F397524

General Info

Members Datasets Scaffolds Average Seq Length
304 193 606 329

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10186998|Ga0075433_101869982
Length 383
Sequence MVLALSRGLALAVAVGTLVLLLAGETRSSDAVARIDPILTARLPGRKAMHYSPPVIGRRAWLTQSLVGAGILLMPRGARAQSPAGVFRVGWLSPAGSEAGGANLDALREGLSALGYQEGRNLAIESRWADGGSEQLPTLARELINLKVDVICTAGTQATRAARGVTSTLPVIFANVAFPVQQQLVASYARPGGNVTGVAFDGAEYGKRLELLKEIVPRLARVALIYNPENQGSVLALEETRRWARSLSITVEPYRIRGPHDLDEAFSGITRSHPDAMMTTADPLIAAYRGRIVAFAAKQRLIAMYPGKEYLEVGGLVFYGGSIPEMYRRVAVYVDRIRKGAKASELPVEQPTKFDTVINARAAKALGLTIPAAVLLRADQVLD

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
181 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
182 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
183 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
186 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
187 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
188 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
189 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
190 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
191 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
192 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
193 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.04
Metatranscriptomes 0
Isolates 2.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.64
Nodule 0.66
Rhizoplane 4.61
Rhizosphere 90.13
Stem 0
Stem Tuber 0
Unclassified 10.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10186998 3300006852 Bacteria 1843
2 Ga0070683_100113511 3300005329 Bacteria 2557
3 Ga0070670_100008733 3300005331 Bacteria 8651
4 Ga0070670_100022430 3300005331 Bacteria 5434
5 Ga0070670_100286383 3300005331 Unclassified 1439
6 Ga0068869_100027174 3300005334 Bacteria 3988
7 Ga0070666_10022567 3300005335 Bacteria 4088
8 Ga0070680_100104961 3300005336 Bacteria 2349
9 Ga0070680_100134170 3300005336 Bacteria 2073
10 Ga0070682_100013375 3300005337 Bacteria 4719
11 Ga0070689_100127214 3300005340 Bacteria 2040
12 Ga0070691_10001273 3300005341 Bacteria 10649
13 Ga0070691_10048371 3300005341 Bacteria 2023
14 Ga0070661_100237702 3300005344 Bacteria 1402
15 Ga0070661_100303645 3300005344 Unclassified 1243
16 Ga0070692_10062875 3300005345 Bacteria 1960
17 Ga0070668_100124972 3300005347 Bacteria 2060
18 Ga0070669_100122567 3300005353 Unclassified 1985
19 Ga0070675_100014147 3300005354 Bacteria 6289
20 Ga0070675_100024645 3300005354 Bacteria 4818
21 Ga0070671_100003362 3300005355 Bacteria 12479
22 Ga0070671_100060938 3300005355 Bacteria 3142
23 Ga0070673_100018158 3300005364 Bacteria 5020
24 Ga0070688_100081541 3300005365 Bacteria 2095
25 Ga0070667_100011807 3300005367 Bacteria 7220
26 Ga0070703_10014786 3300005406 Bacteria 2226
27 Ga0070709_10184436 3300005434 Bacteria 1468
28 Ga0070709_10314016 3300005434 Bacteria 1148
29 Ga0070714_100089000 3300005435 Bacteria 2702
30 Ga0070714_100174487 3300005435 Bacteria 1952
31 Ga0070713_100007758 3300005436 Bacteria 7558
32 Ga0070713_100033553 3300005436 Bacteria 4113
33 Ga0070713_100230753 3300005436 Bacteria 1682
34 Ga0070713_100503366 3300005436 Bacteria 1143
35 Ga0070710_10080205 3300005437 Bacteria 1903
36 Ga0070701_10018073 3300005438 Bacteria 3308
37 Ga0070711_100004885 3300005439 Bacteria 7960
38 Ga0070705_100022100 3300005440 Bacteria 3394
39 Ga0070694_100047755 3300005444 Unclassified 2878
40 Ga0070694_100075236 3300005444 Bacteria 2335
41 Ga0070708_100389876 3300005445 Unclassified 1313
42 Ga0070678_100007685 3300005456 Bacteria 6410
43 Ga0070678_100014948 3300005456 Bacteria 4916
44 Ga0070662_100138015 3300005457 Bacteria 1887
45 Ga0070662_100279815 3300005457 Unclassified 1350
46 Ga0070681_10017045 3300005458 Bacteria 7260
47 Ga0068867_100187021 3300005459 Bacteria 1650
48 Ga0070699_100024889 3300005518 Bacteria 5160
49 Ga0070699_100030182 3300005518 Bacteria 4679
50 Ga0070699_100173951 3300005518 Bacteria 1908
51 Ga0070684_100002635 3300005535 Bacteria 13253
52 Ga0070672_100098796 3300005543 Bacteria 2364
53 Ga0070672_100176468 3300005543 Bacteria 1779
54 Ga0070672_100296100 3300005543 Bacteria 1371
55 Ga0070686_100285197 3300005544 Unclassified 1219
56 Ga0070695_100109166 3300005545 Bacteria 1875
57 Ga0070696_100031758 3300005546 Bacteria 3621
58 Ga0070693_100068116 3300005547 Bacteria 2088
59 Ga0070665_100043339 3300005548 Bacteria 4522
60 Ga0070704_100008829 3300005549 Bacteria 6066
61 Ga0070704_100223286 3300005549 Bacteria 1533
62 Ga0068855_100436612 3300005563 Bacteria 1430
63 Ga0070664_100042757 3300005564 Bacteria 3824
64 Ga0070664_100282960 3300005564 Unclassified 1496
65 Ga0070702_100367683 3300005615 Unclassified 1018
66 Ga0068859_100060557 3300005617 Bacteria 3814
67 Ga0068864_100021701 3300005618 Bacteria 5378
68 Ga0068863_100081133 3300005841 Bacteria 3073
69 Ga0068860_100121467 3300005843 Bacteria 2501
70 Ga0068862_100174688 3300005844 Bacteria 1925
71 Ga0068862_100262242 3300005844 Bacteria 1578
72 Ga0081455_10006169 3300005937 Bacteria 12925
73 Ga0081455_10014471 3300005937 Bacteria 7730
74 Ga0081455_10018124 3300005937 Bacteria 6721
75 Ga0081455_10019790 3300005937 Bacteria 6357
76 Ga0081455_10077760 3300005937 Bacteria 2728
77 Ga0070717_10024049 3300006028 Bacteria 4834
78 Ga0070715_10074499 3300006163 Bacteria 1525
79 Ga0070715_10104334 3300006163 Bacteria 1327
80 Ga0070716_100148778 3300006173 Bacteria 1503
81 Ga0070712_100263541 3300006175 Bacteria 1382
82 Ga0097621_100009715 3300006237 Bacteria 6999
83 Ga0097621_100049087 3300006237 Bacteria 3427
84 Ga0097621_100150224 3300006237 Bacteria 1997
85 Ga0075428_100009069 3300006844 Bacteria 11040
86 Ga0075428_100031712 3300006844 Bacteria 5838
87 Ga0075428_100067962 3300006844 Bacteria 3899
88 Ga0075428_100117587 3300006844 Bacteria 2896
89 Ga0075430_100392071 3300006846 Bacteria 1146
90 Ga0075431_100002496 3300006847 Bacteria 17737
91 Ga0075433_10019360 3300006852 Bacteria 5670
92 Ga0075434_100015025 3300006871 Bacteria 7414
93 Ga0075434_100235276 3300006871 Bacteria 1852
94 Ga0075434_100238408 3300006871 Bacteria 1839
95 Ga0075429_100004480 3300006880 Bacteria 12015
96 Ga0075429_100273101 3300006880 Bacteria 1480
97 Ga0068865_100097091 3300006881 Bacteria 2150
98 Ga0097620_100060557 3300006931 Bacteria 3814
99 Ga0105240_10122404 3300009093 Bacteria 3131
100 Ga0111539_10000353 3300009094 Bacteria 56556
101 Ga0111539_10238567 3300009094 Bacteria 2116
102 Ga0105245_10438974 3300009098 Bacteria 1312
103 Ga0114129_10003093 3300009147 Bacteria 23336
104 Ga0114129_10105557 3300009147 Bacteria 3893
105 Ga0114129_10228198 3300009147 Bacteria 2509
106 Ga0105243_10005129 3300009148 Bacteria 10272
107 Ga0105243_10077082 3300009148 Bacteria 2710
108 Ga0105241_10137697 3300009174 Unclassified 1984
109 Ga0105242_10044368 3300009176 Bacteria 3601
110 Ga0105242_10078768 3300009176 Bacteria 2751
111 Ga0105248_10103609 3300009177 Bacteria 3207
112 Ga0105238_10150442 3300009551 Bacteria 2303
113 Ga0105249_10183437 3300009553 Bacteria 2038
114 Ga0105249_10518269 3300009553 Unclassified 1239
115 Ga0105239_10420176 3300010375 Unclassified 1514
116 Ga0105246_10150083 3300011119 Bacteria 1763
117 Ga0105246_10201161 3300011119 Unclassified 1549
118 Ga0105246_10346626 3300011119 Unclassified 1216
119 Ga0157374_10099688 3300013296 Bacteria 2783
120 Ga0157374_10829808 3300013296 Unclassified 941
121 Ga0157378_10106371 3300013297 Bacteria 2566
122 Ga0157378_10169663 3300013297 Bacteria 2046
123 Ga0157378_10212007 3300013297 Bacteria 1837
124 Ga0157375_10057793 3300013308 Bacteria 3836
125 Ga0157375_10081353 3300013308 Bacteria 3279
126 Ga0157375_10108571 3300013308 Bacteria 2870
127 Ga0157375_10165648 3300013308 Bacteria 2355
128 Ga0157375_10280184 3300013308 Bacteria 1830
129 Ga0163163_10229512 3300014325 Bacteria 1905
130 Ga0163163_10299700 3300014325 Bacteria 1660
131 Ga0157379_10408043 3300014968 Unclassified 1250
132 Ga0157376_10104452 3300014969 Bacteria 2483
133 Ga0163161_10343547 3300017792 Bacteria 1184
134 Ga0207653_10011536 3300025885 Bacteria 2756
135 Ga0207682_10113209 3300025893 Bacteria 1196
136 Ga0207692_10001180 3300025898 Bacteria 9674
137 Ga0207680_10075774 3300025903 Bacteria 2099
138 Ga0207685_10000693 3300025905 Bacteria 6067
139 Ga0207699_10003957 3300025906 Bacteria 7086
140 Ga0207699_10053323 3300025906 Bacteria 2397
141 Ga0207699_10089992 3300025906 Bacteria 1925
142 Ga0207699_10206101 3300025906 Bacteria 1335
143 Ga0207684_10030755 3300025910 Bacteria 4570
144 Ga0207707_10000754 3300025912 Bacteria 31878
145 Ga0207707_10271996 3300025912 Bacteria 1468
146 Ga0207695_10111149 3300025913 Bacteria 2719
147 Ga0207693_10001050 3300025915 Bacteria 24700
148 Ga0207693_10040142 3300025915 Bacteria 3686
149 Ga0207693_10212083 3300025915 Bacteria 1522
150 Ga0207693_10332486 3300025915 Bacteria 1189
151 Ga0207663_10000235 3300025916 Bacteria 24574
152 Ga0207663_10039591 3300025916 Bacteria 2857
153 Ga0207660_10033726 3300025917 Bacteria 3544
154 Ga0207660_10070401 3300025917 Bacteria 2543
155 Ga0207649_10289712 3300025920 Unclassified 1193
156 Ga0207652_10105850 3300025921 Bacteria 2489
157 Ga0207681_10060611 3300025923 Unclassified 2598
158 Ga0207650_10005558 3300025925 Bacteria 8601
159 Ga0207650_10009076 3300025925 Bacteria 6798
160 Ga0207650_10051503 3300025925 Bacteria 3047
161 Ga0207650_10083825 3300025925 Unclassified 2422
162 Ga0207659_10013981 3300025926 Bacteria 5164
163 Ga0207700_10027301 3300025928 Bacteria 3995
164 Ga0207700_10293445 3300025928 Bacteria 1402
165 Ga0207644_10002626 3300025931 Bacteria 11570
166 Ga0207644_10053075 3300025931 Bacteria 2916
167 Ga0207706_10265793 3300025933 Unclassified 1497
168 Ga0207686_10037629 3300025934 Bacteria 2921
169 Ga0207686_10084958 3300025934 Bacteria 2075
170 Ga0207709_10008820 3300025935 Bacteria 5562
171 Ga0207670_10095144 3300025936 Bacteria 2115
172 Ga0207669_10065150 3300025937 Bacteria 2259
173 Ga0207691_10067054 3300025940 Bacteria 3246
174 Ga0207691_10176934 3300025940 Bacteria 1866
175 Ga0207691_10348693 3300025940 Unclassified 1267
176 Ga0207711_10090845 3300025941 Bacteria 2685
177 Ga0207711_10113573 3300025941 Bacteria 2411
178 Ga0207689_10039940 3300025942 Bacteria 3884
179 Ga0207651_10011237 3300025960 Bacteria 5003
180 Ga0207651_10063619 3300025960 Bacteria 2577
181 Ga0207712_10070302 3300025961 Bacteria 2514
182 Ga0207712_10388550 3300025961 Unclassified 1170
183 Ga0207668_10148045 3300025972 Unclassified 1814
184 Ga0207658_10210709 3300025986 Bacteria 1628
185 Ga0207641_10058541 3300026088 Bacteria 3279
186 Ga0207648_10163291 3300026089 Bacteria 1968
187 Ga0207676_10368616 3300026095 Bacteria 1333
188 Ga0207674_10090712 3300026116 Bacteria 3047
189 Ga0207674_10209025 3300026116 Bacteria 1901
190 Ga0207683_10000961 3300026121 Bacteria 26403
191 Ga0207683_10020420 3300026121 Bacteria 5666
192 Ga0207698_10236763 3300026142 Bacteria 1661
193 Ga0207428_10001110 3300027907 Bacteria 29297
194 Ga0207428_10127165 3300027907 Bacteria 1951
195 Ga0268266_10083004 3300028379 Bacteria 2796
196 Ga0268266_10375644 3300028379 Bacteria 1340
197 Ga0268265_10080507 3300028380 Bacteria 2569
198 Ga0268265_10160717 3300028380 Bacteria 1908
199 Ga0268264_10234372 3300028381 Bacteria 1697
200 Ga0307410_10108964 3300031852 Bacteria 2001
201 Ga0373923_0109776 3300035111 Bacteria 1224
202 Ga0373945_0006226 3300035116 Bacteria 3841
203 Ga0373945_0040031 3300035116 Bacteria 1691
204 Ga0373954_0051867 3300035118 Bacteria 1927
205 Ga0373955_0018070 3300035172 Bacteria 3500
206 Ga0373935_0084083 3300035692 Bacteria 2072
207 Ga0373935_0123620 3300035692 Bacteria 1731
208 Ga0373927_0035791 3300035695 Unclassified 3229
209 Ga0373927_0166917 3300035695 Bacteria 1442
210 Ga0373947_0007288 3300035725 Bacteria 6407
211 Ga0373947_0036680 3300035725 Bacteria 2907
212 Ga0373925_0196001 3300037068 Bacteria 1604
213 Ga0451577_0004021 3300042876 Bacteria 15813
214 Ga0453683_0041846 3300044673 Bacteria 2877
215 Ga0453684_0065856 3300044712 Bacteria 4617
216 Ga0451576_0028034 3300045051 Bacteria 6037
217 Ga0451576_0167830 3300045051 Bacteria 2290
218 Ga0466967_0072617 3300045976 Bacteria 3084
219 Ga0495603_0027414 3300046455 Bacteria 3438
220 Ga0495629_0009246 3300046459 Bacteria 7210
221 Ga0495629_0056090 3300046459 Bacteria 2755
222 Ga0495629_0170722 3300046459 Bacteria 1509
223 Ga0495641_0048355 3300046461 Bacteria 1951
224 Ga0495653_0086849 3300046463 Bacteria 2298
225 Ga0495580_0008393 3300046472 Bacteria 8216
226 Ga0495580_0040171 3300046472 Bacteria 3345
227 Ga0495580_0089534 3300046472 Bacteria 2142
228 Ga0495639_0009950 3300046475 Bacteria 4087
229 Ga0495664_0024935 3300046477 Bacteria 3478
230 Ga0495664_0151941 3300046477 Bacteria 1404
231 Ga0495608_0021326 3300046511 Bacteria 4447
232 Ga0495608_0269968 3300046511 Bacteria 1057
233 Ga0495618_0093233 3300046514 Unclassified 1925
234 Ga0495630_0239825 3300046517 Bacteria 1385
235 Ga0495666_0024626 3300046526 Bacteria 2973
236 Ga0495665_0076392 3300046531 Bacteria 1763
237 Ga0495640_0085184 3300046533 Bacteria 2094
238 Ga0495667_0005984 3300046559 Bacteria 8228
239 Ga0495634_0051984 3300046642 Bacteria 2748
240 Ga0495634_0195825 3300046642 Unclassified 1257
241 Ga0495588_0221313 3300046674 Unclassified 999
242 Ga0495624_0177075 3300046690 Bacteria 1300
243 Ga0495604_0204406 3300047317 Bacteria 1368
244 Ga0495674_0001032 3300047319 Bacteria 26737
245 Ga0495674_0009859 3300047319 Bacteria 9068
246 Ga0495674_0233206 3300047319 Bacteria 1518
247 Ga0495676_0014120 3300047321 Bacteria 7152
248 Ga0495680_0019328 3300047322 Bacteria 5753
249 Ga0495680_0068906 3300047322 Bacteria 2701
250 Ga0495684_0011006 3300047471 Bacteria 6995
251 Ga0495684_0113463 3300047471 Bacteria 2043
252 Ga0495593_0004755 3300047673 Bacteria 8067
253 Ga0495593_0055598 3300047673 Bacteria 2082
254 Ga0495614_0149728 3300048089 Bacteria 1040
255 Ga0496102_0107168 3300048905 Bacteria 2602
256 Ga0496103_0359663 3300048906 Bacteria 936
257 Ga0496104_0214242 3300048907 Bacteria 1838
258 Ga0496108_0066151 3300048911 Bacteria 3048
259 Ga0496108_0101084 3300048911 Bacteria 2460
260 Ga0496109_0105705 3300048912 Bacteria 2615
261 Ga0496109_0209751 3300048912 Bacteria 1832
262 Ga0496109_0444252 3300048912 Unclassified 1225
263 Ga0496110_0598789 3300048913 Bacteria 1000
264 Ga0496112_0132327 3300048915 Bacteria 2465
265 Ga0496112_0146203 3300048915 Bacteria 2332
266 Ga0496115_0196626 3300048918 Bacteria 1666
267 Ga0496115_0207845 3300048918 Unclassified 1617
268 Ga0496115_0278753 3300048918 Bacteria 1373
269 Ga0496119_0054026 3300048922 Bacteria 2449
270 Ga0496119_0133077 3300048922 Bacteria 1352
271 Ga0501075_0235494 3300049591 Unclassified 1396
272 nmdc:mga05p37_29341_c1 3300050507 Bacteria 6713
273 nmdc:mga09592_30309_c1 3300050508 Bacteria 4501
274 nmdc:mga06r32_186809_c1 3300050510 Bacteria 2059
275 nmdc:mga06r32_69171_c1 3300050510 Bacteria 3412
276 nmdc:mga08y16_348022_c1 3300050511 Unclassified 1523
277 nmdc:mga08y16_3859_c1 3300050511 Bacteria 15586
278 nmdc:mga0n895_168846_c1 3300050512 Bacteria 2220
279 nmdc:mga0n895_18258_c1 3300050512 Bacteria 6486
280 nmdc:mga0n895_90770_c1 3300050512 Unclassified 3057
281 nmdc:mga0n895_99113_c1 3300050512 Bacteria 2922
282 nmdc:mga0a205_2148_c1 3300050515 Bacteria 17315
283 nmdc:mga0a205_28352_c1 3300050515 Bacteria 5354
284 nmdc:mga0a205_5574_c2 3300050515 Bacteria 9003
285 Ga0495601_0000439 3300053077 Bacteria 21822
286 Ga0495612_0002262 3300053078 Bacteria 7921
287 Ga0495619_0000661 3300053085 Bacteria 22568
288 Ga0495619_0002995 3300053085 Bacteria 10969
289 Ga0500651_0002750 3300053093 Bacteria 9403
290 Ga0500651_0007286 3300053093 Bacteria 6452
291 Ga0500594_0011775 3300053118 Bacteria 2047
292 Ga0500568_0068176 3300053139 Bacteria 1366
293 Ga0500588_0033884 3300053146 Bacteria 1493
294 Ga0501084_0432006 3300054114 Unclassified 1113
295 2513894980 2513237141 Bacteria 8496279
296 2524437211 2524023205 Bacteria 8918781
297 2745076430 2744054633 Bacteria 8678936
298 2824625385 2824617872 Bacteria 8814715
299 2824634198 2824626560 Bacteria 8813858
300 2824642807 2824635225 Bacteria 8785348
301 2824651091 2824644064 Bacteria 8743947
302 2824721121 2824714736 Bacteria 8717648
303 2824731026 2824723954 Bacteria 8758240
304 Ga0075433_10186998
305 Ga0070683_100113511
306 Ga0070670_100008733
307 Ga0070670_100022430
308 Ga0070670_100286383
309 Ga0068869_100027174
310 Ga0070666_10022567
311 Ga0070680_100104961
312 Ga0070680_100134170
313 Ga0070682_100013375
314 Ga0070689_100127214
315 Ga0070691_10001273
316 Ga0070691_10048371
317 Ga0070661_100237702
318 Ga0070661_100303645
319 Ga0070692_10062875
320 Ga0070668_100124972
321 Ga0070669_100122567
322 Ga0070675_100014147
323 Ga0070675_100024645
324 Ga0070671_100003362
325 Ga0070671_100060938
326 Ga0070673_100018158
327 Ga0070688_100081541
328 Ga0070667_100011807
329 Ga0070703_10014786
330 Ga0070709_10184436
331 Ga0070709_10314016
332 Ga0070714_100089000
333 Ga0070714_100174487
334 Ga0070713_100007758
335 Ga0070713_100033553
336 Ga0070713_100230753
337 Ga0070713_100503366
338 Ga0070710_10080205
339 Ga0070701_10018073
340 Ga0070711_100004885
341 Ga0070705_100022100
342 Ga0070694_100047755
343 Ga0070694_100075236
344 Ga0070708_100389876
345 Ga0070678_100007685
346 Ga0070678_100014948
347 Ga0070662_100138015
348 Ga0070662_100279815
349 Ga0070681_10017045
350 Ga0068867_100187021
351 Ga0070699_100024889
352 Ga0070699_100030182
353 Ga0070699_100173951
354 Ga0070684_100002635
355 Ga0070672_100098796
356 Ga0070672_100176468
357 Ga0070672_100296100
358 Ga0070686_100285197
359 Ga0070695_100109166
360 Ga0070696_100031758
361 Ga0070693_100068116
362 Ga0070665_100043339
363 Ga0070704_100008829
364 Ga0070704_100223286
365 Ga0068855_100436612
366 Ga0070664_100042757
367 Ga0070664_100282960
368 Ga0070702_100367683
369 Ga0068859_100060557
370 Ga0068864_100021701
371 Ga0068863_100081133
372 Ga0068860_100121467
373 Ga0068862_100174688
374 Ga0068862_100262242
375 Ga0081455_10006169
376 Ga0081455_10014471
377 Ga0081455_10018124
378 Ga0081455_10019790
379 Ga0081455_10077760
380 Ga0070717_10024049
381 Ga0070715_10074499
382 Ga0070715_10104334
383 Ga0070716_100148778
384 Ga0070712_100263541
385 Ga0097621_100009715
386 Ga0097621_100049087
387 Ga0097621_100150224
388 Ga0075428_100009069
389 Ga0075428_100031712
390 Ga0075428_100067962
391 Ga0075428_100117587
392 Ga0075430_100392071
393 Ga0075431_100002496
394 Ga0075433_10019360
395 Ga0075434_100015025
396 Ga0075434_100235276
397 Ga0075434_100238408
398 Ga0075429_100004480
399 Ga0075429_100273101
400 Ga0068865_100097091
401 Ga0097620_100060557
402 Ga0105240_10122404
403 Ga0111539_10000353
404 Ga0111539_10238567
405 Ga0105245_10438974
406 Ga0114129_10003093
407 Ga0114129_10105557
408 Ga0114129_10228198
409 Ga0105243_10005129
410 Ga0105243_10077082
411 Ga0105241_10137697
412 Ga0105242_10044368
413 Ga0105242_10078768
414 Ga0105248_10103609
415 Ga0105238_10150442
416 Ga0105249_10183437
417 Ga0105249_10518269
418 Ga0105239_10420176
419 Ga0105246_10150083
420 Ga0105246_10201161
421 Ga0105246_10346626
422 Ga0157374_10099688
423 Ga0157374_10829808
424 Ga0157378_10106371
425 Ga0157378_10169663
426 Ga0157378_10212007
427 Ga0157375_10057793
428 Ga0157375_10081353
429 Ga0157375_10108571
430 Ga0157375_10165648
431 Ga0157375_10280184
432 Ga0163163_10229512
433 Ga0163163_10299700
434 Ga0157379_10408043
435 Ga0157376_10104452
436 Ga0163161_10343547
437 Ga0207653_10011536
438 Ga0207682_10113209
439 Ga0207692_10001180
440 Ga0207680_10075774
441 Ga0207685_10000693
442 Ga0207699_10003957
443 Ga0207699_10053323
444 Ga0207699_10089992
445 Ga0207699_10206101
446 Ga0207684_10030755
447 Ga0207707_10000754
448 Ga0207707_10271996
449 Ga0207695_10111149
450 Ga0207693_10001050
451 Ga0207693_10040142
452 Ga0207693_10212083
453 Ga0207693_10332486
454 Ga0207663_10000235
455 Ga0207663_10039591
456 Ga0207660_10033726
457 Ga0207660_10070401
458 Ga0207649_10289712
459 Ga0207652_10105850
460 Ga0207681_10060611
461 Ga0207650_10005558
462 Ga0207650_10009076
463 Ga0207650_10051503
464 Ga0207650_10083825
465 Ga0207659_10013981
466 Ga0207700_10027301
467 Ga0207700_10293445
468 Ga0207644_10002626
469 Ga0207644_10053075
470 Ga0207706_10265793
471 Ga0207686_10037629
472 Ga0207686_10084958
473 Ga0207709_10008820
474 Ga0207670_10095144
475 Ga0207669_10065150
476 Ga0207691_10067054
477 Ga0207691_10176934
478 Ga0207691_10348693
479 Ga0207711_10090845
480 Ga0207711_10113573
481 Ga0207689_10039940
482 Ga0207651_10011237
483 Ga0207651_10063619
484 Ga0207712_10070302
485 Ga0207712_10388550
486 Ga0207668_10148045
487 Ga0207658_10210709
488 Ga0207641_10058541
489 Ga0207648_10163291
490 Ga0207676_10368616
491 Ga0207674_10090712
492 Ga0207674_10209025
493 Ga0207683_10000961
494 Ga0207683_10020420
495 Ga0207698_10236763
496 Ga0207428_10001110
497 Ga0207428_10127165
498 Ga0268266_10083004
499 Ga0268266_10375644
500 Ga0268265_10080507
501 Ga0268265_10160717
502 Ga0268264_10234372
503 Ga0307410_10108964
504 Ga0373923_0109776
505 Ga0373945_0006226
506 Ga0373945_0040031
507 Ga0373954_0051867
508 Ga0373955_0018070
509 Ga0373935_0084083
510 Ga0373935_0123620
511 Ga0373927_0035791
512 Ga0373927_0166917
513 Ga0373947_0007288
514 Ga0373947_0036680
515 Ga0373925_0196001
516 Ga0451577_0004021
517 Ga0453683_0041846
518 Ga0453684_0065856
519 Ga0451576_0028034
520 Ga0451576_0167830
521 Ga0466967_0072617
522 Ga0495603_0027414
523 Ga0495629_0009246
524 Ga0495629_0056090
525 Ga0495629_0170722
526 Ga0495641_0048355
527 Ga0495653_0086849
528 Ga0495580_0008393
529 Ga0495580_0040171
530 Ga0495580_0089534
531 Ga0495639_0009950
532 Ga0495664_0024935
533 Ga0495664_0151941
534 Ga0495608_0021326
535 Ga0495608_0269968
536 Ga0495618_0093233
537 Ga0495630_0239825
538 Ga0495666_0024626
539 Ga0495665_0076392
540 Ga0495640_0085184
541 Ga0495667_0005984
542 Ga0495634_0051984
543 Ga0495634_0195825
544 Ga0495588_0221313
545 Ga0495624_0177075
546 Ga0495604_0204406
547 Ga0495674_0001032
548 Ga0495674_0009859
549 Ga0495674_0233206
550 Ga0495676_0014120
551 Ga0495680_0019328
552 Ga0495680_0068906
553 Ga0495684_0011006
554 Ga0495684_0113463
555 Ga0495593_0004755
556 Ga0495593_0055598
557 Ga0495614_0149728
558 Ga0496102_0107168
559 Ga0496103_0359663
560 Ga0496104_0214242
561 Ga0496108_0066151
562 Ga0496108_0101084
563 Ga0496109_0105705
564 Ga0496109_0209751
565 Ga0496109_0444252
566 Ga0496110_0598789
567 Ga0496112_0132327
568 Ga0496112_0146203
569 Ga0496115_0196626
570 Ga0496115_0207845
571 Ga0496115_0278753
572 Ga0496119_0054026
573 Ga0496119_0133077
574 Ga0501075_0235494
575 nmdc:mga05p37_29341_c1
576 nmdc:mga09592_30309_c1
577 nmdc:mga06r32_186809_c1
578 nmdc:mga06r32_69171_c1
579 nmdc:mga08y16_348022_c1
580 nmdc:mga08y16_3859_c1
581 nmdc:mga0n895_168846_c1
582 nmdc:mga0n895_18258_c1
583 nmdc:mga0n895_90770_c1
584 nmdc:mga0n895_99113_c1
585 nmdc:mga0a205_2148_c1
586 nmdc:mga0a205_28352_c1
587 nmdc:mga0a205_5574_c2
588 Ga0495601_0000439
589 Ga0495612_0002262
590 Ga0495619_0000661
591 Ga0495619_0002995
592 Ga0500651_0002750
593 Ga0500651_0007286
594 Ga0500594_0011775
595 Ga0500568_0068176
596 Ga0500588_0033884
597 Ga0501084_0432006
598 2513894980
599 2524437211
600 2745076430
601 2824625385
602 2824634198
603 2824642807
604 2824651091
605 2824721121
606 2824731026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

96

382

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9122 28 321
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.9035 28 321
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.894 28 322
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8924 32 322
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8912 28 322
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9068 146 322 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9025 146 321 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.889 146 322 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.879 146 321 3.40.50.2300
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.8288 160 223 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A7S9DDA0-F1-model_v4 ABC transporter substrate-binding protein 0.974 151 323
AF-A0A1G0K1G6-F1-model_v4 ABC transporter substrate-binding protein 0.9693 196 323
AF-A0A536Z1U0-F1-model_v4 ABC transporter substrate-binding protein 0.9689 147 323
AF-A0A536Z3T8-F1-model_v4 ABC transporter substrate-binding protein 0.9688 228 323
AF-A0A4V1KUC4-F1-model_v4 ABC transporter substrate-binding protein 0.9674 215 323

Map