F397530

General Info

Members Datasets Scaffolds Average Seq Length
304 179 608 130

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100579576|Ga0075435_1005795762
Length 135
Sequence MSSAPTPRSGQPARPKYYDLSLAHLPPPGLVSIFHRISGLLLFFPLLPLLLYVLQTTLGSEQGYARWAEFFTQRPAVKLILLGFVWAYAHHFFAGIRYLLLDVHWGVAKASARASAVAVLVLGVLTTLVVGWRIW

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
147 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
148 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
149 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
150 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
151 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
152 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
155 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
156 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
178 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 1.97
Rhizosphere 93.42
Stem 0
Stem Tuber 0
Unclassified 8.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100579576 3300007076 Bacteria 972
2 Ga0070658_10015140 3300005327 Bacteria 6173
3 Ga0070658_10028991 3300005327 Bacteria 4445
4 Ga0070658_10080270 3300005327 Bacteria 2679
5 Ga0070683_100321799 3300005329 Bacteria 1472
6 Ga0070683_100681625 3300005329 Bacteria 984
7 Ga0070690_100159912 3300005330 Bacteria 1543
8 Ga0070690_100812021 3300005330 Bacteria 726
9 Ga0068869_101541160 3300005334 Bacteria 591
10 Ga0068868_100090715 3300005338 Bacteria 2462
11 Ga0068868_100140267 3300005338 Bacteria 1984
12 Ga0068868_101420229 3300005338 Bacteria 648
13 Ga0070689_100011824 3300005340 Bacteria 6265
14 Ga0070689_100208742 3300005340 Bacteria 1598
15 Ga0070689_100404374 3300005340 Bacteria 1155
16 Ga0070689_101003452 3300005340 Bacteria 743
17 Ga0070687_100066624 3300005343 Bacteria 1919
18 Ga0070687_100392840 3300005343 Bacteria 907
19 Ga0070661_100087886 3300005344 Bacteria 2300
20 Ga0070692_10458296 3300005345 Bacteria 818
21 Ga0070692_11151550 3300005345 Bacteria 550
22 Ga0070669_100133435 3300005353 Bacteria 1908
23 Ga0070675_100036731 3300005354 Bacteria 3988
24 Ga0070675_100133398 3300005354 Bacteria 2118
25 Ga0070671_100344187 3300005355 Bacteria 1272
26 Ga0070674_100274378 3300005356 Bacteria 1334
27 Ga0070674_100902648 3300005356 Unclassified 770
28 Ga0070688_100425087 3300005365 Bacteria 988
29 Ga0070688_101060230 3300005365 Bacteria 646
30 Ga0070659_100792450 3300005366 Unclassified 824
31 Ga0070659_101597246 3300005366 Bacteria 582
32 Ga0070714_100015758 3300005435 Bacteria 6089
33 Ga0070714_100638009 3300005435 Bacteria 1025
34 Ga0070713_100150358 3300005436 Bacteria 2071
35 Ga0070701_10237007 3300005438 Bacteria 1096
36 Ga0070711_100545703 3300005439 Bacteria 961
37 Ga0070711_101076634 3300005439 Bacteria 692
38 Ga0070705_100814542 3300005440 Bacteria 744
39 Ga0070700_101177426 3300005441 Bacteria 639
40 Ga0070708_101830323 3300005445 Bacteria 563
41 Ga0070678_100767719 3300005456 Bacteria 873
42 Ga0070678_101275520 3300005456 Unclassified 683
43 Ga0070678_102240291 3300005456 Unclassified 518
44 Ga0068867_100441167 3300005459 Bacteria 1107
45 Ga0068867_100563980 3300005459 Unclassified 988
46 Ga0070698_100337430 3300005471 Bacteria 1439
47 Ga0070699_100265146 3300005518 Bacteria 1537
48 Ga0070679_100043798 3300005530 Bacteria 4457
49 Ga0070679_100796665 3300005530 Bacteria 888
50 Ga0070679_100965746 3300005530 Bacteria 796
51 Ga0070684_102175755 3300005535 Unclassified 523
52 Ga0070697_100272391 3300005536 Bacteria 1451
53 Ga0070686_100860026 3300005544 Bacteria 735
54 Ga0070686_101505564 3300005544 Bacteria 567
55 Ga0070695_100582355 3300005545 Bacteria 876
56 Ga0070696_100107782 3300005546 Bacteria 2004
57 Ga0070693_100002260 3300005547 Bacteria 8830
58 Ga0070693_100085552 3300005547 Bacteria 1890
59 Ga0070693_100129473 3300005547 Bacteria 1576
60 Ga0070665_100065032 3300005548 Bacteria 3659
61 Ga0070665_101253262 3300005548 Unclassified 752
62 Ga0070704_100349919 3300005549 Bacteria 1247
63 Ga0070704_100410847 3300005549 Bacteria 1157
64 Ga0068855_100064514 3300005563 Bacteria 4271
65 Ga0068854_100170950 3300005578 Bacteria 1691
66 Ga0068854_100708818 3300005578 Bacteria 869
67 Ga0068854_101024177 3300005578 Bacteria 732
68 Ga0068854_101293675 3300005578 Bacteria 656
69 Ga0068854_101453251 3300005578 Bacteria 621
70 Ga0070702_101279942 3300005615 Bacteria 595
71 Ga0068852_100011442 3300005616 Bacteria 6680
72 Ga0068852_100460897 3300005616 Bacteria 1260
73 Ga0068859_100058550 3300005617 Bacteria 3881
74 Ga0068859_100694812 3300005617 Unclassified 1108
75 Ga0068864_100516666 3300005618 Unclassified 1151
76 Ga0068861_101969887 3300005719 Bacteria 582
77 Ga0068851_10003355 3300005834 Bacteria 7121
78 Ga0068851_10239086 3300005834 Bacteria 1026
79 Ga0068863_100194260 3300005841 Bacteria 1951
80 Ga0068858_100011090 3300005842 Bacteria 8521
81 Ga0068858_100285438 3300005842 Bacteria 1572
82 Ga0068858_101395580 3300005842 Bacteria 690
83 Ga0068860_100511229 3300005843 Bacteria 1200
84 Ga0068862_101578167 3300005844 Bacteria 663
85 Ga0070717_10252949 3300006028 Bacteria 1557
86 Ga0075432_10553869 3300006058 Bacteria 520
87 Ga0070715_10253039 3300006163 Bacteria 921
88 Ga0070716_100571622 3300006173 Bacteria 846
89 Ga0070712_101484939 3300006175 Bacteria 592
90 Ga0075367_10462770 3300006178 Bacteria 804
91 Ga0075366_10086816 3300006195 Bacteria 1872
92 Ga0075366_10136116 3300006195 Bacteria 1483
93 Ga0075366_10178262 3300006195 Bacteria 1290
94 Ga0097621_100004904 3300006237 Bacteria 9385
95 Ga0097621_100021443 3300006237 Bacteria 4998
96 Ga0097621_101761560 3300006237 Bacteria 590
97 Ga0075370_10441196 3300006353 Bacteria 783
98 Ga0068871_100012235 3300006358 Bacteria 6318
99 Ga0068871_100073517 3300006358 Bacteria 2818
100 Ga0068871_101212893 3300006358 Bacteria 708
101 Ga0075428_100041048 3300006844 Bacteria 5089
102 Ga0075433_10049688 3300006852 Bacteria 3649
103 Ga0075434_100104322 3300006871 Bacteria 2844
104 Ga0075434_101246997 3300006871 Bacteria 755
105 Ga0068865_100115083 3300006881 Bacteria 1990
106 Ga0075436_100015869 3300006914 Bacteria 5157
107 Ga0075436_100340730 3300006914 Bacteria 1079
108 Ga0097620_100058551 3300006931 Bacteria 3881
109 Ga0097620_100694874 3300006931 Unclassified 1108
110 Ga0075435_100142791 3300007076 Bacteria 2009
111 Ga0105240_10028075 3300009093 Bacteria 7358
112 Ga0105240_10043233 3300009093 Bacteria 5734
113 Ga0105240_10979294 3300009093 Bacteria 906
114 Ga0111539_10001299 3300009094 Bacteria 33371
115 Ga0105245_10082983 3300009098 Bacteria 2932
116 Ga0105245_10112109 3300009098 Bacteria 2538
117 Ga0105245_10659616 3300009098 Bacteria 1077
118 Ga0105247_11393749 3300009101 Unclassified 567
119 Ga0114129_10761252 3300009147 Bacteria 1239
120 Ga0105243_10071555 3300009148 Bacteria 2804
121 Ga0105243_10893732 3300009148 Bacteria 883
122 Ga0105243_10951274 3300009148 Bacteria 858
123 Ga0105243_12315116 3300009148 Bacteria 575
124 Ga0105242_10015783 3300009176 Bacteria 5868
125 Ga0105242_10045746 3300009176 Bacteria 3548
126 Ga0105242_10942492 3300009176 Bacteria 867
127 Ga0105248_10023772 3300009177 Bacteria 6810
128 Ga0105248_10088952 3300009177 Bacteria 3476
129 Ga0105248_10232069 3300009177 Bacteria 2077
130 Ga0105248_10717201 3300009177 Bacteria 1128
131 Ga0105238_10103920 3300009551 Bacteria 2822
132 Ga0105238_10225040 3300009551 Bacteria 1852
133 Ga0105238_10262448 3300009551 Bacteria 1707
134 Ga0105238_11166290 3300009551 Bacteria 794
135 Ga0105249_10542549 3300009553 Bacteria 1213
136 Ga0105249_10546651 3300009553 Bacteria 1208
137 Ga0105239_11435830 3300010375 Bacteria 797
138 Ga0157370_10731763 3300013104 Bacteria 902
139 Ga0157370_11027538 3300013104 Bacteria 746
140 Ga0157369_11352096 3300013105 Unclassified 725
141 Ga0157374_10104290 3300013296 Bacteria 2722
142 Ga0157374_10204706 3300013296 Bacteria 1934
143 Ga0157374_10340597 3300013296 Bacteria 1489
144 Ga0157378_10366677 3300013297 Bacteria 1411
145 Ga0157378_10497890 3300013297 Bacteria 1217
146 Ga0157378_10500688 3300013297 Bacteria 1214
147 Ga0163162_10419813 3300013306 Bacteria 1470
148 Ga0157372_11861459 3300013307 Bacteria 692
149 Ga0157375_10375305 3300013308 Bacteria 1589
150 Ga0157375_11991663 3300013308 Unclassified 690
151 Ga0157375_13443443 3300013308 Bacteria 527
152 Ga0163163_10774191 3300014325 Bacteria 1023
153 Ga0157380_10311997 3300014326 Bacteria 1454
154 Ga0157380_10473303 3300014326 Bacteria 1209
155 Ga0157380_10496419 3300014326 Bacteria 1184
156 Ga0157380_12143532 3300014326 Bacteria 622
157 Ga0157379_10165816 3300014968 Bacteria 1994
158 Ga0157376_10176990 3300014969 Bacteria 1947
159 Ga0157376_10179824 3300014969 Bacteria 1932
160 Ga0157376_10502736 3300014969 Bacteria 1192
161 Ga0207656_10029214 3300025321 Bacteria 2269
162 Ga0207688_10014116 3300025901 Bacteria 4345
163 Ga0207685_10558523 3300025905 Unclassified 610
164 Ga0207705_10012024 3300025909 Bacteria 6254
165 Ga0207705_10015613 3300025909 Bacteria 5452
166 Ga0207705_10094483 3300025909 Bacteria 2193
167 Ga0207707_10319570 3300025912 Unclassified 1341
168 Ga0207695_10020712 3300025913 Bacteria 7524
169 Ga0207695_10050171 3300025913 Bacteria 4392
170 Ga0207662_10155412 3300025918 Bacteria 1458
171 Ga0207662_10243505 3300025918 Unclassified 1178
172 Ga0207649_10713378 3300025920 Unclassified 778
173 Ga0207652_10190165 3300025921 Bacteria 1846
174 Ga0207646_10129013 3300025922 Bacteria 2275
175 Ga0207694_10777434 3300025924 Bacteria 809
176 Ga0207694_10987765 3300025924 Bacteria 712
177 Ga0207694_11046734 3300025924 Bacteria 691
178 Ga0207687_10029585 3300025927 Bacteria 3686
179 Ga0207687_10417307 3300025927 Bacteria 1107
180 Ga0207700_11005699 3300025928 Bacteria 746
181 Ga0207664_10014237 3300025929 Bacteria 5737
182 Ga0207664_10521058 3300025929 Bacteria 1065
183 Ga0207690_10148834 3300025932 Bacteria 1734
184 Ga0207706_10188244 3300025933 Bacteria 1812
185 Ga0207686_10028329 3300025934 Bacteria 3292
186 Ga0207686_10029135 3300025934 Bacteria 3254
187 Ga0207709_10060282 3300025935 Bacteria 2365
188 Ga0207709_10622038 3300025935 Bacteria 857
189 Ga0207670_10024813 3300025936 Bacteria 3753
190 Ga0207670_10025627 3300025936 Bacteria 3704
191 Ga0207670_10446230 3300025936 Bacteria 1042
192 Ga0207669_10034547 3300025937 Bacteria 2866
193 Ga0207669_10404894 3300025937 Unclassified 1070
194 Ga0207669_11092503 3300025937 Bacteria 673
195 Ga0207704_10061750 3300025938 Bacteria 2326
196 Ga0207665_10411111 3300025939 Bacteria 1032
197 Ga0207691_10148390 3300025940 Bacteria 2063
198 Ga0207691_11269819 3300025940 Bacteria 609
199 Ga0207711_10025198 3300025941 Bacteria 4990
200 Ga0207711_10130155 3300025941 Bacteria 2255
201 Ga0207711_10265919 3300025941 Bacteria 1577
202 Ga0207661_10318785 3300025944 Bacteria 1397
203 Ga0207661_10325451 3300025944 Bacteria 1383
204 Ga0207667_10017756 3300025949 Bacteria 8002
205 Ga0207667_10158387 3300025949 Bacteria 2330
206 Ga0207651_10241215 3300025960 Bacteria 1473
207 Ga0207651_11036651 3300025960 Bacteria 734
208 Ga0207651_11605323 3300025960 Bacteria 586
209 Ga0207712_10396054 3300025961 Bacteria 1159
210 Ga0207640_10276026 3300025981 Bacteria 1318
211 Ga0207640_10532647 3300025981 Bacteria 984
212 Ga0207640_11159854 3300025981 Bacteria 685
213 Ga0207640_11493314 3300025981 Bacteria 607
214 Ga0207640_11731832 3300025981 Bacteria 564
215 Ga0207658_10577836 3300025986 Bacteria 1008
216 Ga0207677_10378816 3300026023 Bacteria 1194
217 Ga0207703_10050864 3300026035 Bacteria 3355
218 Ga0207703_10128952 3300026035 Bacteria 2181
219 Ga0207703_11020997 3300026035 Bacteria 794
220 Ga0207708_10026909 3300026075 Bacteria 4355
221 Ga0207708_10621900 3300026075 Bacteria 917
222 Ga0207641_10439568 3300026088 Bacteria 1259
223 Ga0207648_10243982 3300026089 Bacteria 1600
224 Ga0207676_10982610 3300026095 Bacteria 831
225 Ga0207676_11802481 3300026095 Bacteria 611
226 Ga0207674_10030478 3300026116 Bacteria 5670
227 Ga0207675_100711795 3300026118 Bacteria 1014
228 Ga0207675_101439333 3300026118 Bacteria 710
229 Ga0207683_10044074 3300026121 Bacteria 3900
230 Ga0207683_10823471 3300026121 Bacteria 862
231 Ga0207698_10009505 3300026142 Bacteria 6203
232 Ga0207698_10622713 3300026142 Bacteria 1066
233 Ga0207698_11214113 3300026142 Bacteria 768
234 Ga0207698_11248596 3300026142 Bacteria 757
235 Ga0207698_12144544 3300026142 Bacteria 572
236 Ga0209966_1108631 3300027695 Bacteria 631
237 Ga0207428_10007402 3300027907 Bacteria 10011
238 Ga0207428_10217304 3300027907 Bacteria 1434
239 Ga0268265_12308205 3300028380 Bacteria 545
240 Ga0268264_11774567 3300028381 Unclassified 627
241 Ga0307408_100193351 3300031548 Bacteria 1641
242 Ga0307408_100432111 3300031548 Bacteria 1138
243 Ga0307408_100805484 3300031548 Unclassified 853
244 Ga0307408_100960929 3300031548 Bacteria 785
245 Ga0307405_10369826 3300031731 Bacteria 1112
246 Ga0307405_10764071 3300031731 Bacteria 806
247 Ga0307410_10136645 3300031852 Bacteria 1808
248 Ga0307410_10276029 3300031852 Bacteria 1317
249 Ga0307407_10230341 3300031903 Bacteria 1258
250 Ga0307412_10522009 3300031911 Bacteria 992
251 Ga0307416_100199197 3300032002 Bacteria 1898
252 Ga0307416_100786504 3300032002 Bacteria 1046
253 Ga0307416_100918175 3300032002 Bacteria 976
254 Ga0307416_103343583 3300032002 Bacteria 537
255 Ga0307416_103711514 3300032002 Unclassified 511
256 Ga0307411_10215855 3300032005 Bacteria 1485
257 Ga0373930_0107963 3300034816 Bacteria 667
258 Ga0373929_0007694 3300035085 Bacteria 1972
259 Ga0373934_0092619 3300035086 Bacteria 1219
260 Ga0373931_0237057 3300035691 Bacteria 1104
261 Ga0373925_0015424 3300037068 Bacteria 5525
262 Ga0373925_0115291 3300037068 Bacteria 2080
263 Ga0395900_0033121 3300037418 Bacteria 5318
264 Ga0395905_0004116 3300037471 Bacteria 15241
265 Ga0395901_1281150 3300038443 Bacteria 695
266 Ga0436365_0646131 3300039437 Bacteria 2556
267 Ga0436360_1023535 3300039438 Bacteria 591
268 Ga0439439_0065298 3300041406 Bacteria 970
269 Ga0439447_058877 3300041407 Bacteria 906
270 Ga0451798_0672522 3300041458 Bacteria 756
271 Ga0451807_2509922 3300041486 Bacteria 725
272 Ga0451845_0412745 3300041501 Bacteria 636
273 Ga0451853_2468511 3300041512 Bacteria 1299
274 Ga0439441_133259 3300042001 Unclassified 577
275 Ga0439432_121547 3300042006 Bacteria 773
276 Ga0450899_016598 3300042135 Bacteria 845
277 Ga0451577_0381521 3300042876 Bacteria 1279
278 Ga0453683_0224094 3300044673 Bacteria 1196
279 Ga0495603_0291162 3300046455 Unclassified 938
280 Ga0495598_0052644 3300046537 Bacteria 1231
281 Ga0495598_0290750 3300046537 Bacteria 616
282 Ga0495598_0362161 3300046537 Unclassified 560
283 Ga0495621_0049798 3300046539 Bacteria 1496
284 Ga0495658_0128919 3300046683 Bacteria 1538
285 Ga0496104_0010667 3300048907 Bacteria 8212
286 Ga0496105_0093134 3300048908 Bacteria 2488
287 Ga0496108_0855780 3300048911 Bacteria 782
288 Ga0496110_0067822 3300048913 Bacteria 3157
289 Ga0501034_0634724 3300049571 Bacteria 971
290 Ga0501036_0574719 3300049572 Unclassified 936
291 Ga0501048_1170511 3300049582 Unclassified 553
292 nmdc:mga00v17_611539_c1 3300050491 Bacteria 702
293 nmdc:mga0k408_111551_c1 3300050493 Bacteria 1616
294 nmdc:mga0k408_131126_c1 3300050493 Bacteria 1488
295 nmdc:mga0k408_3227_c1 3300050493 Bacteria 7639
296 nmdc:mga06z11_216360_c1 3300050494 Bacteria 1118
297 nmdc:mga07m45_169940_c1 3300050496 Bacteria 1267
298 nmdc:mga05p37_646199_c1 3300050507 Bacteria 1185
299 nmdc:mga09592_111891_c1 3300050508 Bacteria 2342
300 nmdc:mga08y16_11124_c1 3300050511 Bacteria 9451
301 nmdc:mga0n895_1375822_c1 3300050512 Bacteria 675
302 nmdc:mga0n895_347928_c1 3300050512 Bacteria 1501
303 nmdc:mga08x19_372600_c1 3300050514 Bacteria 999
304 nmdc:mga0a205_167224_c1 3300050515 Bacteria 2095
305 Ga0075435_100579576
306 Ga0070658_10015140
307 Ga0070658_10028991
308 Ga0070658_10080270
309 Ga0070683_100321799
310 Ga0070683_100681625
311 Ga0070690_100159912
312 Ga0070690_100812021
313 Ga0068869_101541160
314 Ga0068868_100090715
315 Ga0068868_100140267
316 Ga0068868_101420229
317 Ga0070689_100011824
318 Ga0070689_100208742
319 Ga0070689_100404374
320 Ga0070689_101003452
321 Ga0070687_100066624
322 Ga0070687_100392840
323 Ga0070661_100087886
324 Ga0070692_10458296
325 Ga0070692_11151550
326 Ga0070669_100133435
327 Ga0070675_100036731
328 Ga0070675_100133398
329 Ga0070671_100344187
330 Ga0070674_100274378
331 Ga0070674_100902648
332 Ga0070688_100425087
333 Ga0070688_101060230
334 Ga0070659_100792450
335 Ga0070659_101597246
336 Ga0070714_100015758
337 Ga0070714_100638009
338 Ga0070713_100150358
339 Ga0070701_10237007
340 Ga0070711_100545703
341 Ga0070711_101076634
342 Ga0070705_100814542
343 Ga0070700_101177426
344 Ga0070708_101830323
345 Ga0070678_100767719
346 Ga0070678_101275520
347 Ga0070678_102240291
348 Ga0068867_100441167
349 Ga0068867_100563980
350 Ga0070698_100337430
351 Ga0070699_100265146
352 Ga0070679_100043798
353 Ga0070679_100796665
354 Ga0070679_100965746
355 Ga0070684_102175755
356 Ga0070697_100272391
357 Ga0070686_100860026
358 Ga0070686_101505564
359 Ga0070695_100582355
360 Ga0070696_100107782
361 Ga0070693_100002260
362 Ga0070693_100085552
363 Ga0070693_100129473
364 Ga0070665_100065032
365 Ga0070665_101253262
366 Ga0070704_100349919
367 Ga0070704_100410847
368 Ga0068855_100064514
369 Ga0068854_100170950
370 Ga0068854_100708818
371 Ga0068854_101024177
372 Ga0068854_101293675
373 Ga0068854_101453251
374 Ga0070702_101279942
375 Ga0068852_100011442
376 Ga0068852_100460897
377 Ga0068859_100058550
378 Ga0068859_100694812
379 Ga0068864_100516666
380 Ga0068861_101969887
381 Ga0068851_10003355
382 Ga0068851_10239086
383 Ga0068863_100194260
384 Ga0068858_100011090
385 Ga0068858_100285438
386 Ga0068858_101395580
387 Ga0068860_100511229
388 Ga0068862_101578167
389 Ga0070717_10252949
390 Ga0075432_10553869
391 Ga0070715_10253039
392 Ga0070716_100571622
393 Ga0070712_101484939
394 Ga0075367_10462770
395 Ga0075366_10086816
396 Ga0075366_10136116
397 Ga0075366_10178262
398 Ga0097621_100004904
399 Ga0097621_100021443
400 Ga0097621_101761560
401 Ga0075370_10441196
402 Ga0068871_100012235
403 Ga0068871_100073517
404 Ga0068871_101212893
405 Ga0075428_100041048
406 Ga0075433_10049688
407 Ga0075434_100104322
408 Ga0075434_101246997
409 Ga0068865_100115083
410 Ga0075436_100015869
411 Ga0075436_100340730
412 Ga0097620_100058551
413 Ga0097620_100694874
414 Ga0075435_100142791
415 Ga0105240_10028075
416 Ga0105240_10043233
417 Ga0105240_10979294
418 Ga0111539_10001299
419 Ga0105245_10082983
420 Ga0105245_10112109
421 Ga0105245_10659616
422 Ga0105247_11393749
423 Ga0114129_10761252
424 Ga0105243_10071555
425 Ga0105243_10893732
426 Ga0105243_10951274
427 Ga0105243_12315116
428 Ga0105242_10015783
429 Ga0105242_10045746
430 Ga0105242_10942492
431 Ga0105248_10023772
432 Ga0105248_10088952
433 Ga0105248_10232069
434 Ga0105248_10717201
435 Ga0105238_10103920
436 Ga0105238_10225040
437 Ga0105238_10262448
438 Ga0105238_11166290
439 Ga0105249_10542549
440 Ga0105249_10546651
441 Ga0105239_11435830
442 Ga0157370_10731763
443 Ga0157370_11027538
444 Ga0157369_11352096
445 Ga0157374_10104290
446 Ga0157374_10204706
447 Ga0157374_10340597
448 Ga0157378_10366677
449 Ga0157378_10497890
450 Ga0157378_10500688
451 Ga0163162_10419813
452 Ga0157372_11861459
453 Ga0157375_10375305
454 Ga0157375_11991663
455 Ga0157375_13443443
456 Ga0163163_10774191
457 Ga0157380_10311997
458 Ga0157380_10473303
459 Ga0157380_10496419
460 Ga0157380_12143532
461 Ga0157379_10165816
462 Ga0157376_10176990
463 Ga0157376_10179824
464 Ga0157376_10502736
465 Ga0207656_10029214
466 Ga0207688_10014116
467 Ga0207685_10558523
468 Ga0207705_10012024
469 Ga0207705_10015613
470 Ga0207705_10094483
471 Ga0207707_10319570
472 Ga0207695_10020712
473 Ga0207695_10050171
474 Ga0207662_10155412
475 Ga0207662_10243505
476 Ga0207649_10713378
477 Ga0207652_10190165
478 Ga0207646_10129013
479 Ga0207694_10777434
480 Ga0207694_10987765
481 Ga0207694_11046734
482 Ga0207687_10029585
483 Ga0207687_10417307
484 Ga0207700_11005699
485 Ga0207664_10014237
486 Ga0207664_10521058
487 Ga0207690_10148834
488 Ga0207706_10188244
489 Ga0207686_10028329
490 Ga0207686_10029135
491 Ga0207709_10060282
492 Ga0207709_10622038
493 Ga0207670_10024813
494 Ga0207670_10025627
495 Ga0207670_10446230
496 Ga0207669_10034547
497 Ga0207669_10404894
498 Ga0207669_11092503
499 Ga0207704_10061750
500 Ga0207665_10411111
501 Ga0207691_10148390
502 Ga0207691_11269819
503 Ga0207711_10025198
504 Ga0207711_10130155
505 Ga0207711_10265919
506 Ga0207661_10318785
507 Ga0207661_10325451
508 Ga0207667_10017756
509 Ga0207667_10158387
510 Ga0207651_10241215
511 Ga0207651_11036651
512 Ga0207651_11605323
513 Ga0207712_10396054
514 Ga0207640_10276026
515 Ga0207640_10532647
516 Ga0207640_11159854
517 Ga0207640_11493314
518 Ga0207640_11731832
519 Ga0207658_10577836
520 Ga0207677_10378816
521 Ga0207703_10050864
522 Ga0207703_10128952
523 Ga0207703_11020997
524 Ga0207708_10026909
525 Ga0207708_10621900
526 Ga0207641_10439568
527 Ga0207648_10243982
528 Ga0207676_10982610
529 Ga0207676_11802481
530 Ga0207674_10030478
531 Ga0207675_100711795
532 Ga0207675_101439333
533 Ga0207683_10044074
534 Ga0207683_10823471
535 Ga0207698_10009505
536 Ga0207698_10622713
537 Ga0207698_11214113
538 Ga0207698_11248596
539 Ga0207698_12144544
540 Ga0209966_1108631
541 Ga0207428_10007402
542 Ga0207428_10217304
543 Ga0268265_12308205
544 Ga0268264_11774567
545 Ga0307408_100193351
546 Ga0307408_100432111
547 Ga0307408_100805484
548 Ga0307408_100960929
549 Ga0307405_10369826
550 Ga0307405_10764071
551 Ga0307410_10136645
552 Ga0307410_10276029
553 Ga0307407_10230341
554 Ga0307412_10522009
555 Ga0307416_100199197
556 Ga0307416_100786504
557 Ga0307416_100918175
558 Ga0307416_103343583
559 Ga0307416_103711514
560 Ga0307411_10215855
561 Ga0373930_0107963
562 Ga0373929_0007694
563 Ga0373934_0092619
564 Ga0373931_0237057
565 Ga0373925_0015424
566 Ga0373925_0115291
567 Ga0395900_0033121
568 Ga0395905_0004116
569 Ga0395901_1281150
570 Ga0436365_0646131
571 Ga0436360_1023535
572 Ga0439439_0065298
573 Ga0439447_058877
574 Ga0451798_0672522
575 Ga0451807_2509922
576 Ga0451845_0412745
577 Ga0451853_2468511
578 Ga0439441_133259
579 Ga0439432_121547
580 Ga0450899_016598
581 Ga0451577_0381521
582 Ga0453683_0224094
583 Ga0495603_0291162
584 Ga0495598_0052644
585 Ga0495598_0290750
586 Ga0495598_0362161
587 Ga0495621_0049798
588 Ga0495658_0128919
589 Ga0496104_0010667
590 Ga0496105_0093134
591 Ga0496108_0855780
592 Ga0496110_0067822
593 Ga0501034_0634724
594 Ga0501036_0574719
595 Ga0501048_1170511
596 nmdc:mga00v17_611539_c1
597 nmdc:mga0k408_111551_c1
598 nmdc:mga0k408_131126_c1
599 nmdc:mga0k408_3227_c1
600 nmdc:mga06z11_216360_c1
601 nmdc:mga07m45_169940_c1
602 nmdc:mga05p37_646199_c1
603 nmdc:mga09592_111891_c1
604 nmdc:mga08y16_11124_c1
605 nmdc:mga0n895_1375822_c1
606 nmdc:mga0n895_347928_c1
607 nmdc:mga08x19_372600_c1
608 nmdc:mga0a205_167224_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

10

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.8021 24 134
6wu6-assembly1.cif.gz_C succinate-coenzyme q reductase 0.7781 24 134
2wdv-assembly1.cif.gz_C e. coli succinate:quinone oxidoreductase (sqr) with an empty quinone- binding pocket 0.7464 14 132
2wu2-assembly3.cif.gz_K crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant 0.7459 14 134
7jz2-assembly1.cif.gz_C succinate: quinone oxidoreductase sqr from e.coli k12 0.7387 11 134
ID Description Score Start End Superfamily
2wdrC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7534 14 134 1.20.1300.10
2ws3C00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7514 14 132 1.20.1300.10
af_Q54B67_6_296_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.7478 79 126 1.50.40.10
2wdvK00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7464 14 132 1.20.1300.10
2wdrC00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7439 14 134 1.20.1300.10
ID Description Score Start End GO Terms
AF-I2NQ66-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9207 47 134 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-I2NQ66-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.9016 47 134 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A1G0DR27-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.8927 36 134 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A258UA49-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.8901 35 134 GO:0006099
GO:0009055
GO:0016020
GO:0046872
AF-A0A069PAH3-F1-model_v4 Succinate dehydrogenase cytochrome b556 subunit 0.8893 40 133 GO:0006099
GO:0009055
GO:0016020
GO:0046872

Map