F397503
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 206 | 304 | 227 |
Family's Representative Sequence
| Representative Sequence | 3300006038|Ga0075365_10006941|Ga0075365_100069418 |
| Length | 243 |
| Sequence | MATERLALIGGHSILGADPGEGFVPRRVETEAGAVDVYEDERRGTVLLQRHGFGRYTTAAKIDHARNLRALAELGCDRILAIASVGGLRPDLGVGTFLCPDDFIALHLGLSLHDDHGGERVPGFDQAWRARVMETWGRVAEPRLVDGGVYWQAIGPRFETPAEIRLIAAHADVIGMTVASECIVAGELGIPYAAVCVVDNLANGIAEAPLSVEEFESGKDANRLRLIAAIDAVAEELVAGAAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 123 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 124 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 126 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 127 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 128 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 129 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 130 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 131 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 134 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 135 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 136 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 137 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 138 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 139 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 167 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 168 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 173 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 174 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 177 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 193 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 194 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 195 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 196 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 206 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.57 |
| Nodule | 0 |
| Rhizoplane | 9.21 |
| Rhizosphere | 81.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006656 | 3300001979 | Bacteria | 4763 |
| 2 | rootH2_10166254 | 3300003320 | Bacteria | 1215 |
| 3 | Ga0070658_10087323 | 3300005327 | Bacteria | 2567 |
| 4 | Ga0070683_100088251 | 3300005329 | Bacteria | 2909 |
| 5 | Ga0070677_10000001 | 3300005333 | Bacteria | 118426 |
| 6 | Ga0070666_10333127 | 3300005335 | Bacteria | 1084 |
| 7 | Ga0070682_100000028 | 3300005337 | Bacteria | 185177 |
| 8 | Ga0070682_100042354 | 3300005337 | Bacteria | 2810 |
| 9 | Ga0068868_100026857 | 3300005338 | Bacteria | 4390 |
| 10 | Ga0068868_100040254 | 3300005338 | Bacteria | 3637 |
| 11 | Ga0070660_100018927 | 3300005339 | Bacteria | 5041 |
| 12 | Ga0070689_100337149 | 3300005340 | Bacteria | 1262 |
| 13 | Ga0070692_10045860 | 3300005345 | Bacteria | 2256 |
| 14 | Ga0070668_100010364 | 3300005347 | Bacteria | 6923 |
| 15 | Ga0070669_100070569 | 3300005353 | Bacteria | 2583 |
| 16 | Ga0070675_100143929 | 3300005354 | Bacteria | 2039 |
| 17 | Ga0070674_100000025 | 3300005356 | Bacteria | 78679 |
| 18 | Ga0070674_100075353 | 3300005356 | Bacteria | 2396 |
| 19 | Ga0070674_100185849 | 3300005356 | Bacteria | 1595 |
| 20 | Ga0070673_100002128 | 3300005364 | Bacteria | 11991 |
| 21 | Ga0070673_100115224 | 3300005364 | Bacteria | 2235 |
| 22 | Ga0070688_100081195 | 3300005365 | Bacteria | 2099 |
| 23 | Ga0070688_100499481 | 3300005365 | Bacteria | 917 |
| 24 | Ga0070659_100067059 | 3300005366 | Bacteria | 2845 |
| 25 | Ga0070667_100054954 | 3300005367 | Bacteria | 3362 |
| 26 | Ga0070667_100313578 | 3300005367 | Bacteria | 1414 |
| 27 | Ga0070710_10257403 | 3300005437 | Bacteria | 1124 |
| 28 | Ga0070701_10139632 | 3300005438 | Bacteria | 1384 |
| 29 | Ga0070711_100196377 | 3300005439 | Bacteria | 1554 |
| 30 | Ga0070705_100439081 | 3300005440 | Bacteria | 976 |
| 31 | Ga0070694_100399778 | 3300005444 | Bacteria | 1075 |
| 32 | Ga0070708_100126852 | 3300005445 | Bacteria | 2359 |
| 33 | Ga0070663_100006755 | 3300005455 | Bacteria | 6931 |
| 34 | Ga0070681_10110113 | 3300005458 | Bacteria | 2694 |
| 35 | Ga0070681_10239779 | 3300005458 | Bacteria | 1727 |
| 36 | Ga0068867_100000890 | 3300005459 | Bacteria | 20219 |
| 37 | Ga0068867_100052816 | 3300005459 | Bacteria | 3000 |
| 38 | Ga0068867_100335406 | 3300005459 | Bacteria | 1257 |
| 39 | Ga0070685_10012296 | 3300005466 | Bacteria | 4495 |
| 40 | Ga0070706_100015108 | 3300005467 | Bacteria | 7131 |
| 41 | Ga0070706_100260244 | 3300005467 | Unclassified | 1620 |
| 42 | Ga0070707_100200152 | 3300005468 | Bacteria | 1947 |
| 43 | Ga0070707_100317208 | 3300005468 | Bacteria | 1515 |
| 44 | Ga0070707_100442087 | 3300005468 | Bacteria | 1261 |
| 45 | Ga0070698_100052337 | 3300005471 | Bacteria | 4154 |
| 46 | Ga0070698_100077966 | 3300005471 | Unclassified | 3312 |
| 47 | Ga0070699_100240257 | 3300005518 | Bacteria | 1616 |
| 48 | Ga0070679_100003822 | 3300005530 | Bacteria | 13829 |
| 49 | Ga0070684_100002537 | 3300005535 | Bacteria | 13485 |
| 50 | Ga0070684_100053740 | 3300005535 | Bacteria | 3508 |
| 51 | Ga0068853_100214702 | 3300005539 | Bacteria | 1755 |
| 52 | Ga0070686_100024000 | 3300005544 | Bacteria | 3652 |
| 53 | Ga0070686_100143636 | 3300005544 | Bacteria | 1664 |
| 54 | Ga0070665_100000202 | 3300005548 | Bacteria | 104773 |
| 55 | Ga0070665_100046449 | 3300005548 | Bacteria | 4363 |
| 56 | Ga0070665_100324937 | 3300005548 | Bacteria | 1542 |
| 57 | Ga0070704_100808389 | 3300005549 | Unclassified | 838 |
| 58 | Ga0070664_100013209 | 3300005564 | Bacteria | 6724 |
| 59 | Ga0068857_100152713 | 3300005577 | Bacteria | 2093 |
| 60 | Ga0068857_100300695 | 3300005577 | Bacteria | 1479 |
| 61 | Ga0068854_100056517 | 3300005578 | Bacteria | 2828 |
| 62 | Ga0068856_100064628 | 3300005614 | Bacteria | 3616 |
| 63 | Ga0068856_100378232 | 3300005614 | Bacteria | 1435 |
| 64 | Ga0068852_100030322 | 3300005616 | Bacteria | 4451 |
| 65 | Ga0068859_100289450 | 3300005617 | Bacteria | 1731 |
| 66 | Ga0068864_100000023 | 3300005618 | Bacteria | 257064 |
| 67 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 68 | Ga0068866_10065992 | 3300005718 | Bacteria | 1895 |
| 69 | Ga0068863_100000004 | 3300005841 | Bacteria | 272478 |
| 70 | Ga0068858_100000012 | 3300005842 | Bacteria | 216931 |
| 71 | Ga0068858_100374559 | 3300005842 | Bacteria | 1366 |
| 72 | Ga0068860_100014975 | 3300005843 | Bacteria | 7579 |
| 73 | Ga0068860_100039787 | 3300005843 | Bacteria | 4497 |
| 74 | Ga0068860_100113465 | 3300005843 | Bacteria | 2591 |
| 75 | Ga0068862_100003740 | 3300005844 | Bacteria | 12983 |
| 76 | Ga0081455_10036449 | 3300005937 | Bacteria | 4378 |
| 77 | Ga0081455_10067172 | 3300005937 | Bacteria | 2989 |
| 78 | Ga0075365_10002624 | 3300006038 | Bacteria | 8906 |
| 79 | Ga0075365_10006941 | 3300006038 | Bacteria | 6290 |
| 80 | Ga0075363_100000723 | 3300006048 | Bacteria | 11223 |
| 81 | Ga0075363_100017515 | 3300006048 | Bacteria | 3554 |
| 82 | Ga0075363_100021799 | 3300006048 | Bacteria | 3233 |
| 83 | Ga0075363_100249415 | 3300006048 | Bacteria | 1022 |
| 84 | Ga0075364_10031633 | 3300006051 | Bacteria | 3399 |
| 85 | Ga0075364_10124836 | 3300006051 | Bacteria | 1725 |
| 86 | Ga0075364_10263908 | 3300006051 | Unclassified | 1171 |
| 87 | Ga0075364_10382892 | 3300006051 | Bacteria | 959 |
| 88 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 89 | Ga0070712_100003807 | 3300006175 | Bacteria | 9297 |
| 90 | Ga0075367_10052089 | 3300006178 | Bacteria | 2422 |
| 91 | Ga0075367_10152663 | 3300006178 | Unclassified | 1434 |
| 92 | Ga0075428_100033472 | 3300006844 | Bacteria | 5675 |
| 93 | Ga0075428_100042699 | 3300006844 | Bacteria | 4985 |
| 94 | Ga0075430_100007289 | 3300006846 | Bacteria | 9337 |
| 95 | Ga0075430_100058430 | 3300006846 | Unclassified | 3242 |
| 96 | Ga0075430_100286620 | 3300006846 | Bacteria | 1362 |
| 97 | Ga0075431_100049678 | 3300006847 | Bacteria | 4324 |
| 98 | Ga0075431_100202962 | 3300006847 | Bacteria | 2028 |
| 99 | Ga0075433_10011661 | 3300006852 | Bacteria | 7080 |
| 100 | Ga0075434_100025970 | 3300006871 | Bacteria | 5735 |
| 101 | Ga0075429_100022860 | 3300006880 | Bacteria | 5421 |
| 102 | Ga0075429_100255718 | 3300006880 | Bacteria | 1533 |
| 103 | Ga0068865_100141994 | 3300006881 | Bacteria | 1812 |
| 104 | Ga0097620_100289450 | 3300006931 | Bacteria | 1731 |
| 105 | Ga0075435_100002547 | 3300007076 | Bacteria | 12136 |
| 106 | Ga0105245_10003682 | 3300009098 | Bacteria | 13684 |
| 107 | Ga0105245_10012932 | 3300009098 | Bacteria | 7275 |
| 108 | Ga0105245_10101602 | 3300009098 | Bacteria | 2662 |
| 109 | Ga0105247_10109973 | 3300009101 | Bacteria | 1772 |
| 110 | Ga0114129_10097292 | 3300009147 | Bacteria | 4075 |
| 111 | Ga0114129_10149380 | 3300009147 | Bacteria | 3198 |
| 112 | Ga0105243_10016010 | 3300009148 | Bacteria | 5672 |
| 113 | Ga0105242_10618620 | 3300009176 | Bacteria | 1049 |
| 114 | Ga0105237_10399661 | 3300009545 | Bacteria | 1379 |
| 115 | Ga0105249_10026492 | 3300009553 | Bacteria | 5225 |
| 116 | Ga0157371_10282698 | 3300013102 | Bacteria | 1199 |
| 117 | Ga0157372_10082172 | 3300013307 | Bacteria | 3647 |
| 118 | Ga0157375_10331229 | 3300013308 | Bacteria | 1687 |
| 119 | Ga0163163_10387359 | 3300014325 | Bacteria | 1455 |
| 120 | Ga0157380_10000138 | 3300014326 | Bacteria | 40711 |
| 121 | Ga0157380_10021108 | 3300014326 | Bacteria | 4881 |
| 122 | Ga0157379_10038288 | 3300014968 | Bacteria | 4279 |
| 123 | Ga0157379_10049376 | 3300014968 | Bacteria | 3757 |
| 124 | Ga0157379_10182059 | 3300014968 | Bacteria | 1898 |
| 125 | Ga0157379_10250764 | 3300014968 | Bacteria | 1607 |
| 126 | Ga0207642_10000006 | 3300025899 | Bacteria | 230268 |
| 127 | Ga0207642_10000007 | 3300025899 | Bacteria | 226017 |
| 128 | Ga0207688_10005550 | 3300025901 | Bacteria | 6859 |
| 129 | Ga0207688_10041166 | 3300025901 | Bacteria | 2569 |
| 130 | Ga0207685_10000011 | 3300025905 | Bacteria | 213430 |
| 131 | Ga0207645_10286674 | 3300025907 | Bacteria | 1094 |
| 132 | Ga0207707_10089185 | 3300025912 | Bacteria | 2695 |
| 133 | Ga0207693_10004341 | 3300025915 | Bacteria | 11995 |
| 134 | Ga0207660_10178259 | 3300025917 | Bacteria | 1649 |
| 135 | Ga0207662_10119485 | 3300025918 | Bacteria | 1652 |
| 136 | Ga0207657_10003401 | 3300025919 | Bacteria | 17003 |
| 137 | Ga0207649_10087576 | 3300025920 | Bacteria | 2032 |
| 138 | Ga0207652_10000549 | 3300025921 | Bacteria | 38051 |
| 139 | Ga0207646_10319901 | 3300025922 | Bacteria | 1402 |
| 140 | Ga0207646_10410359 | 3300025922 | Bacteria | 1223 |
| 141 | Ga0207681_10203969 | 3300025923 | Bacteria | 1520 |
| 142 | Ga0207659_10098726 | 3300025926 | Bacteria | 2196 |
| 143 | Ga0207687_10000055 | 3300025927 | Bacteria | 88382 |
| 144 | Ga0207687_10068583 | 3300025927 | Bacteria | 2527 |
| 145 | Ga0207690_10019712 | 3300025932 | Bacteria | 4158 |
| 146 | Ga0207706_10067516 | 3300025933 | Bacteria | 3146 |
| 147 | Ga0207669_10000009 | 3300025937 | Bacteria | 168012 |
| 148 | Ga0207704_10149606 | 3300025938 | Bacteria | 1645 |
| 149 | Ga0207704_10161961 | 3300025938 | Bacteria | 1593 |
| 150 | Ga0207691_10050678 | 3300025940 | Bacteria | 3800 |
| 151 | Ga0207661_10100260 | 3300025944 | Bacteria | 2430 |
| 152 | Ga0207679_10071739 | 3300025945 | Bacteria | 2613 |
| 153 | Ga0207651_10001164 | 3300025960 | Bacteria | 11772 |
| 154 | Ga0207651_10100173 | 3300025960 | Bacteria | 2148 |
| 155 | Ga0207712_10026797 | 3300025961 | Bacteria | 3845 |
| 156 | Ga0207668_10131487 | 3300025972 | Bacteria | 1912 |
| 157 | Ga0207640_10217197 | 3300025981 | Bacteria | 1461 |
| 158 | Ga0207658_10051677 | 3300025986 | Bacteria | 3029 |
| 159 | Ga0207677_10024895 | 3300026023 | Bacteria | 3725 |
| 160 | Ga0207703_10000740 | 3300026035 | Bacteria | 32186 |
| 161 | Ga0207639_10177487 | 3300026041 | Bacteria | 1809 |
| 162 | Ga0207639_10404463 | 3300026041 | Bacteria | 1230 |
| 163 | Ga0207678_10001712 | 3300026067 | Bacteria | 20098 |
| 164 | Ga0207702_10048161 | 3300026078 | Bacteria | 3594 |
| 165 | Ga0207702_10450236 | 3300026078 | Bacteria | 1249 |
| 166 | Ga0207641_10000170 | 3300026088 | Bacteria | 91128 |
| 167 | Ga0207648_10004004 | 3300026089 | Bacteria | 15293 |
| 168 | Ga0207648_10057082 | 3300026089 | Bacteria | 3406 |
| 169 | Ga0207676_10000025 | 3300026095 | Bacteria | 261714 |
| 170 | Ga0207674_10207781 | 3300026116 | Bacteria | 1907 |
| 171 | Ga0207698_10048915 | 3300026142 | Bacteria | 3214 |
| 172 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 173 | Ga0268266_10031260 | 3300028379 | Bacteria | 4520 |
| 174 | Ga0268265_10012238 | 3300028380 | Bacteria | 5811 |
| 175 | Ga0268264_10002246 | 3300028381 | Bacteria | 17121 |
| 176 | Ga0268264_10085516 | 3300028381 | Bacteria | 2707 |
| 177 | Ga0265337_1000002 | 3300028556 | Bacteria | 139247 |
| 178 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 179 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 180 | Ga0265324_10000263 | 3300029957 | Bacteria | 39080 |
| 181 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 182 | Ga0265329_10002999 | 3300031242 | Bacteria | 7498 |
| 183 | Ga0265339_10111279 | 3300031249 | Bacteria | 1416 |
| 184 | Ga0265331_10006616 | 3300031250 | Bacteria | 6823 |
| 185 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 186 | Ga0316579_10054915 | 3300031691 | Bacteria | 1868 |
| 187 | Ga0265314_10000058 | 3300031711 | Bacteria | 167476 |
| 188 | Ga0265342_10061030 | 3300031712 | Bacteria | 2222 |
| 189 | Ga0307406_10345886 | 3300031901 | Bacteria | 1160 |
| 190 | Ga0373933_0310144 | 3300035724 | Unclassified | 1022 |
| 191 | Ga0373947_0045908 | 3300035725 | Bacteria | 2615 |
| 192 | Ga0373937_0005061 | 3300036401 | Bacteria | 11221 |
| 193 | Ga0316582_0159839 | 3300036647 | Bacteria | 1526 |
| 194 | Ga0451853_0400745 | 3300041512 | Bacteria | 1853 |
| 195 | Ga0451853_1691717 | 3300041512 | Bacteria | 971 |
| 196 | Ga0495603_0000023 | 3300046455 | Bacteria | 63559 |
| 197 | Ga0495603_0010100 | 3300046455 | Bacteria | 5713 |
| 198 | Ga0495603_0195307 | 3300046455 | Bacteria | 1170 |
| 199 | Ga0495641_0000003 | 3300046461 | Bacteria | 242879 |
| 200 | Ga0495641_0092589 | 3300046461 | Bacteria | 1350 |
| 201 | Ga0495582_0000027 | 3300046473 | Bacteria | 79970 |
| 202 | Ga0495608_0123565 | 3300046511 | Bacteria | 1659 |
| 203 | Ga0495628_0068302 | 3300046516 | Bacteria | 2774 |
| 204 | Ga0495628_0108198 | 3300046516 | Bacteria | 2140 |
| 205 | Ga0495628_0290337 | 3300046516 | Bacteria | 1212 |
| 206 | Ga0495630_0529430 | 3300046517 | Unclassified | 904 |
| 207 | Ga0495644_0006018 | 3300046523 | Bacteria | 4726 |
| 208 | Ga0495652_0593786 | 3300046529 | Unclassified | 756 |
| 209 | Ga0495586_0001818 | 3300046535 | Bacteria | 11638 |
| 210 | Ga0495598_0005069 | 3300046537 | Bacteria | 2895 |
| 211 | Ga0495645_0054811 | 3300046543 | Bacteria | 2896 |
| 212 | Ga0495588_0293773 | 3300046674 | Unclassified | 856 |
| 213 | Ga0495599_0001330 | 3300046678 | Bacteria | 14092 |
| 214 | Ga0495658_0000025 | 3300046683 | Bacteria | 79910 |
| 215 | Ga0495658_0275620 | 3300046683 | Bacteria | 1061 |
| 216 | Ga0495658_0475753 | 3300046683 | Unclassified | 799 |
| 217 | Ga0495649_0001198 | 3300046694 | Bacteria | 20005 |
| 218 | Ga0495604_0000038 | 3300047317 | Bacteria | 123703 |
| 219 | Ga0495604_0228279 | 3300047317 | Bacteria | 1278 |
| 220 | Ga0495672_0282219 | 3300047320 | Unclassified | 793 |
| 221 | Ga0495676_0001619 | 3300047321 | Bacteria | 19593 |
| 222 | Ga0495676_0042991 | 3300047321 | Bacteria | 3702 |
| 223 | Ga0495676_0282883 | 3300047321 | Unclassified | 1123 |
| 224 | Ga0495680_0000196 | 3300047322 | Bacteria | 65437 |
| 225 | Ga0495679_009301 | 3300047446 | Bacteria | 3943 |
| 226 | Ga0495602_0176738 | 3300048088 | Bacteria | 1651 |
| 227 | Ga0496100_0024376 | 3300048903 | Bacteria | 3690 |
| 228 | Ga0496101_0026072 | 3300048904 | Bacteria | 4061 |
| 229 | Ga0496102_0004133 | 3300048905 | Bacteria | 12307 |
| 230 | Ga0496102_0477614 | 3300048905 | Unclassified | 1168 |
| 231 | Ga0496103_0001105 | 3300048906 | Bacteria | 18770 |
| 232 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 233 | Ga0496104_0007267 | 3300048907 | Bacteria | 9775 |
| 234 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 235 | Ga0496105_0011958 | 3300048908 | Bacteria | 6872 |
| 236 | Ga0496106_0000864 | 3300048909 | Bacteria | 22031 |
| 237 | Ga0496106_0027746 | 3300048909 | Bacteria | 4217 |
| 238 | Ga0496106_0206862 | 3300048909 | Bacteria | 1563 |
| 239 | Ga0496107_0072361 | 3300048910 | Bacteria | 2506 |
| 240 | Ga0496108_0137743 | 3300048911 | Bacteria | 2101 |
| 241 | Ga0496109_0017032 | 3300048912 | Bacteria | 6360 |
| 242 | Ga0496109_0040501 | 3300048912 | Bacteria | 4220 |
| 243 | Ga0496110_0011873 | 3300048913 | Bacteria | 7155 |
| 244 | Ga0496110_0021572 | 3300048913 | Bacteria | 5456 |
| 245 | Ga0496110_0476261 | 3300048913 | Bacteria | 1137 |
| 246 | Ga0496111_0059564 | 3300048914 | Bacteria | 2767 |
| 247 | Ga0496112_0120504 | 3300048915 | Bacteria | 2593 |
| 248 | Ga0496112_0472340 | 3300048915 | Bacteria | 1191 |
| 249 | Ga0496113_0012804 | 3300048916 | Bacteria | 5652 |
| 250 | Ga0496113_0774144 | 3300048916 | Bacteria | 763 |
| 251 | Ga0496114_0005743 | 3300048917 | Bacteria | 9736 |
| 252 | Ga0496114_0504474 | 3300048917 | Unclassified | 1070 |
| 253 | Ga0496115_0010425 | 3300048918 | Bacteria | 6943 |
| 254 | Ga0496115_0019660 | 3300048918 | Bacteria | 5199 |
| 255 | Ga0496119_0081795 | 3300048922 | Bacteria | 1859 |
| 256 | Ga0501031_0591774 | 3300049568 | Unclassified | 714 |
| 257 | Ga0501034_0428014 | 3300049571 | Bacteria | 1244 |
| 258 | Ga0501040_0626073 | 3300049576 | Bacteria | 778 |
| 259 | Ga0501042_0454854 | 3300049578 | Bacteria | 928 |
| 260 | Ga0501067_0235097 | 3300049583 | Bacteria | 1020 |
| 261 | Ga0501069_0042364 | 3300049585 | Bacteria | 2518 |
| 262 | Ga0501070_0023865 | 3300049586 | Bacteria | 5126 |
| 263 | Ga0501070_0129765 | 3300049586 | Bacteria | 2082 |
| 264 | Ga0501070_0304297 | 3300049586 | Bacteria | 1298 |
| 265 | Ga0501071_0225251 | 3300049587 | Bacteria | 1412 |
| 266 | Ga0501071_0658936 | 3300049587 | Bacteria | 805 |
| 267 | Ga0501072_0028473 | 3300049588 | Bacteria | 4362 |
| 268 | Ga0501072_0229052 | 3300049588 | Bacteria | 1480 |
| 269 | Ga0501073_0114559 | 3300049589 | Bacteria | 1869 |
| 270 | Ga0501074_0047968 | 3300049590 | Bacteria | 3086 |
| 271 | Ga0501075_0000407 | 3300049591 | Bacteria | 25084 |
| 272 | Ga0501075_0266630 | 3300049591 | Unclassified | 1305 |
| 273 | Ga0501076_0863622 | 3300049592 | Bacteria | 746 |
| 274 | Ga0501080_0127403 | 3300049742 | Bacteria | 2357 |
| 275 | Ga0501045_0260672 | 3300049824 | Bacteria | 1290 |
| 276 | nmdc:mga03n38_7422_c1 | 3300050490 | Bacteria | 3880 |
| 277 | nmdc:mga00v17_132493_c1 | 3300050491 | Unclassified | 1593 |
| 278 | nmdc:mga00v17_211909_c1 | 3300050491 | Unclassified | 1254 |
| 279 | nmdc:mga00v17_23983_c1 | 3300050491 | Bacteria | 3534 |
| 280 | nmdc:mga00v17_50636_c1 | 3300050491 | Bacteria | 2524 |
| 281 | nmdc:mga00v17_5612_c1 | 3300050491 | Bacteria | 6617 |
| 282 | nmdc:mga0yw44_5284_c1 | 3300050492 | Bacteria | 6066 |
| 283 | nmdc:mga0yw44_68440_c1 | 3300050492 | Bacteria | 2196 |
| 284 | nmdc:mga0yw44_96376_c1 | 3300050492 | Unclassified | 1878 |
| 285 | nmdc:mga06z11_34329_c1 | 3300050494 | Bacteria | 2489 |
| 286 | nmdc:mga05p37_130469_c1 | 3300050507 | Bacteria | 3084 |
| 287 | nmdc:mga05p37_720560_c1 | 3300050507 | Bacteria | 1105 |
| 288 | nmdc:mga09592_14275_c1 | 3300050508 | Bacteria | 6484 |
| 289 | nmdc:mga09592_250381_c1 | 3300050508 | Viruses | 1535 |
| 290 | nmdc:mga0qj67_185735_c1 | 3300050509 | Unclassified | 1689 |
| 291 | nmdc:mga0qj67_399875_c1 | 3300050509 | Bacteria | 1109 |
| 292 | nmdc:mga0qj67_50635_c1 | 3300050509 | Bacteria | 3285 |
| 293 | nmdc:mga0qj67_81010_c1 | 3300050509 | Bacteria | 2602 |
| 294 | nmdc:mga06r32_37032_c1 | 3300050510 | Bacteria | 4615 |
| 295 | nmdc:mga06r32_9622_c1 | 3300050510 | Bacteria | 8732 |
| 296 | nmdc:mga0n895_89583_c1 | 3300050512 | Bacteria | 3078 |
| 297 | nmdc:mga0rr50_11376_c1 | 3300050513 | Bacteria | 5695 |
| 298 | Ga0495601_0000072 | 3300053077 | Bacteria | 56009 |
| 299 | Ga0495601_0008176 | 3300053077 | Bacteria | 6169 |
| 300 | Ga0495612_0000614 | 3300053078 | Bacteria | 14345 |
| 301 | Ga0495619_0001132 | 3300053085 | Bacteria | 17518 |
| 302 | Ga0495619_0005740 | 3300053085 | Bacteria | 7864 |
| 303 | Ga0500614_000270 | 3300053123 | Bacteria | 13468 |
| 304 | Ga0501084_0299522 | 3300054114 | Bacteria | 1358 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028556 | Ga0265337_1000002 | Ga0265337_1000002140 | 183 |
| 2 | 3300028558 | Ga0265326_10000007 | Ga0265326_10000007198 | 183 |
| 3 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001105 | 183 |
| 4 | 3300029957 | Ga0265324_10000263 | Ga0265324_1000026332 | 183 |
| 5 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002105 | 183 |
| 6 | 3300031242 | Ga0265329_10002999 | Ga0265329_100029993 | 183 |
| 7 | 3300031249 | Ga0265339_10111279 | Ga0265339_101112792 | 183 |
| 8 | 3300031250 | Ga0265331_10006616 | Ga0265331_100066163 | 183 |
| 9 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011105 | 183 |
| 10 | 3300031711 | Ga0265314_10000058 | Ga0265314_1000005812 | 183 |
| 11 | 3300031712 | Ga0265342_10061030 | Ga0265342_100610302 | 183 |
| 12 | 3300046455 | Ga0495603_0000023 | Ga0495603_0000023_1460_2134 | 202 |
| 13 | 3300025907 | Ga0207645_10286674 | Ga0207645_102866741 | 207 |
| 14 | 3300006048 | Ga0075363_100021799 | Ga0075363_1000217991 | 212 |
| 15 | 3300006163 | Ga0070715_10000001 | Ga0070715_1000000176 | 212 |
| 16 | 3300025905 | Ga0207685_10000011 | Ga0207685_1000001176 | 212 |
| 17 | 3300048913 | Ga0496110_0011873 | Ga0496110_0011873_6063_6743 | 212 |
| 18 | 3300050490 | nmdc:mga03n38_7422_c1 | nmdc:mga03n38_7422_c1_2559_3278 | 212 |
| 19 | 3300005335 | Ga0070666_10333127 | Ga0070666_103331272 | 213 |
| 20 | 3300005337 | Ga0070682_100042354 | Ga0070682_1000423543 | 213 |
| 21 | 3300005338 | Ga0068868_100026857 | Ga0068868_1000268575 | 213 |
| 22 | 3300005356 | Ga0070674_100075353 | Ga0070674_1000753532 | 213 |
| 23 | 3300005437 | Ga0070710_10257403 | Ga0070710_102574032 | 213 |
| 24 | 3300005438 | Ga0070701_10139632 | Ga0070701_101396322 | 213 |
| 25 | 3300005439 | Ga0070711_100196377 | Ga0070711_1001963772 | 213 |
| 26 | 3300005440 | Ga0070705_100439081 | Ga0070705_1004390812 | 213 |
| 27 | 3300005444 | Ga0070694_100399778 | Ga0070694_1003997782 | 213 |
| 28 | 3300005459 | Ga0068867_100335406 | Ga0068867_1003354062 | 213 |
| 29 | 3300005468 | Ga0070707_100200152 | Ga0070707_1002001522 | 213 |
| 30 | 3300005544 | Ga0070686_100143636 | Ga0070686_1001436362 | 213 |
| 31 | 3300005718 | Ga0068866_10065992 | Ga0068866_100659922 | 213 |
| 32 | 3300005842 | Ga0068858_100374559 | Ga0068858_1003745592 | 213 |
| 33 | 3300006038 | Ga0075365_10002624 | Ga0075365_100026244 | 213 |
| 34 | 3300006051 | Ga0075364_10124836 | Ga0075364_101248361 | 213 |
| 35 | 3300006175 | Ga0070712_100003807 | Ga0070712_1000038074 | 213 |
| 36 | 3300006178 | Ga0075367_10052089 | Ga0075367_100520892 | 213 |
| 37 | 3300006881 | Ga0068865_100141994 | Ga0068865_1001419942 | 213 |
| 38 | 3300009098 | Ga0105245_10003682 | Ga0105245_100036822 | 213 |
| 39 | 3300009101 | Ga0105247_10109973 | Ga0105247_101099732 | 213 |
| 40 | 3300009176 | Ga0105242_10618620 | Ga0105242_106186202 | 213 |
| 41 | 3300009545 | Ga0105237_10399661 | Ga0105237_103996612 | 213 |
| 42 | 3300013308 | Ga0157375_10331229 | Ga0157375_103312292 | 213 |
| 43 | 3300014968 | Ga0157379_10250764 | Ga0157379_102507642 | 213 |
| 44 | 3300025901 | Ga0207688_10041166 | Ga0207688_100411663 | 213 |
| 45 | 3300025915 | Ga0207693_10004341 | Ga0207693_100043416 | 213 |
| 46 | 3300025922 | Ga0207646_10319901 | Ga0207646_103199012 | 213 |
| 47 | 3300025938 | Ga0207704_10161961 | Ga0207704_101619612 | 213 |
| 48 | 3300046455 | Ga0495603_0195307 | Ga0495603_0195307_98_751 | 213 |
| 49 | 3300046461 | Ga0495641_0092589 | Ga0495641_0092589_30_683 | 213 |
| 50 | 3300046674 | Ga0495588_0293773 | Ga0495588_0293773_99_752 | 213 |
| 51 | 3300046683 | Ga0495658_0475753 | Ga0495658_0475753_95_745 | 213 |
| 52 | 3300047321 | Ga0495676_0042991 | Ga0495676_0042991_1809_2462 | 213 |
| 53 | 3300048903 | Ga0496100_0024376 | Ga0496100_0024376_1871_2524 | 213 |
| 54 | 3300048904 | Ga0496101_0026072 | Ga0496101_0026072_259_912 | 213 |
| 55 | 3300048905 | Ga0496102_0004133 | Ga0496102_0004133_6093_6746 | 213 |
| 56 | 3300048906 | Ga0496103_0001105 | Ga0496103_0001105_13113_13766 | 213 |
| 57 | 3300048907 | Ga0496104_0007267 | Ga0496104_0007267_6349_7002 | 213 |
| 58 | 3300048908 | Ga0496105_0011958 | Ga0496105_0011958_2298_2951 | 213 |
| 59 | 3300048909 | Ga0496106_0027746 | Ga0496106_0027746_3480_4133 | 213 |
| 60 | 3300048912 | Ga0496109_0017032 | Ga0496109_0017032_3390_4043 | 213 |
| 61 | 3300048913 | Ga0496110_0021572 | Ga0496110_0021572_3463_4116 | 213 |
| 62 | 3300048915 | Ga0496112_0120504 | Ga0496112_0120504_1462_2115 | 213 |
| 63 | 3300048916 | Ga0496113_0012804 | Ga0496113_0012804_3716_4369 | 213 |
| 64 | 3300048917 | Ga0496114_0005743 | Ga0496114_0005743_3373_4026 | 213 |
| 65 | 3300048918 | Ga0496115_0010425 | Ga0496115_0010425_1947_2600 | 213 |
| 66 | 3300049587 | Ga0501071_0225251 | Ga0501071_0225251_679_1389 | 213 |
| 67 | 3300049824 | Ga0501045_0260672 | Ga0501045_0260672_427_1137 | 213 |
| 68 | 3300050491 | nmdc:mga00v17_23983_c1 | nmdc:mga00v17_23983_c1_1158_1808 | 213 |
| 69 | 3300050491 | nmdc:mga00v17_50636_c1 | nmdc:mga00v17_50636_c1_462_1112 | 213 |
| 70 | 3300050492 | nmdc:mga0yw44_5284_c1 | nmdc:mga0yw44_5284_c1_4872_5522 | 213 |
| 71 | 3300050494 | nmdc:mga06z11_34329_c1 | nmdc:mga06z11_34329_c1_1584_2237 | 213 |
| 72 | 3300054114 | Ga0501084_0299522 | Ga0501084_0299522_352_1062 | 213 |
| 73 | 3300006846 | Ga0075430_100058430 | Ga0075430_1000584303 | 214 |
| 74 | 3300049576 | Ga0501040_0626073 | Ga0501040_0626073_19_687 | 215 |
| 75 | 3300049578 | Ga0501042_0454854 | Ga0501042_0454854_83_751 | 215 |
| 76 | 3300049588 | Ga0501072_0028473 | Ga0501072_0028473_3512_4180 | 215 |
| 77 | 3300049592 | Ga0501076_0863622 | Ga0501076_0863622_25_693 | 215 |
| 78 | 3300005618 | Ga0068864_100000023 | Ga0068864_10000002312 | 216 |
| 79 | 3300026095 | Ga0207676_10000025 | Ga0207676_10000025262 | 216 |
| 80 | 3300049568 | Ga0501031_0591774 | Ga0501031_0591774_31_684 | 216 |
| 81 | 3300049591 | Ga0501075_0266630 | Ga0501075_0266630_623_1276 | 216 |
| 82 | 3300005577 | Ga0068857_100300695 | Ga0068857_1003006952 | 217 |
| 83 | 3300006846 | Ga0075430_100286620 | Ga0075430_1002866202 | 217 |
| 84 | 3300048913 | Ga0496110_0476261 | Ga0496110_0476261_390_1061 | 217 |
| 85 | 3300048915 | Ga0496112_0472340 | Ga0496112_0472340_323_994 | 217 |
| 86 | 3300050509 | nmdc:mga0qj67_185735_c1 | nmdc:mga0qj67_185735_c1_628_1353 | 217 |
| 87 | 3300050509 | nmdc:mga0qj67_399875_c1 | nmdc:mga0qj67_399875_c1_81_806 | 217 |
| 88 | 3300048905 | Ga0496102_0477614 | Ga0496102_0477614_335_1009 | 218 |
| 89 | 3300048907 | Ga0496104_0000002 | Ga0496104_0000002_636525_637208 | 218 |
| 90 | 3300048908 | Ga0496105_0000001 | Ga0496105_0000001_690971_691654 | 218 |
| 91 | 3300048922 | Ga0496119_0081795 | Ga0496119_0081795_46_729 | 218 |
| 92 | 3300035725 | Ga0373947_0045908 | Ga0373947_0045908_680_1384 | 219 |
| 93 | 3300046517 | Ga0495630_0529430 | Ga0495630_0529430_142_846 | 219 |
| 94 | 3300046683 | Ga0495658_0275620 | Ga0495658_0275620_310_1014 | 219 |
| 95 | 3300050509 | nmdc:mga0qj67_50635_c1 | nmdc:mga0qj67_50635_c1_1352_2122 | 219 |
| 96 | 3300005937 | Ga0081455_10067172 | Ga0081455_100671722 | 220 |
| 97 | 3300048909 | Ga0496106_0000864 | Ga0496106_0000864_12647_13309 | 220 |
| 98 | 3300048910 | Ga0496107_0072361 | Ga0496107_0072361_543_1205 | 220 |
| 99 | 3300005365 | Ga0070688_100499481 | Ga0070688_1004994811 | 222 |
| 100 | 3300014968 | Ga0157379_10182059 | Ga0157379_101820592 | 222 |
| 101 | 3300036401 | Ga0373937_0005061 | Ga0373937_0005061_3010_3681 | 222 |
| 102 | 3300041512 | Ga0451853_1691717 | Ga0451853_1691717_136_807 | 222 |
| 103 | 3300046511 | Ga0495608_0123565 | Ga0495608_0123565_516_1187 | 222 |
| 104 | 3300046516 | Ga0495628_0068302 | Ga0495628_0068302_120_791 | 222 |
| 105 | 3300046516 | Ga0495628_0290337 | Ga0495628_0290337_52_723 | 222 |
| 106 | 3300047317 | Ga0495604_0228279 | Ga0495604_0228279_419_1090 | 222 |
| 107 | 3300047321 | Ga0495676_0282883 | Ga0495676_0282883_37_705 | 222 |
| 108 | 3300053085 | Ga0495619_0001132 | Ga0495619_0001132_13776_14447 | 222 |
| 109 | 3300053085 | Ga0495619_0005740 | Ga0495619_0005740_3822_4493 | 222 |
| 110 | 3300005356 | Ga0070674_100000025 | Ga0070674_10000002572 | 223 |
| 111 | 3300005364 | Ga0070673_100002128 | Ga0070673_1000021287 | 223 |
| 112 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001105 | 223 |
| 113 | 3300005843 | Ga0068860_100014975 | Ga0068860_1000149755 | 223 |
| 114 | 3300025899 | Ga0207642_10000006 | Ga0207642_10000006108 | 223 |
| 115 | 3300025899 | Ga0207642_10000007 | Ga0207642_10000007127 | 223 |
| 116 | 3300025937 | Ga0207669_10000009 | Ga0207669_10000009104 | 223 |
| 117 | 3300025960 | Ga0207651_10001164 | Ga0207651_1000116410 | 223 |
| 118 | 3300028381 | Ga0268264_10002246 | Ga0268264_100022465 | 223 |
| 119 | 3300005459 | Ga0068867_100000890 | Ga0068867_1000008907 | 224 |
| 120 | 3300005535 | Ga0070684_100002537 | Ga0070684_1000025376 | 224 |
| 121 | 3300006048 | Ga0075363_100017515 | Ga0075363_1000175153 | 224 |
| 122 | 3300006051 | Ga0075364_10031633 | Ga0075364_100316335 | 224 |
| 123 | 3300006051 | Ga0075364_10263908 | Ga0075364_102639082 | 224 |
| 124 | 3300006178 | Ga0075367_10152663 | Ga0075367_101526632 | 224 |
| 125 | 3300014326 | Ga0157380_10000138 | Ga0157380_1000013811 | 224 |
| 126 | 3300014968 | Ga0157379_10038288 | Ga0157379_100382883 | 224 |
| 127 | 3300026089 | Ga0207648_10004004 | Ga0207648_100040047 | 224 |
| 128 | 3300031691 | Ga0316579_10054915 | Ga0316579_100549152 | 224 |
| 129 | 3300036647 | Ga0316582_0159839 | Ga0316582_0159839_248_961 | 224 |
| 130 | 3300046473 | Ga0495582_0000027 | Ga0495582_0000027_5272_5949 | 224 |
| 131 | 3300046523 | Ga0495644_0006018 | Ga0495644_0006018_574_1251 | 224 |
| 132 | 3300046529 | Ga0495652_0593786 | Ga0495652_0593786_30_704 | 224 |
| 133 | 3300046537 | Ga0495598_0005069 | Ga0495598_0005069_418_1095 | 224 |
| 134 | 3300046683 | Ga0495658_0000025 | Ga0495658_0000025_5272_5949 | 224 |
| 135 | 3300048917 | Ga0496114_0504474 | Ga0496114_0504474_384_1058 | 224 |
| 136 | 3300048918 | Ga0496115_0019660 | Ga0496115_0019660_803_1477 | 224 |
| 137 | 3300049591 | Ga0501075_0000407 | Ga0501075_0000407_14515_15192 | 224 |
| 138 | 3300050491 | nmdc:mga00v17_211909_c1 | nmdc:mga00v17_211909_c1_425_1138 | 224 |
| 139 | 3300050491 | nmdc:mga00v17_5612_c1 | nmdc:mga00v17_5612_c1_1624_2337 | 224 |
| 140 | 3300050492 | nmdc:mga0yw44_96376_c1 | nmdc:mga0yw44_96376_c1_330_1043 | 224 |
| 141 | 3300053077 | Ga0495601_0008176 | Ga0495601_0008176_151_825 | 224 |
| 142 | 3300005327 | Ga0070658_10087323 | Ga0070658_100873232 | 225 |
| 143 | 3300005329 | Ga0070683_100088251 | Ga0070683_1000882512 | 225 |
| 144 | 3300005333 | Ga0070677_10000001 | Ga0070677_1000000150 | 225 |
| 145 | 3300005337 | Ga0070682_100000028 | Ga0070682_10000002851 | 225 |
| 146 | 3300005338 | Ga0068868_100040254 | Ga0068868_1000402544 | 225 |
| 147 | 3300005339 | Ga0070660_100018927 | Ga0070660_1000189273 | 225 |
| 148 | 3300005340 | Ga0070689_100337149 | Ga0070689_1003371492 | 225 |
| 149 | 3300005345 | Ga0070692_10045860 | Ga0070692_100458602 | 225 |
| 150 | 3300005347 | Ga0070668_100010364 | Ga0070668_1000103642 | 225 |
| 151 | 3300005353 | Ga0070669_100070569 | Ga0070669_1000705692 | 225 |
| 152 | 3300005354 | Ga0070675_100143929 | Ga0070675_1001439292 | 225 |
| 153 | 3300005356 | Ga0070674_100185849 | Ga0070674_1001858492 | 225 |
| 154 | 3300005364 | Ga0070673_100115224 | Ga0070673_1001152243 | 225 |
| 155 | 3300005365 | Ga0070688_100081195 | Ga0070688_1000811951 | 225 |
| 156 | 3300005366 | Ga0070659_100067059 | Ga0070659_1000670593 | 225 |
| 157 | 3300005367 | Ga0070667_100313578 | Ga0070667_1003135782 | 225 |
| 158 | 3300005445 | Ga0070708_100126852 | Ga0070708_1001268522 | 225 |
| 159 | 3300005455 | Ga0070663_100006755 | Ga0070663_1000067552 | 225 |
| 160 | 3300005458 | Ga0070681_10110113 | Ga0070681_101101132 | 225 |
| 161 | 3300005458 | Ga0070681_10239779 | Ga0070681_102397792 | 225 |
| 162 | 3300005459 | Ga0068867_100052816 | Ga0068867_1000528162 | 225 |
| 163 | 3300005466 | Ga0070685_10012296 | Ga0070685_100122964 | 225 |
| 164 | 3300005467 | Ga0070706_100015108 | Ga0070706_1000151088 | 225 |
| 165 | 3300005467 | Ga0070706_100260244 | Ga0070706_1002602442 | 225 |
| 166 | 3300005468 | Ga0070707_100317208 | Ga0070707_1003172081 | 225 |
| 167 | 3300005468 | Ga0070707_100442087 | Ga0070707_1004420872 | 225 |
| 168 | 3300005471 | Ga0070698_100052337 | Ga0070698_1000523371 | 225 |
| 169 | 3300005471 | Ga0070698_100077966 | Ga0070698_1000779663 | 225 |
| 170 | 3300005518 | Ga0070699_100240257 | Ga0070699_1002402572 | 225 |
| 171 | 3300005530 | Ga0070679_100003822 | Ga0070679_10000382213 | 225 |
| 172 | 3300005535 | Ga0070684_100053740 | Ga0070684_1000537402 | 225 |
| 173 | 3300005539 | Ga0068853_100214702 | Ga0068853_1002147022 | 225 |
| 174 | 3300005544 | Ga0070686_100024000 | Ga0070686_1000240005 | 225 |
| 175 | 3300005548 | Ga0070665_100000202 | Ga0070665_10000020279 | 225 |
| 176 | 3300005548 | Ga0070665_100324937 | Ga0070665_1003249372 | 225 |
| 177 | 3300005549 | Ga0070704_100808389 | Ga0070704_1008083891 | 225 |
| 178 | 3300005564 | Ga0070664_100013209 | Ga0070664_1000132094 | 225 |
| 179 | 3300005577 | Ga0068857_100152713 | Ga0068857_1001527132 | 225 |
| 180 | 3300005578 | Ga0068854_100056517 | Ga0068854_1000565173 | 225 |
| 181 | 3300005614 | Ga0068856_100064628 | Ga0068856_1000646283 | 225 |
| 182 | 3300005614 | Ga0068856_100378232 | Ga0068856_1003782322 | 225 |
| 183 | 3300005616 | Ga0068852_100030322 | Ga0068852_1000303224 | 225 |
| 184 | 3300005617 | Ga0068859_100289450 | Ga0068859_1002894502 | 225 |
| 185 | 3300005841 | Ga0068863_100000004 | Ga0068863_100000004201 | 225 |
| 186 | 3300005842 | Ga0068858_100000012 | Ga0068858_10000001213 | 225 |
| 187 | 3300005843 | Ga0068860_100113465 | Ga0068860_1001134653 | 225 |
| 188 | 3300006038 | Ga0075365_10006941 | Ga0075365_100069418 | 225 |
| 189 | 3300006048 | Ga0075363_100000723 | Ga0075363_10000072311 | 225 |
| 190 | 3300006048 | Ga0075363_100249415 | Ga0075363_1002494152 | 225 |
| 191 | 3300006051 | Ga0075364_10382892 | Ga0075364_103828921 | 225 |
| 192 | 3300006844 | Ga0075428_100033472 | Ga0075428_1000334725 | 225 |
| 193 | 3300006844 | Ga0075428_100042699 | Ga0075428_1000426992 | 225 |
| 194 | 3300006846 | Ga0075430_100007289 | Ga0075430_1000072893 | 225 |
| 195 | 3300006847 | Ga0075431_100049678 | Ga0075431_1000496784 | 225 |
| 196 | 3300006847 | Ga0075431_100202962 | Ga0075431_1002029622 | 225 |
| 197 | 3300006852 | Ga0075433_10011661 | Ga0075433_100116615 | 225 |
| 198 | 3300006871 | Ga0075434_100025970 | Ga0075434_1000259706 | 225 |
| 199 | 3300006880 | Ga0075429_100022860 | Ga0075429_1000228603 | 225 |
| 200 | 3300006880 | Ga0075429_100255718 | Ga0075429_1002557183 | 225 |
| 201 | 3300006931 | Ga0097620_100289450 | Ga0097620_1002894502 | 225 |
| 202 | 3300007076 | Ga0075435_100002547 | Ga0075435_1000025472 | 225 |
| 203 | 3300009098 | Ga0105245_10012932 | Ga0105245_100129322 | 225 |
| 204 | 3300009098 | Ga0105245_10101602 | Ga0105245_101016022 | 225 |
| 205 | 3300009147 | Ga0114129_10097292 | Ga0114129_100972923 | 225 |
| 206 | 3300009147 | Ga0114129_10149380 | Ga0114129_101493803 | 225 |
| 207 | 3300009148 | Ga0105243_10016010 | Ga0105243_100160105 | 225 |
| 208 | 3300013102 | Ga0157371_10282698 | Ga0157371_102826982 | 225 |
| 209 | 3300013307 | Ga0157372_10082172 | Ga0157372_100821722 | 225 |
| 210 | 3300014326 | Ga0157380_10021108 | Ga0157380_100211082 | 225 |
| 211 | 3300025901 | Ga0207688_10005550 | Ga0207688_100055507 | 225 |
| 212 | 3300025912 | Ga0207707_10089185 | Ga0207707_100891854 | 225 |
| 213 | 3300025917 | Ga0207660_10178259 | Ga0207660_101782591 | 225 |
| 214 | 3300025918 | Ga0207662_10119485 | Ga0207662_101194852 | 225 |
| 215 | 3300025919 | Ga0207657_10003401 | Ga0207657_100034013 | 225 |
| 216 | 3300025920 | Ga0207649_10087576 | Ga0207649_100875762 | 225 |
| 217 | 3300025921 | Ga0207652_10000549 | Ga0207652_1000054929 | 225 |
| 218 | 3300025922 | Ga0207646_10410359 | Ga0207646_104103592 | 225 |
| 219 | 3300025923 | Ga0207681_10203969 | Ga0207681_102039692 | 225 |
| 220 | 3300025926 | Ga0207659_10098726 | Ga0207659_100987262 | 225 |
| 221 | 3300025927 | Ga0207687_10000055 | Ga0207687_1000005550 | 225 |
| 222 | 3300025927 | Ga0207687_10068583 | Ga0207687_100685832 | 225 |
| 223 | 3300025932 | Ga0207690_10019712 | Ga0207690_100197124 | 225 |
| 224 | 3300025933 | Ga0207706_10067516 | Ga0207706_100675164 | 225 |
| 225 | 3300025938 | Ga0207704_10149606 | Ga0207704_101496062 | 225 |
| 226 | 3300025940 | Ga0207691_10050678 | Ga0207691_100506785 | 225 |
| 227 | 3300025944 | Ga0207661_10100260 | Ga0207661_101002603 | 225 |
| 228 | 3300025945 | Ga0207679_10071739 | Ga0207679_100717392 | 225 |
| 229 | 3300025960 | Ga0207651_10100173 | Ga0207651_101001733 | 225 |
| 230 | 3300025972 | Ga0207668_10131487 | Ga0207668_101314872 | 225 |
| 231 | 3300025981 | Ga0207640_10217197 | Ga0207640_102171972 | 225 |
| 232 | 3300026023 | Ga0207677_10024895 | Ga0207677_100248955 | 225 |
| 233 | 3300026035 | Ga0207703_10000740 | Ga0207703_1000074023 | 225 |
| 234 | 3300026041 | Ga0207639_10177487 | Ga0207639_101774872 | 225 |
| 235 | 3300026041 | Ga0207639_10404463 | Ga0207639_104044631 | 225 |
| 236 | 3300026067 | Ga0207678_10001712 | Ga0207678_1000171213 | 225 |
| 237 | 3300026078 | Ga0207702_10048161 | Ga0207702_100481613 | 225 |
| 238 | 3300026078 | Ga0207702_10450236 | Ga0207702_104502362 | 225 |
| 239 | 3300026088 | Ga0207641_10000170 | Ga0207641_1000017052 | 225 |
| 240 | 3300026089 | Ga0207648_10057082 | Ga0207648_100570824 | 225 |
| 241 | 3300026116 | Ga0207674_10207781 | Ga0207674_102077813 | 225 |
| 242 | 3300026142 | Ga0207698_10048915 | Ga0207698_100489154 | 225 |
| 243 | 3300028379 | Ga0268266_10000020 | Ga0268266_10000020170 | 225 |
| 244 | 3300028381 | Ga0268264_10085516 | Ga0268264_100855163 | 225 |
| 245 | 3300031901 | Ga0307406_10345886 | Ga0307406_103458861 | 225 |
| 246 | 3300035724 | Ga0373933_0310144 | Ga0373933_0310144_219_896 | 225 |
| 247 | 3300041512 | Ga0451853_0400745 | Ga0451853_0400745_368_1045 | 225 |
| 248 | 3300046455 | Ga0495603_0010100 | Ga0495603_0010100_3937_4614 | 225 |
| 249 | 3300046461 | Ga0495641_0000003 | Ga0495641_0000003_97171_97848 | 225 |
| 250 | 3300046516 | Ga0495628_0108198 | Ga0495628_0108198_927_1604 | 225 |
| 251 | 3300046535 | Ga0495586_0001818 | Ga0495586_0001818_514_1191 | 225 |
| 252 | 3300046543 | Ga0495645_0054811 | Ga0495645_0054811_86_763 | 225 |
| 253 | 3300046678 | Ga0495599_0001330 | Ga0495599_0001330_9692_10369 | 225 |
| 254 | 3300046694 | Ga0495649_0001198 | Ga0495649_0001198_6640_7317 | 225 |
| 255 | 3300047317 | Ga0495604_0000038 | Ga0495604_0000038_61505_62185 | 225 |
| 256 | 3300047321 | Ga0495676_0001619 | Ga0495676_0001619_3679_4356 | 225 |
| 257 | 3300047322 | Ga0495680_0000196 | Ga0495680_0000196_30236_30913 | 225 |
| 258 | 3300047446 | Ga0495679_009301 | Ga0495679_009301_3034_3711 | 225 |
| 259 | 3300048088 | Ga0495602_0176738 | Ga0495602_0176738_451_1128 | 225 |
| 260 | 3300048909 | Ga0496106_0206862 | Ga0496106_0206862_726_1445 | 225 |
| 261 | 3300048911 | Ga0496108_0137743 | Ga0496108_0137743_718_1437 | 225 |
| 262 | 3300048912 | Ga0496109_0040501 | Ga0496109_0040501_1793_2512 | 225 |
| 263 | 3300048914 | Ga0496111_0059564 | Ga0496111_0059564_1126_1845 | 225 |
| 264 | 3300048916 | Ga0496113_0774144 | Ga0496113_0774144_13_735 | 225 |
| 265 | 3300049571 | Ga0501034_0428014 | Ga0501034_0428014_144_866 | 225 |
| 266 | 3300049583 | Ga0501067_0235097 | Ga0501067_0235097_24_746 | 225 |
| 267 | 3300049585 | Ga0501069_0042364 | Ga0501069_0042364_737_1459 | 225 |
| 268 | 3300049586 | Ga0501070_0023865 | Ga0501070_0023865_3565_4287 | 225 |
| 269 | 3300049586 | Ga0501070_0129765 | Ga0501070_0129765_649_1371 | 225 |
| 270 | 3300049586 | Ga0501070_0304297 | Ga0501070_0304297_281_1003 | 225 |
| 271 | 3300049587 | Ga0501071_0658936 | Ga0501071_0658936_17_739 | 225 |
| 272 | 3300049588 | Ga0501072_0229052 | Ga0501072_0229052_480_1202 | 225 |
| 273 | 3300049589 | Ga0501073_0114559 | Ga0501073_0114559_918_1640 | 225 |
| 274 | 3300049590 | Ga0501074_0047968 | Ga0501074_0047968_886_1608 | 225 |
| 275 | 3300049742 | Ga0501080_0127403 | Ga0501080_0127403_787_1509 | 225 |
| 276 | 3300050491 | nmdc:mga00v17_132493_c1 | nmdc:mga00v17_132493_c1_656_1387 | 225 |
| 277 | 3300050492 | nmdc:mga0yw44_68440_c1 | nmdc:mga0yw44_68440_c1_980_1711 | 225 |
| 278 | 3300050507 | nmdc:mga05p37_130469_c1 | nmdc:mga05p37_130469_c1_1610_2332 | 225 |
| 279 | 3300050507 | nmdc:mga05p37_720560_c1 | nmdc:mga05p37_720560_c1_16_738 | 225 |
| 280 | 3300050508 | nmdc:mga09592_14275_c1 | nmdc:mga09592_14275_c1_1941_2663 | 225 |
| 281 | 3300050508 | nmdc:mga09592_250381_c1 | nmdc:mga09592_250381_c1_200_922 | 225 |
| 282 | 3300050509 | nmdc:mga0qj67_81010_c1 | nmdc:mga0qj67_81010_c1_131_853 | 225 |
| 283 | 3300050510 | nmdc:mga06r32_37032_c1 | nmdc:mga06r32_37032_c1_2841_3563 | 225 |
| 284 | 3300050510 | nmdc:mga06r32_9622_c1 | nmdc:mga06r32_9622_c1_5960_6682 | 225 |
| 285 | 3300050512 | nmdc:mga0n895_89583_c1 | nmdc:mga0n895_89583_c1_1006_1728 | 225 |
| 286 | 3300050513 | nmdc:mga0rr50_11376_c1 | nmdc:mga0rr50_11376_c1_1120_1842 | 225 |
| 287 | 3300053077 | Ga0495601_0000072 | Ga0495601_0000072_36355_37032 | 225 |
| 288 | 3300053078 | Ga0495612_0000614 | Ga0495612_0000614_246_923 | 225 |
| 289 | 3300053123 | Ga0500614_000270 | Ga0500614_000270_3621_4298 | 225 |
| 290 | 3300003320 | rootH2_10166254 | rootH2_101662542 | 226 |
| 291 | 3300001979 | JGI24740J21852_10006656 | JGI24740J21852_100066565 | 227 |
| 292 | 3300005367 | Ga0070667_100054954 | Ga0070667_1000549544 | 227 |
| 293 | 3300005548 | Ga0070665_100046449 | Ga0070665_1000464494 | 227 |
| 294 | 3300005843 | Ga0068860_100039787 | Ga0068860_1000397872 | 227 |
| 295 | 3300005844 | Ga0068862_100003740 | Ga0068862_1000037402 | 227 |
| 296 | 3300005937 | Ga0081455_10036449 | Ga0081455_100364493 | 227 |
| 297 | 3300009553 | Ga0105249_10026492 | Ga0105249_100264923 | 227 |
| 298 | 3300014325 | Ga0163163_10387359 | Ga0163163_103873592 | 227 |
| 299 | 3300014968 | Ga0157379_10049376 | Ga0157379_100493764 | 227 |
| 300 | 3300025961 | Ga0207712_10026797 | Ga0207712_100267973 | 227 |
| 301 | 3300025986 | Ga0207658_10051677 | Ga0207658_100516772 | 227 |
| 302 | 3300028379 | Ga0268266_10031260 | Ga0268266_100312602 | 227 |
| 303 | 3300028380 | Ga0268265_10012238 | Ga0268265_100122382 | 227 |
| 304 | 3300047320 | Ga0495672_0282219 | Ga0495672_0282219_17_700 | 227 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dz2-assembly1.cif.gz_C | crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1h-1,2,3-triazol-4-yl)propyl)thio)methyl)pyrrolidin-3-ol | 0.8661 | 43 | 226 |
| 5f7o-assembly1.cif.gz_A | crystal structure of mutant q289l of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine | 0.8444 | 31 | 226 |
| 6dz2-assembly1.cif.gz_B | crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with (3r,4s)-1-((4-amino-5h-pyrrolo[3,2-d]pyrimidin-7-yl)methyl)-4-(((3-(1-benzyl-1h-1,2,3-triazol-4-yl)propyl)thio)methyl)pyrrolidin-3-ol | 0.8417 | 29 | 226 |
| 5tc5-assembly1.cif.gz_B | crystal structure of human 5'-deoxy-5'-methylthioadenosine phosphorylase in complex with butylthio-dadme-immucillin-a and chloride | 0.8402 | 29 | 226 |
| 5f7j-assembly1.cif.gz_A | crystal structure of mutant n87t of adenosine/methylthioadenosine phosphorylase from schistosoma mansoni in complex with adenine | 0.8386 | 31 | 226 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8IMU4_17_289_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8579 | 29 | 226 | 3.40.50.1580 |
| 5f7oA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8444 | 31 | 226 | 3.40.50.1580 |
| 3t94A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8379 | 2 | 227 | 3.40.50.1580 |
| 3t94A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.831 | 2 | 227 | 3.40.50.1580 |
| af_Q09438_1_274_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.8263 | 1 | 226 | 3.40.50.1580 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838V6D2-F1-model_v4 | MTAP family purine nucleoside phosphorylase | 0.9665 | 1 | 227 |
GO:0005829
GO:0009116 GO:0017061 GO:0019509 |
| AF-A0A838V6D2-F1-model_v4 | MTAP family purine nucleoside phosphorylase | 0.9623 | 1 | 227 |
GO:0005829
GO:0009116 GO:0017061 GO:0019509 |
| AF-W2Y906-F1-model_v4 | Nucleoside phosphorylase domain-containing protein | 0.9515 | 75 | 222 |
GO:0005829
GO:0006166 GO:0017061 GO:0019509 |
| AF-A0A662L897-F1-model_v4 | 6-oxopurine nucleoside phosphorylase | 0.951 | 29 | 222 |
GO:0005829
GO:0009116 GO:0017061 GO:0019509 |
| AF-A0A2N2LTL4-F1-model_v4 | Nucleoside phosphorylase domain-containing protein | 0.9488 | 34 | 215 |
GO:0005829
GO:0009116 GO:0017061 GO:0019509 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar