F397503

General Info

Members Datasets Scaffolds Average Seq Length
304 206 304 227

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10006941|Ga0075365_100069418
Length 243
Sequence MATERLALIGGHSILGADPGEGFVPRRVETEAGAVDVYEDERRGTVLLQRHGFGRYTTAAKIDHARNLRALAELGCDRILAIASVGGLRPDLGVGTFLCPDDFIALHLGLSLHDDHGGERVPGFDQAWRARVMETWGRVAEPRLVDGGVYWQAIGPRFETPAEIRLIAAHADVIGMTVASECIVAGELGIPYAAVCVVDNLANGIAEAPLSVEEFESGKDANRLRLIAAIDAVAEELVAGAAA

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
122 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
128 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
129 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
130 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
131 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
132 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
185 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
186 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.57
Nodule 0
Rhizoplane 9.21
Rhizosphere 81.91
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006656 3300001979 Bacteria 4763
2 rootH2_10166254 3300003320 Bacteria 1215
3 Ga0070658_10087323 3300005327 Bacteria 2567
4 Ga0070683_100088251 3300005329 Bacteria 2909
5 Ga0070677_10000001 3300005333 Bacteria 118426
6 Ga0070666_10333127 3300005335 Bacteria 1084
7 Ga0070682_100000028 3300005337 Bacteria 185177
8 Ga0070682_100042354 3300005337 Bacteria 2810
9 Ga0068868_100026857 3300005338 Bacteria 4390
10 Ga0068868_100040254 3300005338 Bacteria 3637
11 Ga0070660_100018927 3300005339 Bacteria 5041
12 Ga0070689_100337149 3300005340 Bacteria 1262
13 Ga0070692_10045860 3300005345 Bacteria 2256
14 Ga0070668_100010364 3300005347 Bacteria 6923
15 Ga0070669_100070569 3300005353 Bacteria 2583
16 Ga0070675_100143929 3300005354 Bacteria 2039
17 Ga0070674_100000025 3300005356 Bacteria 78679
18 Ga0070674_100075353 3300005356 Bacteria 2396
19 Ga0070674_100185849 3300005356 Bacteria 1595
20 Ga0070673_100002128 3300005364 Bacteria 11991
21 Ga0070673_100115224 3300005364 Bacteria 2235
22 Ga0070688_100081195 3300005365 Bacteria 2099
23 Ga0070688_100499481 3300005365 Bacteria 917
24 Ga0070659_100067059 3300005366 Bacteria 2845
25 Ga0070667_100054954 3300005367 Bacteria 3362
26 Ga0070667_100313578 3300005367 Bacteria 1414
27 Ga0070710_10257403 3300005437 Bacteria 1124
28 Ga0070701_10139632 3300005438 Bacteria 1384
29 Ga0070711_100196377 3300005439 Bacteria 1554
30 Ga0070705_100439081 3300005440 Bacteria 976
31 Ga0070694_100399778 3300005444 Bacteria 1075
32 Ga0070708_100126852 3300005445 Bacteria 2359
33 Ga0070663_100006755 3300005455 Bacteria 6931
34 Ga0070681_10110113 3300005458 Bacteria 2694
35 Ga0070681_10239779 3300005458 Bacteria 1727
36 Ga0068867_100000890 3300005459 Bacteria 20219
37 Ga0068867_100052816 3300005459 Bacteria 3000
38 Ga0068867_100335406 3300005459 Bacteria 1257
39 Ga0070685_10012296 3300005466 Bacteria 4495
40 Ga0070706_100015108 3300005467 Bacteria 7131
41 Ga0070706_100260244 3300005467 Unclassified 1620
42 Ga0070707_100200152 3300005468 Bacteria 1947
43 Ga0070707_100317208 3300005468 Bacteria 1515
44 Ga0070707_100442087 3300005468 Bacteria 1261
45 Ga0070698_100052337 3300005471 Bacteria 4154
46 Ga0070698_100077966 3300005471 Unclassified 3312
47 Ga0070699_100240257 3300005518 Bacteria 1616
48 Ga0070679_100003822 3300005530 Bacteria 13829
49 Ga0070684_100002537 3300005535 Bacteria 13485
50 Ga0070684_100053740 3300005535 Bacteria 3508
51 Ga0068853_100214702 3300005539 Bacteria 1755
52 Ga0070686_100024000 3300005544 Bacteria 3652
53 Ga0070686_100143636 3300005544 Bacteria 1664
54 Ga0070665_100000202 3300005548 Bacteria 104773
55 Ga0070665_100046449 3300005548 Bacteria 4363
56 Ga0070665_100324937 3300005548 Bacteria 1542
57 Ga0070704_100808389 3300005549 Unclassified 838
58 Ga0070664_100013209 3300005564 Bacteria 6724
59 Ga0068857_100152713 3300005577 Bacteria 2093
60 Ga0068857_100300695 3300005577 Bacteria 1479
61 Ga0068854_100056517 3300005578 Bacteria 2828
62 Ga0068856_100064628 3300005614 Bacteria 3616
63 Ga0068856_100378232 3300005614 Bacteria 1435
64 Ga0068852_100030322 3300005616 Bacteria 4451
65 Ga0068859_100289450 3300005617 Bacteria 1731
66 Ga0068864_100000023 3300005618 Bacteria 257064
67 Ga0068866_10000001 3300005718 Bacteria 519680
68 Ga0068866_10065992 3300005718 Bacteria 1895
69 Ga0068863_100000004 3300005841 Bacteria 272478
70 Ga0068858_100000012 3300005842 Bacteria 216931
71 Ga0068858_100374559 3300005842 Bacteria 1366
72 Ga0068860_100014975 3300005843 Bacteria 7579
73 Ga0068860_100039787 3300005843 Bacteria 4497
74 Ga0068860_100113465 3300005843 Bacteria 2591
75 Ga0068862_100003740 3300005844 Bacteria 12983
76 Ga0081455_10036449 3300005937 Bacteria 4378
77 Ga0081455_10067172 3300005937 Bacteria 2989
78 Ga0075365_10002624 3300006038 Bacteria 8906
79 Ga0075365_10006941 3300006038 Bacteria 6290
80 Ga0075363_100000723 3300006048 Bacteria 11223
81 Ga0075363_100017515 3300006048 Bacteria 3554
82 Ga0075363_100021799 3300006048 Bacteria 3233
83 Ga0075363_100249415 3300006048 Bacteria 1022
84 Ga0075364_10031633 3300006051 Bacteria 3399
85 Ga0075364_10124836 3300006051 Bacteria 1725
86 Ga0075364_10263908 3300006051 Unclassified 1171
87 Ga0075364_10382892 3300006051 Bacteria 959
88 Ga0070715_10000001 3300006163 Bacteria 693690
89 Ga0070712_100003807 3300006175 Bacteria 9297
90 Ga0075367_10052089 3300006178 Bacteria 2422
91 Ga0075367_10152663 3300006178 Unclassified 1434
92 Ga0075428_100033472 3300006844 Bacteria 5675
93 Ga0075428_100042699 3300006844 Bacteria 4985
94 Ga0075430_100007289 3300006846 Bacteria 9337
95 Ga0075430_100058430 3300006846 Unclassified 3242
96 Ga0075430_100286620 3300006846 Bacteria 1362
97 Ga0075431_100049678 3300006847 Bacteria 4324
98 Ga0075431_100202962 3300006847 Bacteria 2028
99 Ga0075433_10011661 3300006852 Bacteria 7080
100 Ga0075434_100025970 3300006871 Bacteria 5735
101 Ga0075429_100022860 3300006880 Bacteria 5421
102 Ga0075429_100255718 3300006880 Bacteria 1533
103 Ga0068865_100141994 3300006881 Bacteria 1812
104 Ga0097620_100289450 3300006931 Bacteria 1731
105 Ga0075435_100002547 3300007076 Bacteria 12136
106 Ga0105245_10003682 3300009098 Bacteria 13684
107 Ga0105245_10012932 3300009098 Bacteria 7275
108 Ga0105245_10101602 3300009098 Bacteria 2662
109 Ga0105247_10109973 3300009101 Bacteria 1772
110 Ga0114129_10097292 3300009147 Bacteria 4075
111 Ga0114129_10149380 3300009147 Bacteria 3198
112 Ga0105243_10016010 3300009148 Bacteria 5672
113 Ga0105242_10618620 3300009176 Bacteria 1049
114 Ga0105237_10399661 3300009545 Bacteria 1379
115 Ga0105249_10026492 3300009553 Bacteria 5225
116 Ga0157371_10282698 3300013102 Bacteria 1199
117 Ga0157372_10082172 3300013307 Bacteria 3647
118 Ga0157375_10331229 3300013308 Bacteria 1687
119 Ga0163163_10387359 3300014325 Bacteria 1455
120 Ga0157380_10000138 3300014326 Bacteria 40711
121 Ga0157380_10021108 3300014326 Bacteria 4881
122 Ga0157379_10038288 3300014968 Bacteria 4279
123 Ga0157379_10049376 3300014968 Bacteria 3757
124 Ga0157379_10182059 3300014968 Bacteria 1898
125 Ga0157379_10250764 3300014968 Bacteria 1607
126 Ga0207642_10000006 3300025899 Bacteria 230268
127 Ga0207642_10000007 3300025899 Bacteria 226017
128 Ga0207688_10005550 3300025901 Bacteria 6859
129 Ga0207688_10041166 3300025901 Bacteria 2569
130 Ga0207685_10000011 3300025905 Bacteria 213430
131 Ga0207645_10286674 3300025907 Bacteria 1094
132 Ga0207707_10089185 3300025912 Bacteria 2695
133 Ga0207693_10004341 3300025915 Bacteria 11995
134 Ga0207660_10178259 3300025917 Bacteria 1649
135 Ga0207662_10119485 3300025918 Bacteria 1652
136 Ga0207657_10003401 3300025919 Bacteria 17003
137 Ga0207649_10087576 3300025920 Bacteria 2032
138 Ga0207652_10000549 3300025921 Bacteria 38051
139 Ga0207646_10319901 3300025922 Bacteria 1402
140 Ga0207646_10410359 3300025922 Bacteria 1223
141 Ga0207681_10203969 3300025923 Bacteria 1520
142 Ga0207659_10098726 3300025926 Bacteria 2196
143 Ga0207687_10000055 3300025927 Bacteria 88382
144 Ga0207687_10068583 3300025927 Bacteria 2527
145 Ga0207690_10019712 3300025932 Bacteria 4158
146 Ga0207706_10067516 3300025933 Bacteria 3146
147 Ga0207669_10000009 3300025937 Bacteria 168012
148 Ga0207704_10149606 3300025938 Bacteria 1645
149 Ga0207704_10161961 3300025938 Bacteria 1593
150 Ga0207691_10050678 3300025940 Bacteria 3800
151 Ga0207661_10100260 3300025944 Bacteria 2430
152 Ga0207679_10071739 3300025945 Bacteria 2613
153 Ga0207651_10001164 3300025960 Bacteria 11772
154 Ga0207651_10100173 3300025960 Bacteria 2148
155 Ga0207712_10026797 3300025961 Bacteria 3845
156 Ga0207668_10131487 3300025972 Bacteria 1912
157 Ga0207640_10217197 3300025981 Bacteria 1461
158 Ga0207658_10051677 3300025986 Bacteria 3029
159 Ga0207677_10024895 3300026023 Bacteria 3725
160 Ga0207703_10000740 3300026035 Bacteria 32186
161 Ga0207639_10177487 3300026041 Bacteria 1809
162 Ga0207639_10404463 3300026041 Bacteria 1230
163 Ga0207678_10001712 3300026067 Bacteria 20098
164 Ga0207702_10048161 3300026078 Bacteria 3594
165 Ga0207702_10450236 3300026078 Bacteria 1249
166 Ga0207641_10000170 3300026088 Bacteria 91128
167 Ga0207648_10004004 3300026089 Bacteria 15293
168 Ga0207648_10057082 3300026089 Bacteria 3406
169 Ga0207676_10000025 3300026095 Bacteria 261714
170 Ga0207674_10207781 3300026116 Bacteria 1907
171 Ga0207698_10048915 3300026142 Bacteria 3214
172 Ga0268266_10000020 3300028379 Bacteria 527065
173 Ga0268266_10031260 3300028379 Bacteria 4520
174 Ga0268265_10012238 3300028380 Bacteria 5811
175 Ga0268264_10002246 3300028381 Bacteria 17121
176 Ga0268264_10085516 3300028381 Bacteria 2707
177 Ga0265337_1000002 3300028556 Bacteria 139247
178 Ga0265326_10000007 3300028558 Bacteria 223057
179 Ga0265322_10000001 3300028654 Bacteria 543854
180 Ga0265324_10000263 3300029957 Bacteria 39080
181 Ga0265320_10000002 3300031240 Bacteria 542875
182 Ga0265329_10002999 3300031242 Bacteria 7498
183 Ga0265339_10111279 3300031249 Bacteria 1416
184 Ga0265331_10006616 3300031250 Bacteria 6823
185 Ga0265327_10000011 3300031251 Bacteria 543807
186 Ga0316579_10054915 3300031691 Bacteria 1868
187 Ga0265314_10000058 3300031711 Bacteria 167476
188 Ga0265342_10061030 3300031712 Bacteria 2222
189 Ga0307406_10345886 3300031901 Bacteria 1160
190 Ga0373933_0310144 3300035724 Unclassified 1022
191 Ga0373947_0045908 3300035725 Bacteria 2615
192 Ga0373937_0005061 3300036401 Bacteria 11221
193 Ga0316582_0159839 3300036647 Bacteria 1526
194 Ga0451853_0400745 3300041512 Bacteria 1853
195 Ga0451853_1691717 3300041512 Bacteria 971
196 Ga0495603_0000023 3300046455 Bacteria 63559
197 Ga0495603_0010100 3300046455 Bacteria 5713
198 Ga0495603_0195307 3300046455 Bacteria 1170
199 Ga0495641_0000003 3300046461 Bacteria 242879
200 Ga0495641_0092589 3300046461 Bacteria 1350
201 Ga0495582_0000027 3300046473 Bacteria 79970
202 Ga0495608_0123565 3300046511 Bacteria 1659
203 Ga0495628_0068302 3300046516 Bacteria 2774
204 Ga0495628_0108198 3300046516 Bacteria 2140
205 Ga0495628_0290337 3300046516 Bacteria 1212
206 Ga0495630_0529430 3300046517 Unclassified 904
207 Ga0495644_0006018 3300046523 Bacteria 4726
208 Ga0495652_0593786 3300046529 Unclassified 756
209 Ga0495586_0001818 3300046535 Bacteria 11638
210 Ga0495598_0005069 3300046537 Bacteria 2895
211 Ga0495645_0054811 3300046543 Bacteria 2896
212 Ga0495588_0293773 3300046674 Unclassified 856
213 Ga0495599_0001330 3300046678 Bacteria 14092
214 Ga0495658_0000025 3300046683 Bacteria 79910
215 Ga0495658_0275620 3300046683 Bacteria 1061
216 Ga0495658_0475753 3300046683 Unclassified 799
217 Ga0495649_0001198 3300046694 Bacteria 20005
218 Ga0495604_0000038 3300047317 Bacteria 123703
219 Ga0495604_0228279 3300047317 Bacteria 1278
220 Ga0495672_0282219 3300047320 Unclassified 793
221 Ga0495676_0001619 3300047321 Bacteria 19593
222 Ga0495676_0042991 3300047321 Bacteria 3702
223 Ga0495676_0282883 3300047321 Unclassified 1123
224 Ga0495680_0000196 3300047322 Bacteria 65437
225 Ga0495679_009301 3300047446 Bacteria 3943
226 Ga0495602_0176738 3300048088 Bacteria 1651
227 Ga0496100_0024376 3300048903 Bacteria 3690
228 Ga0496101_0026072 3300048904 Bacteria 4061
229 Ga0496102_0004133 3300048905 Bacteria 12307
230 Ga0496102_0477614 3300048905 Unclassified 1168
231 Ga0496103_0001105 3300048906 Bacteria 18770
232 Ga0496104_0000002 3300048907 Bacteria 686017
233 Ga0496104_0007267 3300048907 Bacteria 9775
234 Ga0496105_0000001 3300048908 Bacteria 1328178
235 Ga0496105_0011958 3300048908 Bacteria 6872
236 Ga0496106_0000864 3300048909 Bacteria 22031
237 Ga0496106_0027746 3300048909 Bacteria 4217
238 Ga0496106_0206862 3300048909 Bacteria 1563
239 Ga0496107_0072361 3300048910 Bacteria 2506
240 Ga0496108_0137743 3300048911 Bacteria 2101
241 Ga0496109_0017032 3300048912 Bacteria 6360
242 Ga0496109_0040501 3300048912 Bacteria 4220
243 Ga0496110_0011873 3300048913 Bacteria 7155
244 Ga0496110_0021572 3300048913 Bacteria 5456
245 Ga0496110_0476261 3300048913 Bacteria 1137
246 Ga0496111_0059564 3300048914 Bacteria 2767
247 Ga0496112_0120504 3300048915 Bacteria 2593
248 Ga0496112_0472340 3300048915 Bacteria 1191
249 Ga0496113_0012804 3300048916 Bacteria 5652
250 Ga0496113_0774144 3300048916 Bacteria 763
251 Ga0496114_0005743 3300048917 Bacteria 9736
252 Ga0496114_0504474 3300048917 Unclassified 1070
253 Ga0496115_0010425 3300048918 Bacteria 6943
254 Ga0496115_0019660 3300048918 Bacteria 5199
255 Ga0496119_0081795 3300048922 Bacteria 1859
256 Ga0501031_0591774 3300049568 Unclassified 714
257 Ga0501034_0428014 3300049571 Bacteria 1244
258 Ga0501040_0626073 3300049576 Bacteria 778
259 Ga0501042_0454854 3300049578 Bacteria 928
260 Ga0501067_0235097 3300049583 Bacteria 1020
261 Ga0501069_0042364 3300049585 Bacteria 2518
262 Ga0501070_0023865 3300049586 Bacteria 5126
263 Ga0501070_0129765 3300049586 Bacteria 2082
264 Ga0501070_0304297 3300049586 Bacteria 1298
265 Ga0501071_0225251 3300049587 Bacteria 1412
266 Ga0501071_0658936 3300049587 Bacteria 805
267 Ga0501072_0028473 3300049588 Bacteria 4362
268 Ga0501072_0229052 3300049588 Bacteria 1480
269 Ga0501073_0114559 3300049589 Bacteria 1869
270 Ga0501074_0047968 3300049590 Bacteria 3086
271 Ga0501075_0000407 3300049591 Bacteria 25084
272 Ga0501075_0266630 3300049591 Unclassified 1305
273 Ga0501076_0863622 3300049592 Bacteria 746
274 Ga0501080_0127403 3300049742 Bacteria 2357
275 Ga0501045_0260672 3300049824 Bacteria 1290
276 nmdc:mga03n38_7422_c1 3300050490 Bacteria 3880
277 nmdc:mga00v17_132493_c1 3300050491 Unclassified 1593
278 nmdc:mga00v17_211909_c1 3300050491 Unclassified 1254
279 nmdc:mga00v17_23983_c1 3300050491 Bacteria 3534
280 nmdc:mga00v17_50636_c1 3300050491 Bacteria 2524
281 nmdc:mga00v17_5612_c1 3300050491 Bacteria 6617
282 nmdc:mga0yw44_5284_c1 3300050492 Bacteria 6066
283 nmdc:mga0yw44_68440_c1 3300050492 Bacteria 2196
284 nmdc:mga0yw44_96376_c1 3300050492 Unclassified 1878
285 nmdc:mga06z11_34329_c1 3300050494 Bacteria 2489
286 nmdc:mga05p37_130469_c1 3300050507 Bacteria 3084
287 nmdc:mga05p37_720560_c1 3300050507 Bacteria 1105
288 nmdc:mga09592_14275_c1 3300050508 Bacteria 6484
289 nmdc:mga09592_250381_c1 3300050508 Viruses 1535
290 nmdc:mga0qj67_185735_c1 3300050509 Unclassified 1689
291 nmdc:mga0qj67_399875_c1 3300050509 Bacteria 1109
292 nmdc:mga0qj67_50635_c1 3300050509 Bacteria 3285
293 nmdc:mga0qj67_81010_c1 3300050509 Bacteria 2602
294 nmdc:mga06r32_37032_c1 3300050510 Bacteria 4615
295 nmdc:mga06r32_9622_c1 3300050510 Bacteria 8732
296 nmdc:mga0n895_89583_c1 3300050512 Bacteria 3078
297 nmdc:mga0rr50_11376_c1 3300050513 Bacteria 5695
298 Ga0495601_0000072 3300053077 Bacteria 56009
299 Ga0495601_0008176 3300053077 Bacteria 6169
300 Ga0495612_0000614 3300053078 Bacteria 14345
301 Ga0495619_0001132 3300053085 Bacteria 17518
302 Ga0495619_0005740 3300053085 Bacteria 7864
303 Ga0500614_000270 3300053123 Bacteria 13468
304 Ga0501084_0299522 3300054114 Bacteria 1358

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028556 Ga0265337_1000002 Ga0265337_1000002140 183
2 3300028558 Ga0265326_10000007 Ga0265326_10000007198 183
3 3300028654 Ga0265322_10000001 Ga0265322_10000001105 183
4 3300029957 Ga0265324_10000263 Ga0265324_1000026332 183
5 3300031240 Ga0265320_10000002 Ga0265320_10000002105 183
6 3300031242 Ga0265329_10002999 Ga0265329_100029993 183
7 3300031249 Ga0265339_10111279 Ga0265339_101112792 183
8 3300031250 Ga0265331_10006616 Ga0265331_100066163 183
9 3300031251 Ga0265327_10000011 Ga0265327_10000011105 183
10 3300031711 Ga0265314_10000058 Ga0265314_1000005812 183
11 3300031712 Ga0265342_10061030 Ga0265342_100610302 183
12 3300046455 Ga0495603_0000023 Ga0495603_0000023_1460_2134 202
13 3300025907 Ga0207645_10286674 Ga0207645_102866741 207
14 3300006048 Ga0075363_100021799 Ga0075363_1000217991 212
15 3300006163 Ga0070715_10000001 Ga0070715_1000000176 212
16 3300025905 Ga0207685_10000011 Ga0207685_1000001176 212
17 3300048913 Ga0496110_0011873 Ga0496110_0011873_6063_6743 212
18 3300050490 nmdc:mga03n38_7422_c1 nmdc:mga03n38_7422_c1_2559_3278 212
19 3300005335 Ga0070666_10333127 Ga0070666_103331272 213
20 3300005337 Ga0070682_100042354 Ga0070682_1000423543 213
21 3300005338 Ga0068868_100026857 Ga0068868_1000268575 213
22 3300005356 Ga0070674_100075353 Ga0070674_1000753532 213
23 3300005437 Ga0070710_10257403 Ga0070710_102574032 213
24 3300005438 Ga0070701_10139632 Ga0070701_101396322 213
25 3300005439 Ga0070711_100196377 Ga0070711_1001963772 213
26 3300005440 Ga0070705_100439081 Ga0070705_1004390812 213
27 3300005444 Ga0070694_100399778 Ga0070694_1003997782 213
28 3300005459 Ga0068867_100335406 Ga0068867_1003354062 213
29 3300005468 Ga0070707_100200152 Ga0070707_1002001522 213
30 3300005544 Ga0070686_100143636 Ga0070686_1001436362 213
31 3300005718 Ga0068866_10065992 Ga0068866_100659922 213
32 3300005842 Ga0068858_100374559 Ga0068858_1003745592 213
33 3300006038 Ga0075365_10002624 Ga0075365_100026244 213
34 3300006051 Ga0075364_10124836 Ga0075364_101248361 213
35 3300006175 Ga0070712_100003807 Ga0070712_1000038074 213
36 3300006178 Ga0075367_10052089 Ga0075367_100520892 213
37 3300006881 Ga0068865_100141994 Ga0068865_1001419942 213
38 3300009098 Ga0105245_10003682 Ga0105245_100036822 213
39 3300009101 Ga0105247_10109973 Ga0105247_101099732 213
40 3300009176 Ga0105242_10618620 Ga0105242_106186202 213
41 3300009545 Ga0105237_10399661 Ga0105237_103996612 213
42 3300013308 Ga0157375_10331229 Ga0157375_103312292 213
43 3300014968 Ga0157379_10250764 Ga0157379_102507642 213
44 3300025901 Ga0207688_10041166 Ga0207688_100411663 213
45 3300025915 Ga0207693_10004341 Ga0207693_100043416 213
46 3300025922 Ga0207646_10319901 Ga0207646_103199012 213
47 3300025938 Ga0207704_10161961 Ga0207704_101619612 213
48 3300046455 Ga0495603_0195307 Ga0495603_0195307_98_751 213
49 3300046461 Ga0495641_0092589 Ga0495641_0092589_30_683 213
50 3300046674 Ga0495588_0293773 Ga0495588_0293773_99_752 213
51 3300046683 Ga0495658_0475753 Ga0495658_0475753_95_745 213
52 3300047321 Ga0495676_0042991 Ga0495676_0042991_1809_2462 213
53 3300048903 Ga0496100_0024376 Ga0496100_0024376_1871_2524 213
54 3300048904 Ga0496101_0026072 Ga0496101_0026072_259_912 213
55 3300048905 Ga0496102_0004133 Ga0496102_0004133_6093_6746 213
56 3300048906 Ga0496103_0001105 Ga0496103_0001105_13113_13766 213
57 3300048907 Ga0496104_0007267 Ga0496104_0007267_6349_7002 213
58 3300048908 Ga0496105_0011958 Ga0496105_0011958_2298_2951 213
59 3300048909 Ga0496106_0027746 Ga0496106_0027746_3480_4133 213
60 3300048912 Ga0496109_0017032 Ga0496109_0017032_3390_4043 213
61 3300048913 Ga0496110_0021572 Ga0496110_0021572_3463_4116 213
62 3300048915 Ga0496112_0120504 Ga0496112_0120504_1462_2115 213
63 3300048916 Ga0496113_0012804 Ga0496113_0012804_3716_4369 213
64 3300048917 Ga0496114_0005743 Ga0496114_0005743_3373_4026 213
65 3300048918 Ga0496115_0010425 Ga0496115_0010425_1947_2600 213
66 3300049587 Ga0501071_0225251 Ga0501071_0225251_679_1389 213
67 3300049824 Ga0501045_0260672 Ga0501045_0260672_427_1137 213
68 3300050491 nmdc:mga00v17_23983_c1 nmdc:mga00v17_23983_c1_1158_1808 213
69 3300050491 nmdc:mga00v17_50636_c1 nmdc:mga00v17_50636_c1_462_1112 213
70 3300050492 nmdc:mga0yw44_5284_c1 nmdc:mga0yw44_5284_c1_4872_5522 213
71 3300050494 nmdc:mga06z11_34329_c1 nmdc:mga06z11_34329_c1_1584_2237 213
72 3300054114 Ga0501084_0299522 Ga0501084_0299522_352_1062 213
73 3300006846 Ga0075430_100058430 Ga0075430_1000584303 214
74 3300049576 Ga0501040_0626073 Ga0501040_0626073_19_687 215
75 3300049578 Ga0501042_0454854 Ga0501042_0454854_83_751 215
76 3300049588 Ga0501072_0028473 Ga0501072_0028473_3512_4180 215
77 3300049592 Ga0501076_0863622 Ga0501076_0863622_25_693 215
78 3300005618 Ga0068864_100000023 Ga0068864_10000002312 216
79 3300026095 Ga0207676_10000025 Ga0207676_10000025262 216
80 3300049568 Ga0501031_0591774 Ga0501031_0591774_31_684 216
81 3300049591 Ga0501075_0266630 Ga0501075_0266630_623_1276 216
82 3300005577 Ga0068857_100300695 Ga0068857_1003006952 217
83 3300006846 Ga0075430_100286620 Ga0075430_1002866202 217
84 3300048913 Ga0496110_0476261 Ga0496110_0476261_390_1061 217
85 3300048915 Ga0496112_0472340 Ga0496112_0472340_323_994 217
86 3300050509 nmdc:mga0qj67_185735_c1 nmdc:mga0qj67_185735_c1_628_1353 217
87 3300050509 nmdc:mga0qj67_399875_c1 nmdc:mga0qj67_399875_c1_81_806 217
88 3300048905 Ga0496102_0477614 Ga0496102_0477614_335_1009 218
89 3300048907 Ga0496104_0000002 Ga0496104_0000002_636525_637208 218
90 3300048908 Ga0496105_0000001 Ga0496105_0000001_690971_691654 218
91 3300048922 Ga0496119_0081795 Ga0496119_0081795_46_729 218
92 3300035725 Ga0373947_0045908 Ga0373947_0045908_680_1384 219
93 3300046517 Ga0495630_0529430 Ga0495630_0529430_142_846 219
94 3300046683 Ga0495658_0275620 Ga0495658_0275620_310_1014 219
95 3300050509 nmdc:mga0qj67_50635_c1 nmdc:mga0qj67_50635_c1_1352_2122 219
96 3300005937 Ga0081455_10067172 Ga0081455_100671722 220
97 3300048909 Ga0496106_0000864 Ga0496106_0000864_12647_13309 220
98 3300048910 Ga0496107_0072361 Ga0496107_0072361_543_1205 220
99 3300005365 Ga0070688_100499481 Ga0070688_1004994811 222
100 3300014968 Ga0157379_10182059 Ga0157379_101820592 222
101 3300036401 Ga0373937_0005061 Ga0373937_0005061_3010_3681 222
102 3300041512 Ga0451853_1691717 Ga0451853_1691717_136_807 222
103 3300046511 Ga0495608_0123565 Ga0495608_0123565_516_1187 222
104 3300046516 Ga0495628_0068302 Ga0495628_0068302_120_791 222
105 3300046516 Ga0495628_0290337 Ga0495628_0290337_52_723 222
106 3300047317 Ga0495604_0228279 Ga0495604_0228279_419_1090 222
107 3300047321 Ga0495676_0282883 Ga0495676_0282883_37_705 222
108 3300053085 Ga0495619_0001132 Ga0495619_0001132_13776_14447 222
109 3300053085 Ga0495619_0005740 Ga0495619_0005740_3822_4493 222
110 3300005356 Ga0070674_100000025 Ga0070674_10000002572 223
111 3300005364 Ga0070673_100002128 Ga0070673_1000021287 223
112 3300005718 Ga0068866_10000001 Ga0068866_10000001105 223
113 3300005843 Ga0068860_100014975 Ga0068860_1000149755 223
114 3300025899 Ga0207642_10000006 Ga0207642_10000006108 223
115 3300025899 Ga0207642_10000007 Ga0207642_10000007127 223
116 3300025937 Ga0207669_10000009 Ga0207669_10000009104 223
117 3300025960 Ga0207651_10001164 Ga0207651_1000116410 223
118 3300028381 Ga0268264_10002246 Ga0268264_100022465 223
119 3300005459 Ga0068867_100000890 Ga0068867_1000008907 224
120 3300005535 Ga0070684_100002537 Ga0070684_1000025376 224
121 3300006048 Ga0075363_100017515 Ga0075363_1000175153 224
122 3300006051 Ga0075364_10031633 Ga0075364_100316335 224
123 3300006051 Ga0075364_10263908 Ga0075364_102639082 224
124 3300006178 Ga0075367_10152663 Ga0075367_101526632 224
125 3300014326 Ga0157380_10000138 Ga0157380_1000013811 224
126 3300014968 Ga0157379_10038288 Ga0157379_100382883 224
127 3300026089 Ga0207648_10004004 Ga0207648_100040047 224
128 3300031691 Ga0316579_10054915 Ga0316579_100549152 224
129 3300036647 Ga0316582_0159839 Ga0316582_0159839_248_961 224
130 3300046473 Ga0495582_0000027 Ga0495582_0000027_5272_5949 224
131 3300046523 Ga0495644_0006018 Ga0495644_0006018_574_1251 224
132 3300046529 Ga0495652_0593786 Ga0495652_0593786_30_704 224
133 3300046537 Ga0495598_0005069 Ga0495598_0005069_418_1095 224
134 3300046683 Ga0495658_0000025 Ga0495658_0000025_5272_5949 224
135 3300048917 Ga0496114_0504474 Ga0496114_0504474_384_1058 224
136 3300048918 Ga0496115_0019660 Ga0496115_0019660_803_1477 224
137 3300049591 Ga0501075_0000407 Ga0501075_0000407_14515_15192 224
138 3300050491 nmdc:mga00v17_211909_c1 nmdc:mga00v17_211909_c1_425_1138 224
139 3300050491 nmdc:mga00v17_5612_c1 nmdc:mga00v17_5612_c1_1624_2337 224
140 3300050492 nmdc:mga0yw44_96376_c1 nmdc:mga0yw44_96376_c1_330_1043 224
141 3300053077 Ga0495601_0008176 Ga0495601_0008176_151_825 224
142 3300005327 Ga0070658_10087323 Ga0070658_100873232 225
143 3300005329 Ga0070683_100088251 Ga0070683_1000882512 225
144 3300005333 Ga0070677_10000001 Ga0070677_1000000150 225
145 3300005337 Ga0070682_100000028 Ga0070682_10000002851 225
146 3300005338 Ga0068868_100040254 Ga0068868_1000402544 225
147 3300005339 Ga0070660_100018927 Ga0070660_1000189273 225
148 3300005340 Ga0070689_100337149 Ga0070689_1003371492 225
149 3300005345 Ga0070692_10045860 Ga0070692_100458602 225
150 3300005347 Ga0070668_100010364 Ga0070668_1000103642 225
151 3300005353 Ga0070669_100070569 Ga0070669_1000705692 225
152 3300005354 Ga0070675_100143929 Ga0070675_1001439292 225
153 3300005356 Ga0070674_100185849 Ga0070674_1001858492 225
154 3300005364 Ga0070673_100115224 Ga0070673_1001152243 225
155 3300005365 Ga0070688_100081195 Ga0070688_1000811951 225
156 3300005366 Ga0070659_100067059 Ga0070659_1000670593 225
157 3300005367 Ga0070667_100313578 Ga0070667_1003135782 225
158 3300005445 Ga0070708_100126852 Ga0070708_1001268522 225
159 3300005455 Ga0070663_100006755 Ga0070663_1000067552 225
160 3300005458 Ga0070681_10110113 Ga0070681_101101132 225
161 3300005458 Ga0070681_10239779 Ga0070681_102397792 225
162 3300005459 Ga0068867_100052816 Ga0068867_1000528162 225
163 3300005466 Ga0070685_10012296 Ga0070685_100122964 225
164 3300005467 Ga0070706_100015108 Ga0070706_1000151088 225
165 3300005467 Ga0070706_100260244 Ga0070706_1002602442 225
166 3300005468 Ga0070707_100317208 Ga0070707_1003172081 225
167 3300005468 Ga0070707_100442087 Ga0070707_1004420872 225
168 3300005471 Ga0070698_100052337 Ga0070698_1000523371 225
169 3300005471 Ga0070698_100077966 Ga0070698_1000779663 225
170 3300005518 Ga0070699_100240257 Ga0070699_1002402572 225
171 3300005530 Ga0070679_100003822 Ga0070679_10000382213 225
172 3300005535 Ga0070684_100053740 Ga0070684_1000537402 225
173 3300005539 Ga0068853_100214702 Ga0068853_1002147022 225
174 3300005544 Ga0070686_100024000 Ga0070686_1000240005 225
175 3300005548 Ga0070665_100000202 Ga0070665_10000020279 225
176 3300005548 Ga0070665_100324937 Ga0070665_1003249372 225
177 3300005549 Ga0070704_100808389 Ga0070704_1008083891 225
178 3300005564 Ga0070664_100013209 Ga0070664_1000132094 225
179 3300005577 Ga0068857_100152713 Ga0068857_1001527132 225
180 3300005578 Ga0068854_100056517 Ga0068854_1000565173 225
181 3300005614 Ga0068856_100064628 Ga0068856_1000646283 225
182 3300005614 Ga0068856_100378232 Ga0068856_1003782322 225
183 3300005616 Ga0068852_100030322 Ga0068852_1000303224 225
184 3300005617 Ga0068859_100289450 Ga0068859_1002894502 225
185 3300005841 Ga0068863_100000004 Ga0068863_100000004201 225
186 3300005842 Ga0068858_100000012 Ga0068858_10000001213 225
187 3300005843 Ga0068860_100113465 Ga0068860_1001134653 225
188 3300006038 Ga0075365_10006941 Ga0075365_100069418 225
189 3300006048 Ga0075363_100000723 Ga0075363_10000072311 225
190 3300006048 Ga0075363_100249415 Ga0075363_1002494152 225
191 3300006051 Ga0075364_10382892 Ga0075364_103828921 225
192 3300006844 Ga0075428_100033472 Ga0075428_1000334725 225
193 3300006844 Ga0075428_100042699 Ga0075428_1000426992 225
194 3300006846 Ga0075430_100007289 Ga0075430_1000072893 225
195 3300006847 Ga0075431_100049678 Ga0075431_1000496784 225
196 3300006847 Ga0075431_100202962 Ga0075431_1002029622 225
197 3300006852 Ga0075433_10011661 Ga0075433_100116615 225
198 3300006871 Ga0075434_100025970 Ga0075434_1000259706 225
199 3300006880 Ga0075429_100022860 Ga0075429_1000228603 225
200 3300006880 Ga0075429_100255718 Ga0075429_1002557183 225
201 3300006931 Ga0097620_100289450 Ga0097620_1002894502 225
202 3300007076 Ga0075435_100002547 Ga0075435_1000025472 225
203 3300009098 Ga0105245_10012932 Ga0105245_100129322 225
204 3300009098 Ga0105245_10101602 Ga0105245_101016022 225
205 3300009147 Ga0114129_10097292 Ga0114129_100972923 225
206 3300009147 Ga0114129_10149380 Ga0114129_101493803 225
207 3300009148 Ga0105243_10016010 Ga0105243_100160105 225
208 3300013102 Ga0157371_10282698 Ga0157371_102826982 225
209 3300013307 Ga0157372_10082172 Ga0157372_100821722 225
210 3300014326 Ga0157380_10021108 Ga0157380_100211082 225
211 3300025901 Ga0207688_10005550 Ga0207688_100055507 225
212 3300025912 Ga0207707_10089185 Ga0207707_100891854 225
213 3300025917 Ga0207660_10178259 Ga0207660_101782591 225
214 3300025918 Ga0207662_10119485 Ga0207662_101194852 225
215 3300025919 Ga0207657_10003401 Ga0207657_100034013 225
216 3300025920 Ga0207649_10087576 Ga0207649_100875762 225
217 3300025921 Ga0207652_10000549 Ga0207652_1000054929 225
218 3300025922 Ga0207646_10410359 Ga0207646_104103592 225
219 3300025923 Ga0207681_10203969 Ga0207681_102039692 225
220 3300025926 Ga0207659_10098726 Ga0207659_100987262 225
221 3300025927 Ga0207687_10000055 Ga0207687_1000005550 225
222 3300025927 Ga0207687_10068583 Ga0207687_100685832 225
223 3300025932 Ga0207690_10019712 Ga0207690_100197124 225
224 3300025933 Ga0207706_10067516 Ga0207706_100675164 225
225 3300025938 Ga0207704_10149606 Ga0207704_101496062 225
226 3300025940 Ga0207691_10050678 Ga0207691_100506785 225
227 3300025944 Ga0207661_10100260 Ga0207661_101002603 225
228 3300025945 Ga0207679_10071739 Ga0207679_100717392 225
229 3300025960 Ga0207651_10100173 Ga0207651_101001733 225
230 3300025972 Ga0207668_10131487 Ga0207668_101314872 225
231 3300025981 Ga0207640_10217197 Ga0207640_102171972 225
232 3300026023 Ga0207677_10024895 Ga0207677_100248955 225
233 3300026035 Ga0207703_10000740 Ga0207703_1000074023 225
234 3300026041 Ga0207639_10177487 Ga0207639_101774872 225
235 3300026041 Ga0207639_10404463 Ga0207639_104044631 225
236 3300026067 Ga0207678_10001712 Ga0207678_1000171213 225
237 3300026078 Ga0207702_10048161 Ga0207702_100481613 225
238 3300026078 Ga0207702_10450236 Ga0207702_104502362 225
239 3300026088 Ga0207641_10000170 Ga0207641_1000017052 225
240 3300026089 Ga0207648_10057082 Ga0207648_100570824 225
241 3300026116 Ga0207674_10207781 Ga0207674_102077813 225
242 3300026142 Ga0207698_10048915 Ga0207698_100489154 225
243 3300028379 Ga0268266_10000020 Ga0268266_10000020170 225
244 3300028381 Ga0268264_10085516 Ga0268264_100855163 225
245 3300031901 Ga0307406_10345886 Ga0307406_103458861 225
246 3300035724 Ga0373933_0310144 Ga0373933_0310144_219_896 225
247 3300041512 Ga0451853_0400745 Ga0451853_0400745_368_1045 225
248 3300046455 Ga0495603_0010100 Ga0495603_0010100_3937_4614 225
249 3300046461 Ga0495641_0000003 Ga0495641_0000003_97171_97848 225
250 3300046516 Ga0495628_0108198 Ga0495628_0108198_927_1604 225
251 3300046535 Ga0495586_0001818 Ga0495586_0001818_514_1191 225
252 3300046543 Ga0495645_0054811 Ga0495645_0054811_86_763 225
253 3300046678 Ga0495599_0001330 Ga0495599_0001330_9692_10369 225
254 3300046694 Ga0495649_0001198 Ga0495649_0001198_6640_7317 225
255 3300047317 Ga0495604_0000038 Ga0495604_0000038_61505_62185 225
256 3300047321 Ga0495676_0001619 Ga0495676_0001619_3679_4356 225
257 3300047322 Ga0495680_0000196 Ga0495680_0000196_30236_30913 225
258 3300047446 Ga0495679_009301 Ga0495679_009301_3034_3711 225
259 3300048088 Ga0495602_0176738 Ga0495602_0176738_451_1128 225
260 3300048909 Ga0496106_0206862 Ga0496106_0206862_726_1445 225
261 3300048911 Ga0496108_0137743 Ga0496108_0137743_718_1437 225
262 3300048912 Ga0496109_0040501 Ga0496109_0040501_1793_2512 225
263 3300048914 Ga0496111_0059564 Ga0496111_0059564_1126_1845 225
264 3300048916 Ga0496113_0774144 Ga0496113_0774144_13_735 225
265 3300049571 Ga0501034_0428014 Ga0501034_0428014_144_866 225
266 3300049583 Ga0501067_0235097 Ga0501067_0235097_24_746 225
267 3300049585 Ga0501069_0042364 Ga0501069_0042364_737_1459 225
268 3300049586 Ga0501070_0023865 Ga0501070_0023865_3565_4287 225
269 3300049586 Ga0501070_0129765 Ga0501070_0129765_649_1371 225
270 3300049586 Ga0501070_0304297 Ga0501070_0304297_281_1003 225
271 3300049587 Ga0501071_0658936 Ga0501071_0658936_17_739 225
272 3300049588 Ga0501072_0229052 Ga0501072_0229052_480_1202 225
273 3300049589 Ga0501073_0114559 Ga0501073_0114559_918_1640 225
274 3300049590 Ga0501074_0047968 Ga0501074_0047968_886_1608 225
275 3300049742 Ga0501080_0127403 Ga0501080_0127403_787_1509 225
276 3300050491 nmdc:mga00v17_132493_c1 nmdc:mga00v17_132493_c1_656_1387 225
277 3300050492 nmdc:mga0yw44_68440_c1 nmdc:mga0yw44_68440_c1_980_1711 225
278 3300050507 nmdc:mga05p37_130469_c1 nmdc:mga05p37_130469_c1_1610_2332 225
279 3300050507 nmdc:mga05p37_720560_c1 nmdc:mga05p37_720560_c1_16_738 225
280 3300050508 nmdc:mga09592_14275_c1 nmdc:mga09592_14275_c1_1941_2663 225
281 3300050508 nmdc:mga09592_250381_c1 nmdc:mga09592_250381_c1_200_922 225
282 3300050509 nmdc:mga0qj67_81010_c1 nmdc:mga0qj67_81010_c1_131_853 225
283 3300050510 nmdc:mga06r32_37032_c1 nmdc:mga06r32_37032_c1_2841_3563 225
284 3300050510 nmdc:mga06r32_9622_c1 nmdc:mga06r32_9622_c1_5960_6682 225
285 3300050512 nmdc:mga0n895_89583_c1 nmdc:mga0n895_89583_c1_1006_1728 225
286 3300050513 nmdc:mga0rr50_11376_c1 nmdc:mga0rr50_11376_c1_1120_1842 225
287 3300053077 Ga0495601_0000072 Ga0495601_0000072_36355_37032 225
288 3300053078 Ga0495612_0000614 Ga0495612_0000614_246_923 225
289 3300053123 Ga0500614_000270 Ga0500614_000270_3621_4298 225
290 3300003320 rootH2_10166254 rootH2_101662542 226
291 3300001979 JGI24740J21852_10006656 JGI24740J21852_100066565 227
292 3300005367 Ga0070667_100054954 Ga0070667_1000549544 227
293 3300005548 Ga0070665_100046449 Ga0070665_1000464494 227
294 3300005843 Ga0068860_100039787 Ga0068860_1000397872 227
295 3300005844 Ga0068862_100003740 Ga0068862_1000037402 227
296 3300005937 Ga0081455_10036449 Ga0081455_100364493 227
297 3300009553 Ga0105249_10026492 Ga0105249_100264923 227
298 3300014325 Ga0163163_10387359 Ga0163163_103873592 227
299 3300014968 Ga0157379_10049376 Ga0157379_100493764 227
300 3300025961 Ga0207712_10026797 Ga0207712_100267973 227
301 3300025986 Ga0207658_10051677 Ga0207658_100516772 227
302 3300028379 Ga0268266_10031260 Ga0268266_100312602 227
303 3300028380 Ga0268265_10012238 Ga0268265_100122382 227
304 3300047320 Ga0495672_0282219 Ga0495672_0282219_17_700 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

12

235

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dz2-assembly1.cif.gz_C crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1h-1,2,3-triazol-4-yl)propyl)thio)methyl)pyrrolidin-3-ol 0.8661 43 226
5f7o-assembly1.cif.gz_A crystal structure of mutant q289l of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine 0.8444 31 226
6dz2-assembly1.cif.gz_B crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1h-1,2,3-triazol-4-yl)propyl)thio)methyl)pyrrolidin-3-ol 0.8417 29 226
5tc5-assembly1.cif.gz_B crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with butylthio-dadme-immucillin-a and chloride 0.8402 29 226
5f7j-assembly1.cif.gz_A crystal structure of mutant n87t of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine 0.8386 31 226
ID Description Score Start End Superfamily
af_Q8IMU4_17_289_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8579 29 226 3.40.50.1580
5f7oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8444 31 226 3.40.50.1580
3t94A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8379 2 227 3.40.50.1580
3t94A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.831 2 227 3.40.50.1580
af_Q09438_1_274_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.8263 1 226 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A838V6D2-F1-model_v4 MTAP family purine nucleoside phosphorylase 0.9665 1 227 GO:0005829
GO:0009116
GO:0017061
GO:0019509
AF-A0A838V6D2-F1-model_v4 MTAP family purine nucleoside phosphorylase 0.9623 1 227 GO:0005829
GO:0009116
GO:0017061
GO:0019509
AF-W2Y906-F1-model_v4 Nucleoside phosphorylase domain-containing protein 0.9515 75 222 GO:0005829
GO:0006166
GO:0017061
GO:0019509
AF-A0A662L897-F1-model_v4 6-oxopurine nucleoside phosphorylase 0.951 29 222 GO:0005829
GO:0009116
GO:0017061
GO:0019509
AF-A0A2N2LTL4-F1-model_v4 Nucleoside phosphorylase domain-containing protein 0.9488 34 215 GO:0005829
GO:0009116
GO:0017061
GO:0019509

Feature Viewer

pLDDT pTM Quality
87.59 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map