265_100637172 143
183 3300028381 Ga0268264_10233173 Ga0268264_102331733 143
184 3300028556 Ga0265337_1000001 Ga0265337_1000001161 143
185 3300028556 Ga0265337_1001897 Ga0265337_100189710 143
186 3300028556 Ga0265337_1001932 Ga0265337_100193211 143
187 3300028556 Ga0265337_1002922 Ga0265337_10029222 143
188 3300028556 Ga0265337_1005837 Ga0265337_10058374 143
189 3300028558 Ga0265326_10000303 Ga0265326_100003035 143
190 3300028558 Ga0265326_10001540 Ga0265326_100015402 143
191 3300028558 Ga0265326_10004220 Ga0265326_100042206 143
192 3300028558 Ga0265326_10037183 Ga0265326_100371833 143
193 3300028558 Ga0265326_10050454 Ga0265326_100504542 143
194 3300028563 Ga0265319_1008118 Ga0265319_10081184 143
195 3300028563 Ga0265319_1030009 Ga0265319_10300092 143
196 3300028573 Ga0265334_10000049 Ga0265334_1000004983 143
197 3300028573 Ga0265334_10003511 Ga0265334_100035112 143
198 3300028573 Ga0265334_10004026 Ga0265334_100040266 143
199 3300028573 Ga0265334_10025136 Ga0265334_100251361 143
200 3300028573 Ga0265334_10038813 Ga0265334_100388132 143
201 3300028573 Ga0265334_10095985 Ga0265334_100959852 143
202 3300028577 Ga0265318_10003578 Ga0265318_100035789 143
203 3300028577 Ga0265318_10116134 Ga0265318_101161342 143
204 3300028653 Ga0265323_10005117 Ga0265323_100051174 143
205 3300028654 Ga0265322_10001961 Ga0265322_100019619 143
206 3300028654 Ga0265322_10083645 Ga0265322_100836452 143
207 3300028666 Ga0265336_10000047 Ga0265336_1000004762 143
208 3300028666 Ga0265336_10002635 Ga0265336_100026357 143
209 3300028666 Ga0265336_10002777 Ga0265336_100027772 143
210 3300028666 Ga0265336_10005536 Ga0265336_100055362 143
211 3300028800 Ga0265338_10000003 Ga0265338_10000003435 143
212 3300028800 Ga0265338_10000039 Ga0265338_10000039228 143
213 3300028800 Ga0265338_10000054 Ga0265338_10000054223 143
214 3300028800 Ga0265338_10000178 Ga0265338_1000017835 143
215 3300028800 Ga0265338_10000482 Ga0265338_100004828 143
216 3300028800 Ga0265338_10002389 Ga0265338_1000238930 143
217 3300028800 Ga0265338_10013060 Ga0265338_100130603 143
218 3300028800 Ga0265338_10030929 Ga0265338_100309295 143
219 3300028800 Ga0265338_10076270 Ga0265338_100762703 143
220 3300028800 Ga0265338_10100438 Ga0265338_101004382 143
221 3300028800 Ga0265338_10139574 Ga0265338_101395742 143
222 3300028800 Ga0265338_10149692 Ga0265338_101496922 143
223 3300028800 Ga0265338_10182989 Ga0265338_101829893 143
224 3300028800 Ga0265338_10242244 Ga0265338_102422442 143
225 3300028800 Ga0265338_10350161 Ga0265338_103501611 143
226 3300029957 Ga0265324_10011104 Ga0265324_100111043 143
227 3300029957 Ga0265324_10023814 Ga0265324_100238143 143
228 3300029957 Ga0265324_10025215 Ga0265324_100252152 143
229 3300031235 Ga0265330_10009761 Ga0265330_100097613 143
230 3300031235 Ga0265330_10081468 Ga0265330_100814682 143
231 3300031238 Ga0265332_10003382 Ga0265332_100033822 143
232 3300031238 Ga0265332_10233944 Ga0265332_102339442 143
233 3300031239 Ga0265328_10012928 Ga0265328_100129283 143
234 3300031240 Ga0265320_10009368 Ga0265320_100093687 143
235 3300031240 Ga0265320_10020970 Ga0265320_100209702 143
236 3300031240 Ga0265320_10132006 Ga0265320_101320062 143
237 3300031241 Ga0265325_10014388 Ga0265325_100143883 143
238 3300031241 Ga0265325_10018573 Ga0265325_100185732 143
239 3300031241 Ga0265325_10139795 Ga0265325_101397952 143
240 3300031241 Ga0265325_10162559 Ga0265325_101625592 143
241 3300031242 Ga0265329_10008151 Ga0265329_100081513 143
242 3300031247 Ga0265340_10019710 Ga0265340_100197105 143
243 3300031247 Ga0265340_10079875 Ga0265340_100798753 143
244 3300031249 Ga0265339_10052767 Ga0265339_100527672 143
245 3300031249 Ga0265339_10059147 Ga0265339_100591473 143
246 3300031250 Ga0265331_10003494 Ga0265331_100034944 143
247 3300031251 Ga0265327_10017578 Ga0265327_100175784 143
248 3300031251 Ga0265327_10033859 Ga0265327_100338592 143
249 3300031251 Ga0265327_10067732 Ga0265327_100677322 143
250 3300031251 Ga0265327_10070631 Ga0265327_100706312 143
251 3300031251 Ga0265327_10157489 Ga0265327_101574892 143
252 3300031344 Ga0265316_10050602 Ga0265316_100506023 143
253 3300031344 Ga0265316_10085616 Ga0265316_100856162 143
254 3300031344 Ga0265316_10279838 Ga0265316_102798382 143
255 3300031595 Ga0265313_10005537 Ga0265313_1000553711 143
256 3300031595 Ga0265313_10034726 Ga0265313_100347262 143
257 3300031595 Ga0265313_10074012 Ga0265313_100740122 143
258 3300031595 Ga0265313_10334902 Ga0265313_103349021 143
259 3300031711 Ga0265314_10007161 Ga0265314_100071619 143
260 3300031711 Ga0265314_10111998 Ga0265314_101119982 143
261 3300031711 Ga0265314_10272428 Ga0265314_102724282 143
262 3300031712 Ga0265342_10005380 Ga0265342_100053809 143
263 3300031712 Ga0265342_10215193 Ga0265342_102151931 143
264 3300031901 Ga0307406_10116453 Ga0307406_101164533 143
265 3300031995 Ga0307409_100091047 Ga0307409_1000910473 143
266 3300032005 Ga0307411_10120043 Ga0307411_101200432 143
267 3300032126 Ga0307415_100023226 Ga0307415_1000232264 143
268 3300035089 Ga0373944_0135418 Ga0373944_0135418_117_611 143
269 3300037418 Ga0395900_0005281 Ga0395900_0005281_10882_11313 143
270 3300037418 Ga0395900_0157148 Ga0395900_0157148_1387_1881 143
271 3300037466 Ga0395898_0059724 Ga0395898_0059724_2666_3097 143
272 3300037466 Ga0395898_0158574 Ga0395898_0158574_450_944 143
273 3300037471 Ga0395905_0062800 Ga0395905_0062800_497_928 143
274 3300038443 Ga0395901_0002456 Ga0395901_0002456_16113_16544 143
275 3300038443 Ga0395901_0093963 Ga0395901_0093963_1825_2319 143
276 3300042876 Ga0451577_0114423 Ga0451577_0114423_455_904 143
277 3300044673 Ga0453683_0288198 Ga0453683_0288198_200_682 143
278 3300044712 Ga0453684_0011100 Ga0453684_0011100_6384_6833 143
279 3300045051 Ga0451576_0036414 Ga0451576_0036414_1230_1679 143
280 3300045051 Ga0451576_0059644 Ga0451576_0059644_1494_1961 143
281 3300045836 Ga0466958_0354566 Ga0466958_0354566_264_749 143
282 3300046516 Ga0495628_0028531 Ga0495628_0028531_1918_2391 143
283 3300047319 Ga0495674_0717544 Ga0495674_0717544_249_722 143
284 3300049569 Ga0501032_0215077 Ga0501032_0215077_197_691 143
285 3300049571 Ga0501034_0002581 Ga0501034_0002581_14700_15146 143
286 3300049571 Ga0501034_0010282 Ga0501034_0010282_6485_6979 143
287 3300049572 Ga0501036_0068508 Ga0501036_0068508_1945_2439 143
288 3300049574 Ga0501038_0264351 Ga0501038_0264351_745_1239 143
289 3300049574 Ga0501038_0564584 Ga0501038_0564584_213_659 143
290 3300049581 Ga0501047_0000397 Ga0501047_0000397_36298_36792 143
291 3300049581 Ga0501047_0117084 Ga0501047_0117084_1053_1499 143
292 3300049589 Ga0501073_0113640 Ga0501073_0113640_462_971 143
293 3300049744 Ga0501083_0005553 Ga0501083_0005553_738_1232 143
294 3300049744 Ga0501083_0169109 Ga0501083_0169109_15_509 143
295 3300049822 Ga0501035_0000033 Ga0501035_0000033_85412_85906 143
296 3300049823 Ga0501044_0165989 Ga0501044_0165989_1555_2049 143
297 3300050492 nmdc:mga0yw44_29003_c1 nmdc:mga0yw44_29003_c1_2434_2931 143
298 3300050493 nmdc:mga0k408_114_c1 nmdc:mga0k408_114_c1_13853_14350 143
299 3300050511 nmdc:mga08y16_634194_c1 nmdc:mga08y16_634194_c1_540_998 143
300 3300050514 nmdc:mga08x19_27202_c1 nmdc:mga08x19_27202_c1_2935_3366 143
301 3300053077 Ga0495601_0098796 Ga0495601_0098796_598_1071 143
302 3300053104 Ga0500556_0001728 Ga0500556_0001728_4236_4700 143
303 3300053129 Ga0500628_167022 Ga0500628_167022_81_584 143
304 3300053146 Ga0500588_0056581 Ga0500588_0056581_362_859 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

10

107

0.96

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

102

167

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9835 1 142
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9777 2 142
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9771 2 142
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9736 1 143
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.97 1 142
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9772 2 142 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9736 1 143 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.967 1 143 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9624 1 128 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9606 2 143 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A2V6JTY0-F1-model_v4 Ribose-5-phosphate isomerase 1.005 1 125 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6B4V8-F1-model_v4 Ribose-5-phosphate isomerase 1.004 1 118 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6HBS0-F1-model_v4 Ribose 5-phosphate isomerase B 1.003 1 143 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6LHR3-F1-model_v4 Ribose 5-phosphate isomerase B 1.001 1 143 GO:0004751
GO:0009052
GO:0019316
AF-A0A2V6D0B3-F1-model_v4 Ribose 5-phosphate isomerase B 1 1 143 GO:0004751
GO:0009052
GO:0019316

Feature Viewer

pLDDT pTM Quality
97.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map