F397631

General Info

Members Datasets Scaffolds Average Seq Length
304 168 608 307

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10127465|Ga0207678_101274651
Length 345
Sequence MSEVLSSEAFIRDLVARIEARRTFGGHPLWLELADGKLSREHLKLFAVQFFLQVREFPRAVSAMHANCPFPEERMALAESIYEEETGRISGCNQPHPEIFIRFGEAIGLARAEMVEGISIIHDDESIVVIDKPVGVAVHPSMGWTGPTVVGHLRAAGYRIATGGAPERQGIVQRLDVGTSGVMVICKSERAYSVLKNAFRHRTVDKTYHALVQGHPDPLEGTIDAPIGRAPKSDWKFTVRDDGKHSVTHYETLEAHRFASLLEIHLETGRTHQIRVHMAALKHPCVGDLTYGADPTLARRLGLERQWLHAVRLGFDHPDSGAYVEYESAYPSDLAAALEIIRDEH

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
71 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
72 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
87 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
88 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
89 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
90 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
91 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
94 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
100 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
108 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
114 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
115 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
116 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
117 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
118 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
119 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
134 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
135 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
136 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
146 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
147 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
152 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
153 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 2558860280 Kutzneria sp. 744 Isolate Unclassified
156 2643221576 Nocardioides sp. Root614 Isolate Unclassified
157 2643221590 Nocardioides sp. Root682 Isolate Unclassified
158 2643221604 Nocardioides sp. Root190 Isolate Unclassified
159 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
160 2738541305 Nocardioides sp. CF167 Isolate Unclassified
161 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
162 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
163 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
164 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
165 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
166 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
167 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
168 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.74
Metatranscriptomes 0.66
Isolates 4.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 22.04
Nodule 0
Rhizoplane 5.59
Rhizosphere 66.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10127465 3300026067 Bacteria 2171
2 LJQas_1009019 3300000549 Bacteria 1204
3 Ga0070683_100153569 3300005329 Bacteria 2183
4 Ga0070670_100182319 3300005331 Bacteria 1823
5 Ga0070682_100179522 3300005337 Bacteria 1477
6 Ga0070660_100005688 3300005339 Bacteria 8638
7 Ga0070661_100061375 3300005344 Bacteria 2759
8 Ga0070659_100001990 3300005366 Bacteria 14601
9 Ga0070667_100004448 3300005367 Bacteria 11816
10 Ga0070714_100024086 3300005435 Bacteria 5009
11 Ga0070714_100350225 3300005435 Bacteria 1387
12 Ga0070710_10000022 3300005437 Bacteria 77699
13 Ga0070663_100074236 3300005455 Bacteria 2483
14 Ga0070698_100047471 3300005471 Bacteria 4389
15 Ga0070679_100607500 3300005530 Bacteria 1037
16 Ga0070684_100348081 3300005535 Bacteria 1363
17 Ga0068853_100019302 3300005539 Bacteria 5651
18 Ga0070686_100191279 3300005544 Bacteria 1461
19 Ga0070696_100002219 3300005546 Bacteria 12797
20 Ga0070665_100058081 3300005548 Bacteria 3879
21 Ga0070664_100094469 3300005564 Bacteria 2593
22 Ga0070664_100179747 3300005564 Bacteria 1880
23 Ga0068852_100258557 3300005616 Bacteria 1671
24 Ga0068852_100529873 3300005616 Bacteria 1176
25 Ga0068859_100609875 3300005617 Bacteria 1184
26 Ga0068863_100013687 3300005841 Bacteria 7822
27 Ga0068863_100181921 3300005841 Bacteria 2018
28 Ga0081455_10000249 3300005937 Bacteria 70419
29 Ga0081539_10089174 3300005985 Bacteria 1598
30 Ga0075365_10004862 3300006038 Bacteria 7175
31 Ga0075365_10018125 3300006038 Bacteria 4322
32 Ga0075365_10029088 3300006038 Bacteria 3528
33 Ga0075365_10063350 3300006038 Bacteria 2475
34 Ga0075365_10196220 3300006038 Bacteria 1413
35 Ga0075368_10004309 3300006042 Bacteria 4813
36 Ga0075363_100002226 3300006048 Bacteria 7841
37 Ga0075363_100006558 3300006048 Bacteria 5300
38 Ga0075363_100006618 3300006048 Bacteria 5281
39 Ga0075363_100008786 3300006048 Bacteria 4723
40 Ga0075363_100009009 3300006048 Bacteria 4678
41 Ga0075363_100010606 3300006048 Bacteria 4385
42 Ga0075363_100015499 3300006048 Bacteria 3749
43 Ga0075363_100018788 3300006048 Bacteria 3447
44 Ga0075363_100022947 3300006048 Bacteria 3159
45 Ga0075363_100026211 3300006048 Bacteria 2980
46 Ga0075364_10000494 3300006051 Bacteria 20067
47 Ga0075364_10001410 3300006051 Bacteria 13020
48 Ga0075364_10005314 3300006051 Bacteria 7471
49 Ga0075364_10144079 3300006051 Bacteria 1603
50 Ga0070716_100031053 3300006173 Bacteria 2903
51 Ga0075362_10004943 3300006177 Bacteria 4830
52 Ga0075362_10037505 3300006177 Bacteria 2125
53 Ga0075362_10042982 3300006177 Bacteria 2000
54 Ga0075367_10008729 3300006178 Bacteria 5265
55 Ga0075367_10027313 3300006178 Bacteria 3246
56 Ga0075367_10038499 3300006178 Bacteria 2783
57 Ga0075369_10000653 3300006186 Bacteria 11033
58 Ga0075369_10055308 3300006186 Bacteria 1724
59 Ga0075370_10007517 3300006353 Bacteria 5553
60 Ga0075370_10008759 3300006353 Bacteria 5221
61 Ga0075370_10059752 3300006353 Bacteria 2170
62 Ga0075370_10061821 3300006353 Bacteria 2133
63 Ga0075370_10129729 3300006353 Bacteria 1471
64 Ga0075370_10143618 3300006353 Bacteria 1396
65 Ga0075428_100356464 3300006844 Bacteria 1570
66 Ga0075430_100214543 3300006846 Bacteria 1597
67 Ga0075431_100000088 3300006847 Bacteria 56098
68 Ga0097620_100609945 3300006931 Bacteria 1184
69 Ga0111539_10090230 3300009094 Bacteria 3601
70 Ga0111539_10092735 3300009094 Bacteria 3549
71 Ga0105245_10050911 3300009098 Bacteria 3713
72 Ga0105245_10130795 3300009098 Bacteria 2354
73 Ga0105245_10290617 3300009098 Bacteria 1601
74 Ga0105243_10012499 3300009148 Bacteria 6419
75 Ga0105248_10405863 3300009177 Bacteria 1534
76 Ga0105237_10217838 3300009545 Bacteria 1909
77 Ga0105238_10177432 3300009551 Bacteria 2107
78 Ga0105238_10477055 3300009551 Bacteria 1246
79 Ga0105238_10529919 3300009551 Bacteria 1181
80 Ga0105249_10234330 3300009553 Bacteria 1812
81 Ga0105239_10031872 3300010375 Bacteria 5792
82 Ga0157375_10114128 3300013308 Bacteria 2803
83 Ga0163163_10145504 3300014325 Bacteria 2413
84 Ga0157377_10124337 3300014745 Bacteria 1567
85 Ga0206353_10886113 3300020082 Bacteria 8746
86 Ga0154015_1562139 3300020610 Bacteria 1865
87 Ga0213875_10004165 3300021388 Bacteria 8006
88 Ga0209025_1058074 3300025294 Bacteria 1473
89 Ga0207682_10109325 3300025893 Bacteria 1216
90 Ga0207692_10000390 3300025898 Bacteria 15169
91 Ga0207647_10018485 3300025904 Bacteria 4710
92 Ga0207705_10003881 3300025909 Bacteria 11373
93 Ga0207707_10194308 3300025912 Bacteria 1770
94 Ga0207662_10148683 3300025918 Bacteria 1488
95 Ga0207657_10009355 3300025919 Bacteria 9861
96 Ga0207657_10079113 3300025919 Bacteria 2767
97 Ga0207649_10041093 3300025920 Bacteria 2814
98 Ga0207709_10068763 3300025935 Bacteria 2239
99 Ga0207665_10063580 3300025939 Bacteria 2507
100 Ga0207679_10120207 3300025945 Bacteria 2090
101 Ga0207678_10222200 3300026067 Bacteria 1617
102 Ga0207641_10105159 3300026088 Bacteria 2493
103 Ga0207675_100188635 3300026118 Bacteria 1977
104 Ga0207698_10169902 3300026142 Bacteria 1918
105 Ga0207698_10218661 3300026142 Bacteria 1720
106 Ga0207698_10577739 3300026142 Bacteria 1105
107 Ga0209813_10025797 3300027866 Bacteria 1694
108 Ga0268266_10043483 3300028379 Bacteria 3839
109 Ga0307511_10000324 3300030521 Bacteria 50832
110 Ga0316176_1211198 3300030732 Bacteria 3590
111 Ga0314311_1005961 3300030733 Bacteria 8017
112 Ga0265325_10059147 3300031241 Bacteria 1949
113 Ga0265340_10026358 3300031247 Bacteria 2939
114 Ga0265314_10074211 3300031711 Bacteria 2266
115 Ga0307410_10145242 3300031852 Bacteria 1760
116 Ga0307410_10260290 3300031852 Bacteria 1353
117 Ga0307407_10037692 3300031903 Bacteria 2673
118 Ga0307412_10023975 3300031911 Bacteria 3762
119 Ga0307416_100034435 3300032002 Bacteria 3854
120 Ga0307416_100209856 3300032002 Bacteria 1856
121 Ga0307415_100001609 3300032126 Bacteria 10907
122 Ga0395899_0179206 3300037312 Bacteria 1489
123 Ga0395900_0048008 3300037418 Bacteria 4397
124 Ga0395900_0103962 3300037418 Bacteria 2918
125 Ga0395900_0142151 3300037418 Bacteria 2457
126 Ga0395898_0229938 3300037466 Bacteria 1769
127 Ga0436364_0383034 3300037853 Bacteria 52816
128 Ga0395901_0035325 3300038443 Bacteria 5163
129 Ga0395901_0575531 3300038443 Bacteria 1138
130 Ga0439461_0011533 3300041410 Bacteria 1642
131 Ga0439466_0032387 3300041411 Bacteria 1782
132 Ga0451853_0898999 3300041512 Bacteria 1141
133 Ga0439442_016672 3300042002 Bacteria 1515
134 Ga0439445_0026771 3300042004 Bacteria 1478
135 Ga0439435_0039627 3300042436 Bacteria 1313
136 Ga0466969_0001230 3300044656 Bacteria 13849
137 Ga0466969_0006947 3300044656 Bacteria 6022
138 Ga0466972_0003230 3300044658 Bacteria 8090
139 Ga0466972_0023702 3300044658 Bacteria 3051
140 Ga0466972_0038516 3300044658 Bacteria 2335
141 Ga0466972_0177097 3300044658 Bacteria 1000
142 Ga0466965_0004804 3300044683 Bacteria 6029
143 Ga0466965_0006800 3300044683 Bacteria 5222
144 Ga0466965_0015635 3300044683 Bacteria 3605
145 Ga0466965_0033136 3300044683 Bacteria 2524
146 Ga0466965_0036523 3300044683 Bacteria 2410
147 Ga0466965_0052809 3300044683 Bacteria 2019
148 Ga0466966_0000466 3300044684 Bacteria 25968
149 Ga0466966_0034846 3300044684 Bacteria 3254
150 Ga0466961_0024584 3300044693 Bacteria 3875
151 Ga0466961_0030029 3300044693 Bacteria 3493
152 Ga0466961_0100294 3300044693 Bacteria 1824
153 Ga0466963_0288144 3300044694 Bacteria 1154
154 Ga0466964_0031550 3300044706 Bacteria 2102
155 Ga0466971_0084996 3300044719 Bacteria 1445
156 Ga0466971_0106416 3300044719 Bacteria 1292
157 Ga0466968_0005135 3300044735 Bacteria 4897
158 Ga0466968_0032815 3300044735 Bacteria 2161
159 Ga0466968_0040095 3300044735 Bacteria 1974
160 Ga0466970_0002109 3300044765 Bacteria 9601
161 Ga0466970_0005935 3300044765 Bacteria 6088
162 Ga0466970_0008368 3300044765 Bacteria 5205
163 Ga0466970_0017848 3300044765 Bacteria 3669
164 Ga0466970_0021547 3300044765 Bacteria 3356
165 Ga0466970_0029503 3300044765 Bacteria 2888
166 Ga0466970_0037113 3300044765 Bacteria 2582
167 Ga0466970_0065315 3300044765 Bacteria 1952
168 Ga0466957_0022360 3300044842 Bacteria 3731
169 Ga0466957_0025159 3300044842 Bacteria 3527
170 Ga0466957_0031288 3300044842 Bacteria 3179
171 Ga0466957_0035832 3300044842 Bacteria 2979
172 Ga0466957_0188792 3300044842 Bacteria 1349
173 Ga0466957_0304125 3300044842 Bacteria 1072
174 Ga0466960_0000190 3300044901 Bacteria 21147
175 Ga0466960_0010317 3300044901 Bacteria 3877
176 Ga0466960_0011123 3300044901 Bacteria 3752
177 Ga0466960_0032675 3300044901 Bacteria 2412
178 Ga0466960_0036030 3300044901 Bacteria 2316
179 Ga0466960_0055106 3300044901 Bacteria 1933
180 Ga0466959_0007635 3300045049 Bacteria 7603
181 Ga0466959_0044470 3300045049 Bacteria 3272
182 Ga0466959_0104614 3300045049 Bacteria 2025
183 Ga0466958_0065156 3300045836 Bacteria 2223
184 Ga0466967_0014429 3300045976 Bacteria 6155
185 Ga0466967_0016193 3300045976 Bacteria 5869
186 Ga0466967_0105557 3300045976 Bacteria 2581
187 Ga0466967_0128597 3300045976 Bacteria 2349
188 Ga0466967_0209202 3300045976 Bacteria 1850
189 Ga0466967_0275436 3300045976 Bacteria 1613
190 Ga0466967_0351104 3300045976 Bacteria 1427
191 Ga0495583_0153966 3300046506 Bacteria 952
192 Ga0495649_0199688 3300046694 Bacteria 1039
193 Ga0495672_0066810 3300047320 Bacteria 2050
194 Ga0496102_0032598 3300048905 Bacteria 4680
195 Ga0496105_0023148 3300048908 Bacteria 5038
196 Ga0496105_0342190 3300048908 Bacteria 1196
197 Ga0496108_0006830 3300048911 Bacteria 9235
198 Ga0496108_0071396 3300048911 Bacteria 2929
199 Ga0496108_0125994 3300048911 Bacteria 2199
200 Ga0496109_0017376 3300048912 Bacteria 6305
201 Ga0496109_0770123 3300048912 Bacteria 900
202 Ga0496110_0025602 3300048913 Bacteria 5044
203 Ga0496110_0191237 3300048913 Bacteria 1859
204 Ga0496110_0269669 3300048913 Bacteria 1550
205 Ga0496111_0059635 3300048914 Bacteria 2765
206 Ga0496112_0051343 3300048915 Bacteria 4045
207 Ga0496113_0070278 3300048916 Bacteria 2661
208 Ga0496114_0033716 3300048917 Bacteria 4221
209 Ga0496114_0307312 3300048917 Bacteria 1400
210 Ga0496114_0551898 3300048917 Bacteria 1018
211 Ga0501031_0036749 3300049568 Bacteria 3196
212 Ga0501034_0007412 3300049571 Bacteria 11677
213 Ga0501034_0026054 3300049571 Bacteria 5956
214 Ga0501034_0066409 3300049571 Bacteria 3620
215 Ga0501036_0082142 3300049572 Bacteria 2723
216 Ga0501036_0140386 3300049572 Bacteria 2039
217 Ga0501036_0448504 3300049572 Bacteria 1075
218 Ga0501037_0001399 3300049573 Bacteria 17692
219 Ga0501037_0066139 3300049573 Bacteria 2634
220 Ga0501038_0000703 3300049574 Bacteria 29849
221 Ga0501038_0005487 3300049574 Bacteria 11778
222 Ga0501038_0308795 3300049574 Bacteria 1240
223 Ga0501039_0002460 3300049575 Bacteria 13795
224 Ga0501039_0126921 3300049575 Bacteria 2001
225 Ga0501039_0153072 3300049575 Bacteria 1812
226 Ga0501040_0031732 3300049576 Bacteria 3572
227 Ga0501041_0073960 3300049577 Bacteria 2094
228 Ga0501041_0248014 3300049577 Bacteria 1119
229 Ga0501042_0027001 3300049578 Bacteria 4036
230 Ga0501043_0018511 3300049579 Bacteria 5464
231 Ga0501043_0143386 3300049579 Bacteria 1870
232 Ga0501046_0012644 3300049580 Bacteria 7176
233 Ga0501046_0058793 3300049580 Bacteria 3013
234 Ga0501048_0008944 3300049582 Bacteria 7540
235 Ga0501048_0325994 3300049582 Bacteria 1094
236 Ga0501067_0004283 3300049583 Bacteria 7865
237 Ga0501069_0046936 3300049585 Bacteria 2397
238 Ga0501069_0081137 3300049585 Bacteria 1827
239 Ga0501069_0169175 3300049585 Bacteria 1260
240 Ga0501070_0010272 3300049586 Bacteria 7916
241 Ga0501070_0062552 3300049586 Bacteria 3083
242 Ga0501070_0182178 3300049586 Bacteria 1728
243 Ga0501072_0329941 3300049588 Bacteria 1212
244 Ga0501073_0232669 3300049589 Bacteria 1273
245 Ga0501075_0144856 3300049591 Bacteria 1811
246 Ga0501080_0166964 3300049742 Bacteria 2031
247 Ga0501080_0197019 3300049742 Bacteria 1850
248 Ga0501081_0134452 3300049743 Bacteria 1769
249 Ga0501035_0004179 3300049822 Bacteria 13724
250 Ga0501044_0074405 3300049823 Bacteria 3451
251 Ga0501045_0124147 3300049824 Bacteria 1917
252 nmdc:mga03683_30540_c1 3300050489 Bacteria 2156
253 nmdc:mga03683_42998_c1 3300050489 Bacteria 1862
254 nmdc:mga03n38_11284_c1 3300050490 Bacteria 3322
255 nmdc:mga03n38_18669_c1 3300050490 Bacteria 2742
256 nmdc:mga03n38_54817_c1 3300050490 Bacteria 1794
257 nmdc:mga03n38_5696_c1 3300050490 Bacteria 4266
258 nmdc:mga03n38_57167_c1 3300050490 Bacteria 1763
259 nmdc:mga03n38_63755_c1 3300050490 Bacteria 1685
260 nmdc:mga03n38_73370_c1 3300050490 Bacteria 1589
261 nmdc:mga03n38_84305_c1 3300050490 Bacteria 1500
262 nmdc:mga03n38_92394_c1 3300050490 Bacteria 1443
263 nmdc:mga00v17_19404_c1 3300050491 Bacteria 3881
264 nmdc:mga00v17_264_c1 3300050491 Bacteria 30927
265 nmdc:mga00v17_3024_c1 3300050491 Bacteria 8642
266 nmdc:mga00v17_6916_c1 3300050491 Bacteria 6030
267 nmdc:mga00v17_938_c1 3300050491 Bacteria 15668
268 nmdc:mga0yw44_107436_c1 3300050492 Bacteria 1785
269 nmdc:mga0yw44_12344_c1 3300050492 Bacteria 4449
270 nmdc:mga0yw44_181038_c1 3300050492 Bacteria 1387
271 nmdc:mga0yw44_36467_c1 3300050492 Bacteria 2898
272 nmdc:mga0yw44_52533_c1 3300050492 Bacteria 2471
273 nmdc:mga06z11_2100_c1 3300050494 Bacteria 7566
274 nmdc:mga04h51_74338_c1 3300050495 Bacteria 1194
275 nmdc:mga07m45_152405_c1 3300050496 Bacteria 1341
276 nmdc:mga07m45_202976_c1 3300050496 Bacteria 1153
277 nmdc:mga07m45_27182_c1 3300050496 Bacteria 3150
278 nmdc:mga07m45_4032_c1 3300050496 Bacteria 7152
279 nmdc:mga07m45_68117_c1 3300050496 Bacteria 2023
280 nmdc:mga06r32_3363_c1 3300050510 Bacteria 14318
281 nmdc:mga08y16_192318_c1 3300050511 Bacteria 2116
282 nmdc:mga0sz30_1300_c1 3300050516 Bacteria 8878
283 nmdc:mga0sz30_909_c1 3300050516 Bacteria 10635
284 Ga0500641_0000736 3300053096 Bacteria 11863
285 Ga0501084_0101936 3300054114 Bacteria 2411
286 Ga0466962_0003884 3300061719 Bacteria 7141
287 Ga0466962_0046252 3300061719 Bacteria 2079
288 Ga0466962_0049406 3300061719 Bacteria 2010
289 Ga0466962_0064328 3300061719 Bacteria 1751
290 Ga0466962_0067797 3300061719 Bacteria 1704
291 2559429878 2558860280 Bacteria 11429938
292 2643888978 2643221576 Bacteria 5214352
293 2643958033 2643221590 Bacteria 5214697
294 2644034519 2643221604 Bacteria 5014917
295 2645719324 2643221961 Bacteria 3919167
296 2738868070 2738541305 Bacteria 4910150
297 2784471918 2784132109 Bacteria 3141763
298 2812332392 2811994874 Bacteria 5367947
299 2812350627 2811994878 Bacteria 5992952
300 2855387811 2855386786 Bacteria 4752232
301 2857485873 2857481737 Bacteria 4761446
302 2891971772 2891968417 Bacteria 5821697
303 2990258296 2990256926 Bacteria 4252839
304 3001891137 3001889506 Bacteria 2975194
305 Ga0207678_10127465
306 LJQas_1009019
307 Ga0070683_100153569
308 Ga0070670_100182319
309 Ga0070682_100179522
310 Ga0070660_100005688
311 Ga0070661_100061375
312 Ga0070659_100001990
313 Ga0070667_100004448
314 Ga0070714_100024086
315 Ga0070714_100350225
316 Ga0070710_10000022
317 Ga0070663_100074236
318 Ga0070698_100047471
319 Ga0070679_100607500
320 Ga0070684_100348081
321 Ga0068853_100019302
322 Ga0070686_100191279
323 Ga0070696_100002219
324 Ga0070665_100058081
325 Ga0070664_100094469
326 Ga0070664_100179747
327 Ga0068852_100258557
328 Ga0068852_100529873
329 Ga0068859_100609875
330 Ga0068863_100013687
331 Ga0068863_100181921
332 Ga0081455_10000249
333 Ga0081539_10089174
334 Ga0075365_10004862
335 Ga0075365_10018125
336 Ga0075365_10029088
337 Ga0075365_10063350
338 Ga0075365_10196220
339 Ga0075368_10004309
340 Ga0075363_100002226
341 Ga0075363_100006558
342 Ga0075363_100006618
343 Ga0075363_100008786
344 Ga0075363_100009009
345 Ga0075363_100010606
346 Ga0075363_100015499
347 Ga0075363_100018788
348 Ga0075363_100022947
349 Ga0075363_100026211
350 Ga0075364_10000494
351 Ga0075364_10001410
352 Ga0075364_10005314
353 Ga0075364_10144079
354 Ga0070716_100031053
355 Ga0075362_10004943
356 Ga0075362_10037505
357 Ga0075362_10042982
358 Ga0075367_10008729
359 Ga0075367_10027313
360 Ga0075367_10038499
361 Ga0075369_10000653
362 Ga0075369_10055308
363 Ga0075370_10007517
364 Ga0075370_10008759
365 Ga0075370_10059752
366 Ga0075370_10061821
367 Ga0075370_10129729
368 Ga0075370_10143618
369 Ga0075428_100356464
370 Ga0075430_100214543
371 Ga0075431_100000088
372 Ga0097620_100609945
373 Ga0111539_10090230
374 Ga0111539_10092735
375 Ga0105245_10050911
376 Ga0105245_10130795
377 Ga0105245_10290617
378 Ga0105243_10012499
379 Ga0105248_10405863
380 Ga0105237_10217838
381 Ga0105238_10177432
382 Ga0105238_10477055
383 Ga0105238_10529919
384 Ga0105249_10234330
385 Ga0105239_10031872
386 Ga0157375_10114128
387 Ga0163163_10145504
388 Ga0157377_10124337
389 Ga0206353_10886113
390 Ga0154015_1562139
391 Ga0213875_10004165
392 Ga0209025_1058074
393 Ga0207682_10109325
394 Ga0207692_10000390
395 Ga0207647_10018485
396 Ga0207705_10003881
397 Ga0207707_10194308
398 Ga0207662_10148683
399 Ga0207657_10009355
400 Ga0207657_10079113
401 Ga0207649_10041093
402 Ga0207709_10068763
403 Ga0207665_10063580
404 Ga0207679_10120207
405 Ga0207678_10222200
406 Ga0207641_10105159
407 Ga0207675_100188635
408 Ga0207698_10169902
409 Ga0207698_10218661
410 Ga0207698_10577739
411 Ga0209813_10025797
412 Ga0268266_10043483
413 Ga0307511_10000324
414 Ga0316176_1211198
415 Ga0314311_1005961
416 Ga0265325_10059147
417 Ga0265340_10026358
418 Ga0265314_10074211
419 Ga0307410_10145242
420 Ga0307410_10260290
421 Ga0307407_10037692
422 Ga0307412_10023975
423 Ga0307416_100034435
424 Ga0307416_100209856
425 Ga0307415_100001609
426 Ga0395899_0179206
427 Ga0395900_0048008
428 Ga0395900_0103962
429 Ga0395900_0142151
430 Ga0395898_0229938
431 Ga0436364_0383034
432 Ga0395901_0035325
433 Ga0395901_0575531
434 Ga0439461_0011533
435 Ga0439466_0032387
436 Ga0451853_0898999
437 Ga0439442_016672
438 Ga0439445_0026771
439 Ga0439435_0039627
440 Ga0466969_0001230
441 Ga0466969_0006947
442 Ga0466972_0003230
443 Ga0466972_0023702
444 Ga0466972_0038516
445 Ga0466972_0177097
446 Ga0466965_0004804
447 Ga0466965_0006800
448 Ga0466965_0015635
449 Ga0466965_0033136
450 Ga0466965_0036523
451 Ga0466965_0052809
452 Ga0466966_0000466
453 Ga0466966_0034846
454 Ga0466961_0024584
455 Ga0466961_0030029
456 Ga0466961_0100294
457 Ga0466963_0288144
458 Ga0466964_0031550
459 Ga0466971_0084996
460 Ga0466971_0106416
461 Ga0466968_0005135
462 Ga0466968_0032815
463 Ga0466968_0040095
464 Ga0466970_0002109
465 Ga0466970_0005935
466 Ga0466970_0008368
467 Ga0466970_0017848
468 Ga0466970_0021547
469 Ga0466970_0029503
470 Ga0466970_0037113
471 Ga0466970_0065315
472 Ga0466957_0022360
473 Ga0466957_0025159
474 Ga0466957_0031288
475 Ga0466957_0035832
476 Ga0466957_0188792
477 Ga0466957_0304125
478 Ga0466960_0000190
479 Ga0466960_0010317
480 Ga0466960_0011123
481 Ga0466960_0032675
482 Ga0466960_0036030
483 Ga0466960_0055106
484 Ga0466959_0007635
485 Ga0466959_0044470
486 Ga0466959_0104614
487 Ga0466958_0065156
488 Ga0466967_0014429
489 Ga0466967_0016193
490 Ga0466967_0105557
491 Ga0466967_0128597
492 Ga0466967_0209202
493 Ga0466967_0275436
494 Ga0466967_0351104
495 Ga0495583_0153966
496 Ga0495649_0199688
497 Ga0495672_0066810
498 Ga0496102_0032598
499 Ga0496105_0023148
500 Ga0496105_0342190
501 Ga0496108_0006830
502 Ga0496108_0071396
503 Ga0496108_0125994
504 Ga0496109_0017376
505 Ga0496109_0770123
506 Ga0496110_0025602
507 Ga0496110_0191237
508 Ga0496110_0269669
509 Ga0496111_0059635
510 Ga0496112_0051343
511 Ga0496113_0070278
512 Ga0496114_0033716
513 Ga0496114_0307312
514 Ga0496114_0551898
515 Ga0501031_0036749
516 Ga0501034_0007412
517 Ga0501034_0026054
518 Ga0501034_0066409
519 Ga0501036_0082142
520 Ga0501036_0140386
521 Ga0501036_0448504
522 Ga0501037_0001399
523 Ga0501037_0066139
524 Ga0501038_0000703
525 Ga0501038_0005487
526 Ga0501038_0308795
527 Ga0501039_0002460
528 Ga0501039_0126921
529 Ga0501039_0153072
530 Ga0501040_0031732
531 Ga0501041_0073960
532 Ga0501041_0248014
533 Ga0501042_0027001
534 Ga0501043_0018511
535 Ga0501043_0143386
536 Ga0501046_0012644
537 Ga0501046_0058793
538 Ga0501048_0008944
539 Ga0501048_0325994
540 Ga0501067_0004283
541 Ga0501069_0046936
542 Ga0501069_0081137
543 Ga0501069_0169175
544 Ga0501070_0010272
545 Ga0501070_0062552
546 Ga0501070_0182178
547 Ga0501072_0329941
548 Ga0501073_0232669
549 Ga0501075_0144856
550 Ga0501080_0166964
551 Ga0501080_0197019
552 Ga0501081_0134452
553 Ga0501035_0004179
554 Ga0501044_0074405
555 Ga0501045_0124147
556 nmdc:mga03683_30540_c1
557 nmdc:mga03683_42998_c1
558 nmdc:mga03n38_11284_c1
559 nmdc:mga03n38_18669_c1
560 nmdc:mga03n38_54817_c1
561 nmdc:mga03n38_5696_c1
562 nmdc:mga03n38_57167_c1
563 nmdc:mga03n38_63755_c1
564 nmdc:mga03n38_73370_c1
565 nmdc:mga03n38_84305_c1
566 nmdc:mga03n38_92394_c1
567 nmdc:mga00v17_19404_c1
568 nmdc:mga00v17_264_c1
569 nmdc:mga00v17_3024_c1
570 nmdc:mga00v17_6916_c1
571 nmdc:mga00v17_938_c1
572 nmdc:mga0yw44_107436_c1
573 nmdc:mga0yw44_12344_c1
574 nmdc:mga0yw44_181038_c1
575 nmdc:mga0yw44_36467_c1
576 nmdc:mga0yw44_52533_c1
577 nmdc:mga06z11_2100_c1
578 nmdc:mga04h51_74338_c1
579 nmdc:mga07m45_152405_c1
580 nmdc:mga07m45_202976_c1
581 nmdc:mga07m45_27182_c1
582 nmdc:mga07m45_4032_c1
583 nmdc:mga07m45_68117_c1
584 nmdc:mga06r32_3363_c1
585 nmdc:mga08y16_192318_c1
586 nmdc:mga0sz30_1300_c1
587 nmdc:mga0sz30_909_c1
588 Ga0500641_0000736
589 Ga0501084_0101936
590 Ga0466962_0003884
591 Ga0466962_0046252
592 Ga0466962_0049406
593 Ga0466962_0064328
594 Ga0466962_0067797
595 2559429878
596 2643888978
597 2643958033
598 2644034519
599 2645719324
600 2738868070
601 2784471918
602 2812332392
603 2812350627
604 2855387811
605 2857485873
606 2891971772
607 2990258296
608 3001891137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00849

PseudoU_synth_2

RNA pseudouridylate synthase

126

280

0.97

PF03070

TENA_THI-4

TENA/THI-4/PQQC family

14

119

0.89

PF14518

Haem_oxygenas_2

Iron-containing redox enzyme

44

157

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nbu-assembly1.cif.gz_D structure of the higb1 toxin mutant k95a from mycobacterium tuberculosis (rv1955) and its target, the cspa mrna, on the e. coli ribosome. 0.9042 20 66
5z81-assembly1.cif.gz_C trimeric structure of vibrio cholerae heat shock protein 15 at 2.3 angstrom resolution 0.9027 18 64
8ced-assembly1.cif.gz_F rnase r bound to a 30s degradation intermediate (state i - head-turning) 0.8957 20 66
4v47-assembly1.cif.gz_BD real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the ef-g.gtp state of e. coli 70s ribosome 0.8942 20 64
7asa-assembly1.cif.gz_1 bacillus subtilis ribosome-associated quality control complex state b, multibody refinement focussed on rqch. ribosomal 50s subunit with p-trna, rqch, and rqcp/yabo 0.8902 20 66
ID Description Score Start End Superfamily
af_P9WHQ3_3_67_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9612 8 69 3.10.290.10
af_Q5JNI6_225_280_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9368 18 66 3.10.290.10
af_A0A1D6JNZ0_152_214_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.931 18 58 3.10.290.10
af_P9WHQ3_81_307_3.30.2350.10 Alpha Beta;2-Layer Sandwich;Pseudouridine synthase;Pseudouridine synthase 0.9285 86 310 3.30.2350.10
af_P9WHQ1_10_70_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9237 18 66 3.10.290.10
ID Description Score Start End GO Terms
AF-A0A448UT97-F1-model_v4 Ribosomal large subunit pseudouridine synthase D (EC 5.4.99.23) 0.9894 150 310 GO:0000455
GO:0003723
GO:0160140
AF-A0A3D2VKT9-F1-model_v4 RNA pseudouridine synthase 0.9759 190 312 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A6J6GGR7-F1-model_v4 Unannotated protein 0.9694 183 311 GO:0000455
GO:0003723
GO:0009982
AF-A0A3D2VKT9-F1-model_v4 RNA pseudouridine synthase 0.9681 190 312 GO:0000455
GO:0003723
GO:0009982
GO:0140098
AF-A0A317Z3S0-F1-model_v4 RluA family pseudouridine synthase 0.9652 172 244 GO:0000455
GO:0003723
GO:0009982
GO:0140098

Map