F397458
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 304 | 158 | 304 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300005471|Ga0070698_100000063|Ga0070698_10000006325 |
| Length | 171 |
| Sequence | MDQWLEDFKQTIDSATPRLLQISEAQSEKPRSEDHWSAKQIIGHLIDSATNNHARFVLGQIKDDLIFPGYEQNRWVEINHYQQAPWSQLVDLWRAYNLHLLHVMSHADPHKMNNRCAQHSLQTIAFETISESKTATLEYLMKDYVVHLKHHLSQILESAAETDHAGESASN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001426 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 | Metagenome | Rhizosphere |
| 2 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 107 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 112 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 113 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 114 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 115 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 116 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 117 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 122 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 123 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 124 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 125 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.66 |
| Rhizosphere | 99.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24030J14995_100112 | 3300001426 | Bacteria | 1969 |
| 2 | JGI24034J14986_101297 | 3300001432 | Unclassified | 1451 |
| 3 | JGI24748J21848_1000001 | 3300002074 | Bacteria | 444271 |
| 4 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 5 | JGI25406J46586_10017323 | 3300003203 | Bacteria | 2982 |
| 6 | Ga0065704_10451392 | 3300005289 | Unclassified | 705 |
| 7 | Ga0065715_10496410 | 3300005293 | Unclassified | 783 |
| 8 | Ga0065715_10521973 | 3300005293 | Unclassified | 749 |
| 9 | Ga0065707_10084507 | 3300005295 | Bacteria | 7130 |
| 10 | Ga0065707_10191752 | 3300005295 | Bacteria | 1357 |
| 11 | Ga0070676_10283375 | 3300005328 | Bacteria | 1117 |
| 12 | Ga0070690_100071973 | 3300005330 | Bacteria | 2247 |
| 13 | Ga0068869_100261306 | 3300005334 | Bacteria | 1386 |
| 14 | Ga0070689_100367016 | 3300005340 | Unclassified | 1211 |
| 15 | Ga0070691_10829752 | 3300005341 | Unclassified | 565 |
| 16 | Ga0070687_100043858 | 3300005343 | Bacteria | 2276 |
| 17 | Ga0070692_10250874 | 3300005345 | Bacteria | 1059 |
| 18 | Ga0070669_100129282 | 3300005353 | Bacteria | 1936 |
| 19 | Ga0070675_100170986 | 3300005354 | Unclassified | 1874 |
| 20 | Ga0070671_100311708 | 3300005355 | Unclassified | 1340 |
| 21 | Ga0070671_101069089 | 3300005355 | Bacteria | 708 |
| 22 | Ga0070673_100346254 | 3300005364 | Unclassified | 1318 |
| 23 | Ga0070667_101386974 | 3300005367 | Unclassified | 659 |
| 24 | Ga0070703_10000049 | 3300005406 | Bacteria | 58073 |
| 25 | Ga0070703_10026830 | 3300005406 | Bacteria | 1714 |
| 26 | Ga0070710_10537629 | 3300005437 | Unclassified | 805 |
| 27 | Ga0070710_10634778 | 3300005437 | Unclassified | 747 |
| 28 | Ga0070701_10031103 | 3300005438 | Bacteria | 2647 |
| 29 | Ga0070711_100794116 | 3300005439 | Unclassified | 802 |
| 30 | Ga0070705_100202257 | 3300005440 | Bacteria | 1363 |
| 31 | Ga0070700_100001704 | 3300005441 | Bacteria | 11035 |
| 32 | Ga0070700_100241365 | 3300005441 | Bacteria | 1291 |
| 33 | Ga0070694_100005491 | 3300005444 | Bacteria | 7680 |
| 34 | Ga0070694_100052430 | 3300005444 | Bacteria | 2757 |
| 35 | Ga0070694_100067224 | 3300005444 | Bacteria | 2460 |
| 36 | Ga0070694_100134087 | 3300005444 | Bacteria | 1793 |
| 37 | Ga0070694_100293348 | 3300005444 | Unclassified | 1244 |
| 38 | Ga0070694_100318533 | 3300005444 | Unclassified | 1196 |
| 39 | Ga0070694_100759151 | 3300005444 | Bacteria | 792 |
| 40 | Ga0070694_101092993 | 3300005444 | Unclassified | 665 |
| 41 | Ga0070708_100435736 | 3300005445 | Bacteria | 1236 |
| 42 | Ga0070708_100478218 | 3300005445 | Bacteria | 1175 |
| 43 | Ga0070708_101187212 | 3300005445 | Bacteria | 714 |
| 44 | Ga0070681_10375111 | 3300005458 | Bacteria | 1333 |
| 45 | Ga0068867_100475672 | 3300005459 | Bacteria | 1069 |
| 46 | Ga0068867_101804662 | 3300005459 | Unclassified | 575 |
| 47 | Ga0070706_100134623 | 3300005467 | Bacteria | 2307 |
| 48 | Ga0070706_100324028 | 3300005467 | Bacteria | 1437 |
| 49 | Ga0070706_100462704 | 3300005467 | Bacteria | 1180 |
| 50 | Ga0070707_100000107 | 3300005468 | Bacteria | 76101 |
| 51 | Ga0070707_100003181 | 3300005468 | Bacteria | 15534 |
| 52 | Ga0070707_100049227 | 3300005468 | Unclassified | 4039 |
| 53 | Ga0070707_100085947 | 3300005468 | Bacteria | 3041 |
| 54 | Ga0070707_100104089 | 3300005468 | Bacteria | 2751 |
| 55 | Ga0070707_101079124 | 3300005468 | Unclassified | 769 |
| 56 | Ga0070707_101673149 | 3300005468 | Bacteria | 603 |
| 57 | Ga0070707_102004131 | 3300005468 | Unclassified | 546 |
| 58 | Ga0070698_100000063 | 3300005471 | Bacteria | 78062 |
| 59 | Ga0070698_100058886 | 3300005471 | Unclassified | 3882 |
| 60 | Ga0070698_100074006 | 3300005471 | Bacteria | 3412 |
| 61 | Ga0070698_100109499 | 3300005471 | Bacteria | 2729 |
| 62 | Ga0070698_100146747 | 3300005471 | Unclassified | 2308 |
| 63 | Ga0070698_100212472 | 3300005471 | Bacteria | 1869 |
| 64 | Ga0070698_100227677 | 3300005471 | Bacteria | 1798 |
| 65 | Ga0070698_100931300 | 3300005471 | Unclassified | 815 |
| 66 | Ga0070698_101055993 | 3300005471 | Bacteria | 760 |
| 67 | Ga0070699_100128227 | 3300005518 | Bacteria | 2235 |
| 68 | Ga0070699_100180760 | 3300005518 | Bacteria | 1872 |
| 69 | Ga0070699_100436830 | 3300005518 | Bacteria | 1186 |
| 70 | Ga0070699_101623213 | 3300005518 | Unclassified | 592 |
| 71 | Ga0070697_100016574 | 3300005536 | Bacteria | 5797 |
| 72 | Ga0070697_100044328 | 3300005536 | Bacteria | 3602 |
| 73 | Ga0070697_100759141 | 3300005536 | Bacteria | 857 |
| 74 | Ga0070672_100432377 | 3300005543 | Unclassified | 1132 |
| 75 | Ga0070686_100023684 | 3300005544 | Bacteria | 3673 |
| 76 | Ga0070686_100088003 | 3300005544 | Bacteria | 2072 |
| 77 | Ga0070686_100189730 | 3300005544 | Bacteria | 1466 |
| 78 | Ga0070686_101181550 | 3300005544 | Unclassified | 635 |
| 79 | Ga0070695_100119583 | 3300005545 | Bacteria | 1800 |
| 80 | Ga0070695_100145002 | 3300005545 | Bacteria | 1651 |
| 81 | Ga0070695_101027642 | 3300005545 | Unclassified | 671 |
| 82 | Ga0070696_100525297 | 3300005546 | Bacteria | 945 |
| 83 | Ga0070696_100621991 | 3300005546 | Bacteria | 873 |
| 84 | Ga0070693_100098482 | 3300005547 | Bacteria | 1777 |
| 85 | Ga0070704_100000588 | 3300005549 | Bacteria | 17506 |
| 86 | Ga0070704_100077876 | 3300005549 | Bacteria | 2430 |
| 87 | Ga0070704_100415046 | 3300005549 | Bacteria | 1152 |
| 88 | Ga0070704_100617621 | 3300005549 | Bacteria | 954 |
| 89 | Ga0070704_101075062 | 3300005549 | Bacteria | 730 |
| 90 | Ga0068854_100089075 | 3300005578 | Unclassified | 2293 |
| 91 | Ga0068859_100028738 | 3300005617 | Bacteria | 5574 |
| 92 | Ga0068859_100037974 | 3300005617 | Bacteria | 4833 |
| 93 | Ga0068859_100131903 | 3300005617 | Bacteria | 2570 |
| 94 | Ga0068859_100952189 | 3300005617 | Unclassified | 942 |
| 95 | Ga0068864_100276764 | 3300005618 | Bacteria | 1565 |
| 96 | Ga0068861_100048577 | 3300005719 | Bacteria | 3209 |
| 97 | Ga0068863_100362401 | 3300005841 | Unclassified | 1413 |
| 98 | Ga0068858_100000051 | 3300005842 | Bacteria | 120692 |
| 99 | Ga0068858_100108593 | 3300005842 | Bacteria | 2590 |
| 100 | Ga0068858_100147301 | 3300005842 | Bacteria | 2212 |
| 101 | Ga0068858_101501959 | 3300005842 | Unclassified | 664 |
| 102 | Ga0068862_100008314 | 3300005844 | Bacteria | 8587 |
| 103 | Ga0068862_100548437 | 3300005844 | Unclassified | 1104 |
| 104 | Ga0081539_10000666 | 3300005985 | Bacteria | 68895 |
| 105 | Ga0081539_10224887 | 3300005985 | Bacteria | 851 |
| 106 | Ga0070715_10000025 | 3300006163 | Bacteria | 107539 |
| 107 | Ga0070716_100000003 | 3300006173 | Bacteria | 312721 |
| 108 | Ga0097621_101204488 | 3300006237 | Bacteria | 713 |
| 109 | Ga0068871_100660358 | 3300006358 | Bacteria | 955 |
| 110 | Ga0075428_100529202 | 3300006844 | Bacteria | 1260 |
| 111 | Ga0075430_100004320 | 3300006846 | Bacteria | 12006 |
| 112 | Ga0075430_100078261 | 3300006846 | Bacteria | 2772 |
| 113 | Ga0075430_100088096 | 3300006846 | Bacteria | 2597 |
| 114 | Ga0075431_100007356 | 3300006847 | Bacteria | 10965 |
| 115 | Ga0075433_10053966 | 3300006852 | Bacteria | 3505 |
| 116 | Ga0075433_10652530 | 3300006852 | Bacteria | 923 |
| 117 | Ga0075434_100126206 | 3300006871 | Bacteria | 2576 |
| 118 | Ga0075434_100127124 | 3300006871 | Unclassified | 2566 |
| 119 | Ga0075434_100181967 | 3300006871 | Bacteria | 2122 |
| 120 | Ga0075434_100736261 | 3300006871 | Unclassified | 1003 |
| 121 | Ga0075434_100776382 | 3300006871 | Unclassified | 975 |
| 122 | Ga0075434_101208935 | 3300006871 | Bacteria | 768 |
| 123 | Ga0075429_100008602 | 3300006880 | Bacteria | 8878 |
| 124 | Ga0075429_100466295 | 3300006880 | Unclassified | 1106 |
| 125 | Ga0068865_100107062 | 3300006881 | Unclassified | 2056 |
| 126 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 127 | Ga0075436_100233025 | 3300006914 | Bacteria | 1308 |
| 128 | Ga0097620_100028740 | 3300006931 | Bacteria | 5574 |
| 129 | Ga0097620_100037976 | 3300006931 | Bacteria | 4833 |
| 130 | Ga0097620_100131901 | 3300006931 | Bacteria | 2570 |
| 131 | Ga0097620_100952085 | 3300006931 | Unclassified | 942 |
| 132 | Ga0075435_100005602 | 3300007076 | Bacteria | 8793 |
| 133 | Ga0075435_100562880 | 3300007076 | Bacteria | 988 |
| 134 | Ga0099794_10005067 | 3300007265 | Bacteria | 5251 |
| 135 | Ga0111539_10144414 | 3300009094 | Bacteria | 2786 |
| 136 | Ga0111539_11081560 | 3300009094 | Unclassified | 932 |
| 137 | Ga0105245_11774761 | 3300009098 | Unclassified | 670 |
| 138 | Ga0105247_10000004 | 3300009101 | Bacteria | 455497 |
| 139 | Ga0105247_10480005 | 3300009101 | Bacteria | 902 |
| 140 | Ga0114129_10143527 | 3300009147 | Bacteria | 3271 |
| 141 | Ga0105243_10000037 | 3300009148 | Bacteria | 175237 |
| 142 | Ga0105243_10000446 | 3300009148 | Bacteria | 43049 |
| 143 | Ga0105243_10257634 | 3300009148 | Unclassified | 1561 |
| 144 | Ga0105243_10406507 | 3300009148 | Bacteria | 1266 |
| 145 | Ga0105242_10001013 | 3300009176 | Bacteria | 22070 |
| 146 | Ga0105242_10003928 | 3300009176 | Bacteria | 11551 |
| 147 | Ga0105242_10365097 | 3300009176 | Bacteria | 1337 |
| 148 | Ga0105242_10845518 | 3300009176 | Unclassified | 910 |
| 149 | Ga0105248_10406121 | 3300009177 | Bacteria | 1534 |
| 150 | Ga0105248_10456400 | 3300009177 | Bacteria | 1440 |
| 151 | Ga0105248_12259484 | 3300009177 | Unclassified | 619 |
| 152 | Ga0105249_10033755 | 3300009553 | Bacteria | 4634 |
| 153 | Ga0105249_10286885 | 3300009553 | Bacteria | 1646 |
| 154 | Ga0105249_11363840 | 3300009553 | Bacteria | 781 |
| 155 | Ga0105249_11476284 | 3300009553 | Unclassified | 752 |
| 156 | Ga0105239_10043633 | 3300010375 | Bacteria | 4917 |
| 157 | Ga0105239_11861548 | 3300010375 | Bacteria | 698 |
| 158 | Ga0157371_10158129 | 3300013102 | Bacteria | 1618 |
| 159 | Ga0157378_10000004 | 3300013297 | Bacteria | 201051 |
| 160 | Ga0157378_10015793 | 3300013297 | Bacteria | 6612 |
| 161 | Ga0157378_10019632 | 3300013297 | Bacteria | 5941 |
| 162 | Ga0157378_10108589 | 3300013297 | Bacteria | 2541 |
| 163 | Ga0157378_10358843 | 3300013297 | Bacteria | 1426 |
| 164 | Ga0157378_10900130 | 3300013297 | Unclassified | 915 |
| 165 | Ga0163162_10010975 | 3300013306 | Bacteria | 8821 |
| 166 | Ga0163162_10207060 | 3300013306 | Bacteria | 2091 |
| 167 | Ga0163162_10990063 | 3300013306 | Bacteria | 950 |
| 168 | Ga0157375_10000479 | 3300013308 | Bacteria | 36426 |
| 169 | Ga0157379_10069966 | 3300014968 | Bacteria | 3139 |
| 170 | Ga0163161_10004588 | 3300017792 | Bacteria | 9613 |
| 171 | Ga0163161_10410790 | 3300017792 | Bacteria | 1087 |
| 172 | Ga0207672_1000002 | 3300025223 | Bacteria | 31879 |
| 173 | Ga0207653_10000163 | 3300025885 | Bacteria | 47337 |
| 174 | Ga0207653_10009719 | 3300025885 | Bacteria | 2999 |
| 175 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 176 | Ga0207685_10000008 | 3300025905 | Bacteria | 273136 |
| 177 | Ga0207699_10057965 | 3300025906 | Bacteria | 2315 |
| 178 | Ga0207684_10003514 | 3300025910 | Bacteria | 15286 |
| 179 | Ga0207684_10253717 | 3300025910 | Bacteria | 1517 |
| 180 | Ga0207684_10305621 | 3300025910 | Bacteria | 1371 |
| 181 | Ga0207684_10521104 | 3300025910 | Bacteria | 1018 |
| 182 | Ga0207662_10016043 | 3300025918 | Unclassified | 4222 |
| 183 | Ga0207662_10064160 | 3300025918 | Bacteria | 2209 |
| 184 | Ga0207662_10084795 | 3300025918 | Bacteria | 1939 |
| 185 | Ga0207646_10000543 | 3300025922 | Bacteria | 49799 |
| 186 | Ga0207646_10004949 | 3300025922 | Bacteria | 14244 |
| 187 | Ga0207646_10011440 | 3300025922 | Bacteria | 8598 |
| 188 | Ga0207646_10042513 | 3300025922 | Unclassified | 4082 |
| 189 | Ga0207646_10089140 | 3300025922 | Bacteria | 2761 |
| 190 | Ga0207646_11255484 | 3300025922 | Unclassified | 648 |
| 191 | Ga0207646_11474283 | 3300025922 | Unclassified | 590 |
| 192 | Ga0207644_10000179 | 3300025931 | Bacteria | 45397 |
| 193 | Ga0207686_10000003 | 3300025934 | Bacteria | 376934 |
| 194 | Ga0207686_10000127 | 3300025934 | Bacteria | 61880 |
| 195 | Ga0207686_10000965 | 3300025934 | Bacteria | 17144 |
| 196 | Ga0207686_10731715 | 3300025934 | Bacteria | 789 |
| 197 | Ga0207686_11433044 | 3300025934 | Unclassified | 569 |
| 198 | Ga0207709_10000017 | 3300025935 | Bacteria | 470753 |
| 199 | Ga0207709_10003560 | 3300025935 | Bacteria | 9208 |
| 200 | Ga0207709_10297372 | 3300025935 | Bacteria | 1199 |
| 201 | Ga0207709_10417971 | 3300025935 | Bacteria | 1029 |
| 202 | Ga0207709_10465579 | 3300025935 | Bacteria | 980 |
| 203 | Ga0207670_10365169 | 3300025936 | Unclassified | 1146 |
| 204 | Ga0207704_10072800 | 3300025938 | Unclassified | 2186 |
| 205 | Ga0207665_10000003 | 3300025939 | Bacteria | 220666 |
| 206 | Ga0207691_10707558 | 3300025940 | Bacteria | 849 |
| 207 | Ga0207689_10073696 | 3300025942 | Bacteria | 2805 |
| 208 | Ga0207651_10083005 | 3300025960 | Bacteria | 2316 |
| 209 | Ga0207651_10399521 | 3300025960 | Bacteria | 1169 |
| 210 | Ga0207712_10093283 | 3300025961 | Bacteria | 2221 |
| 211 | Ga0207712_10622255 | 3300025961 | Bacteria | 936 |
| 212 | Ga0207640_10438705 | 3300025981 | Bacteria | 1073 |
| 213 | Ga0207658_11555560 | 3300025986 | Unclassified | 605 |
| 214 | Ga0207703_10000114 | 3300026035 | Bacteria | 96051 |
| 215 | Ga0207703_10155723 | 3300026035 | Bacteria | 1996 |
| 216 | Ga0207703_10425079 | 3300026035 | Bacteria | 1237 |
| 217 | Ga0207708_10003764 | 3300026075 | Bacteria | 11175 |
| 218 | Ga0207708_10621143 | 3300026075 | Bacteria | 917 |
| 219 | Ga0207708_10812654 | 3300026075 | Bacteria | 805 |
| 220 | Ga0207641_10167637 | 3300026088 | Unclassified | 2002 |
| 221 | Ga0207641_10340009 | 3300026088 | Unclassified | 1428 |
| 222 | Ga0207648_10211489 | 3300026089 | Bacteria | 1722 |
| 223 | Ga0207676_10179495 | 3300026095 | Bacteria | 1853 |
| 224 | Ga0207676_10379037 | 3300026095 | Unclassified | 1316 |
| 225 | Ga0207675_100045308 | 3300026118 | Bacteria | 4109 |
| 226 | Ga0207675_100519333 | 3300026118 | Bacteria | 1187 |
| 227 | Ga0207428_10001780 | 3300027907 | Bacteria | 22062 |
| 228 | Ga0268265_10072698 | 3300028380 | Bacteria | 2683 |
| 229 | Ga0268265_12611582 | 3300028380 | Unclassified | 511 |
| 230 | Ga0268264_10122673 | 3300028381 | Unclassified | 2292 |
| 231 | Ga0307410_10027216 | 3300031852 | Bacteria | 3612 |
| 232 | Ga0307416_101194398 | 3300032002 | Bacteria | 866 |
| 233 | Ga0307411_10073993 | 3300032005 | Bacteria | 2320 |
| 234 | Ga0373936_0026640 | 3300035113 | Bacteria | 2264 |
| 235 | Ga0373953_0518907 | 3300035117 | Unclassified | 529 |
| 236 | Ga0373956_0107550 | 3300035119 | Bacteria | 1297 |
| 237 | Ga0373943_0006056 | 3300035170 | Bacteria | 5431 |
| 238 | Ga0373946_0009458 | 3300035171 | Bacteria | 3591 |
| 239 | Ga0373955_0008814 | 3300035172 | Bacteria | 4702 |
| 240 | Ga0373947_0009269 | 3300035725 | Bacteria | 5656 |
| 241 | Ga0373937_0231304 | 3300036401 | Unclassified | 1741 |
| 242 | Ga0373937_0616211 | 3300036401 | Bacteria | 1030 |
| 243 | Ga0373937_1101152 | 3300036401 | Unclassified | 743 |
| 244 | Ga0395905_0172119 | 3300037471 | Bacteria | 2034 |
| 245 | Ga0451577_0098499 | 3300042876 | Bacteria | 2611 |
| 246 | Ga0453683_0185042 | 3300044673 | Bacteria | 1321 |
| 247 | Ga0453684_0490336 | 3300044712 | Unclassified | 1362 |
| 248 | Ga0451576_0095940 | 3300045051 | Unclassified | 3084 |
| 249 | Ga0451576_1020669 | 3300045051 | Bacteria | 867 |
| 250 | Ga0451576_1429816 | 3300045051 | Unclassified | 719 |
| 251 | Ga0495580_0444293 | 3300046472 | Unclassified | 871 |
| 252 | Ga0495580_0579152 | 3300046472 | Unclassified | 743 |
| 253 | Ga0495608_0025785 | 3300046511 | Bacteria | 4012 |
| 254 | Ga0495628_0197385 | 3300046516 | Bacteria | 1517 |
| 255 | Ga0495630_0005097 | 3300046517 | Bacteria | 9238 |
| 256 | Ga0495630_0082283 | 3300046517 | Bacteria | 2430 |
| 257 | Ga0495640_0036447 | 3300046533 | Bacteria | 3475 |
| 258 | Ga0495598_0014643 | 3300046537 | Bacteria | 1965 |
| 259 | Ga0495621_0187321 | 3300046539 | Bacteria | 828 |
| 260 | Ga0495634_0192203 | 3300046642 | Bacteria | 1272 |
| 261 | Ga0495634_0196055 | 3300046642 | Bacteria | 1257 |
| 262 | Ga0495635_0282491 | 3300046663 | Unclassified | 1115 |
| 263 | Ga0495657_0092452 | 3300046675 | Bacteria | 1938 |
| 264 | Ga0495599_0118054 | 3300046678 | Bacteria | 1650 |
| 265 | Ga0495613_0000599 | 3300046689 | Bacteria | 29031 |
| 266 | Ga0495613_0213678 | 3300046689 | Unclassified | 1356 |
| 267 | Ga0495613_0349725 | 3300046689 | Unclassified | 1015 |
| 268 | Ga0495624_0127090 | 3300046690 | Bacteria | 1564 |
| 269 | Ga0495600_0251266 | 3300046809 | Bacteria | 1124 |
| 270 | Ga0495600_0255127 | 3300046809 | Bacteria | 1115 |
| 271 | Ga0495581_0028412 | 3300047315 | Bacteria | 3242 |
| 272 | Ga0495636_0014016 | 3300047318 | Bacteria | 3186 |
| 273 | Ga0495674_0065054 | 3300047319 | Bacteria | 3168 |
| 274 | Ga0495675_0134875 | 3300047444 | Bacteria | 1533 |
| 275 | Ga0495684_0000310 | 3300047471 | Bacteria | 39859 |
| 276 | Ga0495684_0094079 | 3300047471 | Bacteria | 2270 |
| 277 | Ga0495602_0469266 | 3300048088 | Unclassified | 885 |
| 278 | Ga0496101_0756520 | 3300048904 | Unclassified | 767 |
| 279 | Ga0496106_0001061 | 3300048909 | Bacteria | 20265 |
| 280 | nmdc:mga05p37_199802_c1 | 3300050507 | Bacteria | 2422 |
| 281 | nmdc:mga09592_57792_c1 | 3300050508 | Bacteria | 3279 |
| 282 | nmdc:mga0qj67_134307_c1 | 3300050509 | Bacteria | 2005 |
| 283 | nmdc:mga0qj67_45884_c1 | 3300050509 | Bacteria | 3448 |
| 284 | nmdc:mga0qj67_5713_c1 | 3300050509 | Bacteria | 9101 |
| 285 | nmdc:mga06r32_38885_c1 | 3300050510 | Bacteria | 4510 |
| 286 | nmdc:mga06r32_95493_c1 | 3300050510 | Bacteria | 2910 |
| 287 | nmdc:mga08y16_387161_c1 | 3300050511 | Bacteria | 1433 |
| 288 | nmdc:mga08y16_746696_c1 | 3300050511 | Unclassified | 975 |
| 289 | nmdc:mga0n895_1138939_c1 | 3300050512 | Unclassified | 756 |
| 290 | nmdc:mga0n895_180557_c1 | 3300050512 | Bacteria | 2142 |
| 291 | nmdc:mga0n895_733951_c1 | 3300050512 | Bacteria | 982 |
| 292 | nmdc:mga0n895_8996_c1 | 3300050512 | Bacteria | 8705 |
| 293 | nmdc:mga0rr50_3767_c1 | 3300050513 | Bacteria | 8793 |
| 294 | nmdc:mga0rr50_995962_c1 | 3300050513 | Unclassified | 714 |
| 295 | nmdc:mga08x19_279000_c1 | 3300050514 | Unclassified | 1157 |
| 296 | nmdc:mga08x19_696326_c1 | 3300050514 | Bacteria | 721 |
| 297 | nmdc:mga08x19_9_c1 | 3300050514 | Bacteria | 418852 |
| 298 | nmdc:mga0a205_120621_c1 | 3300050515 | Bacteria | 2521 |
| 299 | nmdc:mga0a205_172244_c1 | 3300050515 | Bacteria | 1022 |
| 300 | nmdc:mga0a205_96516_c1 | 3300050515 | Bacteria | 2855 |
| 301 | Ga0495612_0115744 | 3300053078 | Bacteria | 1151 |
| 302 | Ga0495595_0048143 | 3300053084 | Bacteria | 1968 |
| 303 | Ga0495619_0009340 | 3300053085 | Bacteria | 6190 |
| 304 | Ga0495619_0178323 | 3300053085 | Bacteria | 1470 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_1101152 | Ga0373937_1101152_42_431 | 129 |
| 2 | 3300046472 | Ga0495580_0444293 | Ga0495580_0444293_469_858 | 129 |
| 3 | 3300005328 | Ga0070676_10283375 | Ga0070676_102833752 | 138 |
| 4 | 3300006881 | Ga0068865_100107062 | Ga0068865_1001070624 | 138 |
| 5 | 3300025935 | Ga0207709_10297372 | Ga0207709_102973722 | 138 |
| 6 | 3300025938 | Ga0207704_10072800 | Ga0207704_100728004 | 138 |
| 7 | 3300005468 | Ga0070707_100000107 | Ga0070707_10000010761 | 143 |
| 8 | 3300025922 | Ga0207646_10000543 | Ga0207646_1000054321 | 143 |
| 9 | 3300006871 | Ga0075434_100776382 | Ga0075434_1007763822 | 144 |
| 10 | 3300009147 | Ga0114129_10143527 | Ga0114129_101435272 | 144 |
| 11 | 3300050507 | nmdc:mga05p37_199802_c1 | nmdc:mga05p37_199802_c1_1247_1729 | 144 |
| 12 | 3300050515 | nmdc:mga0a205_120621_c1 | nmdc:mga0a205_120621_c1_1454_1936 | 144 |
| 13 | 3300005471 | Ga0070698_100212472 | Ga0070698_1002124722 | 145 |
| 14 | 3300005439 | Ga0070711_100794116 | Ga0070711_1007941162 | 147 |
| 15 | 3300005458 | Ga0070681_10375111 | Ga0070681_103751112 | 147 |
| 16 | 3300035113 | Ga0373936_0026640 | Ga0373936_0026640_77_547 | 147 |
| 17 | 3300035117 | Ga0373953_0518907 | Ga0373953_0518907_58_519 | 147 |
| 18 | 3300035119 | Ga0373956_0107550 | Ga0373956_0107550_109_567 | 147 |
| 19 | 3300035170 | Ga0373943_0006056 | Ga0373943_0006056_2417_2887 | 147 |
| 20 | 3300035171 | Ga0373946_0009458 | Ga0373946_0009458_847_1317 | 147 |
| 21 | 3300035172 | Ga0373955_0008814 | Ga0373955_0008814_4192_4650 | 147 |
| 22 | 3300035725 | Ga0373947_0009269 | Ga0373947_0009269_4543_5013 | 147 |
| 23 | 3300036401 | Ga0373937_0231304 | Ga0373937_0231304_1014_1484 | 147 |
| 24 | 3300036401 | Ga0373937_0616211 | Ga0373937_0616211_436_897 | 147 |
| 25 | 3300046472 | Ga0495580_0579152 | Ga0495580_0579152_254_706 | 147 |
| 26 | 3300046511 | Ga0495608_0025785 | Ga0495608_0025785_2443_2901 | 147 |
| 27 | 3300046516 | Ga0495628_0197385 | Ga0495628_0197385_249_707 | 147 |
| 28 | 3300046517 | Ga0495630_0005097 | Ga0495630_0005097_8353_8811 | 147 |
| 29 | 3300046533 | Ga0495640_0036447 | Ga0495640_0036447_221_679 | 147 |
| 30 | 3300046642 | Ga0495634_0192203 | Ga0495634_0192203_620_1078 | 147 |
| 31 | 3300046663 | Ga0495635_0282491 | Ga0495635_0282491_229_687 | 147 |
| 32 | 3300046675 | Ga0495657_0092452 | Ga0495657_0092452_1063_1521 | 147 |
| 33 | 3300046678 | Ga0495599_0118054 | Ga0495599_0118054_466_924 | 147 |
| 34 | 3300046689 | Ga0495613_0000599 | Ga0495613_0000599_17292_17750 | 147 |
| 35 | 3300046689 | Ga0495613_0349725 | Ga0495613_0349725_44_514 | 147 |
| 36 | 3300046690 | Ga0495624_0127090 | Ga0495624_0127090_383_841 | 147 |
| 37 | 3300046809 | Ga0495600_0251266 | Ga0495600_0251266_222_680 | 147 |
| 38 | 3300047315 | Ga0495581_0028412 | Ga0495581_0028412_2146_2604 | 147 |
| 39 | 3300047319 | Ga0495674_0065054 | Ga0495674_0065054_954_1412 | 147 |
| 40 | 3300047444 | Ga0495675_0134875 | Ga0495675_0134875_868_1326 | 147 |
| 41 | 3300047471 | Ga0495684_0000310 | Ga0495684_0000310_10929_11387 | 147 |
| 42 | 3300048088 | Ga0495602_0469266 | Ga0495602_0469266_300_761 | 147 |
| 43 | 3300053078 | Ga0495612_0115744 | Ga0495612_0115744_318_776 | 147 |
| 44 | 3300053084 | Ga0495595_0048143 | Ga0495595_0048143_1231_1692 | 147 |
| 45 | 3300053085 | Ga0495619_0009340 | Ga0495619_0009340_3019_3477 | 147 |
| 46 | 3300053085 | Ga0495619_0178323 | Ga0495619_0178323_980_1441 | 147 |
| 47 | 3300009553 | Ga0105249_11476284 | Ga0105249_114762841 | 152 |
| 48 | 3300005293 | Ga0065715_10521973 | Ga0065715_105219732 | 156 |
| 49 | 3300005471 | Ga0070698_101055993 | Ga0070698_1010559932 | 157 |
| 50 | 3300005549 | Ga0070704_101075062 | Ga0070704_1010750621 | 157 |
| 51 | 3300005437 | Ga0070710_10537629 | Ga0070710_105376292 | 158 |
| 52 | 3300005444 | Ga0070694_100052430 | Ga0070694_1000524303 | 158 |
| 53 | 3300005544 | Ga0070686_101181550 | Ga0070686_1011815501 | 158 |
| 54 | 3300005547 | Ga0070693_100098482 | Ga0070693_1000984823 | 158 |
| 55 | 3300005617 | Ga0068859_100952189 | Ga0068859_1009521892 | 158 |
| 56 | 3300005719 | Ga0068861_100048577 | Ga0068861_1000485774 | 158 |
| 57 | 3300005842 | Ga0068858_100147301 | Ga0068858_1001473013 | 158 |
| 58 | 3300006237 | Ga0097621_101204488 | Ga0097621_1012044882 | 158 |
| 59 | 3300006358 | Ga0068871_100660358 | Ga0068871_1006603582 | 158 |
| 60 | 3300006871 | Ga0075434_101208935 | Ga0075434_1012089352 | 158 |
| 61 | 3300006931 | Ga0097620_100952085 | Ga0097620_1009520852 | 158 |
| 62 | 3300009101 | Ga0105247_10480005 | Ga0105247_104800052 | 158 |
| 63 | 3300009148 | Ga0105243_10257634 | Ga0105243_102576342 | 158 |
| 64 | 3300009176 | Ga0105242_10365097 | Ga0105242_103650972 | 158 |
| 65 | 3300009177 | Ga0105248_10406121 | Ga0105248_104061212 | 158 |
| 66 | 3300009177 | Ga0105248_10456400 | Ga0105248_104564002 | 158 |
| 67 | 3300013297 | Ga0157378_10358843 | Ga0157378_103588432 | 158 |
| 68 | 3300013297 | Ga0157378_10900130 | Ga0157378_109001302 | 158 |
| 69 | 3300013306 | Ga0163162_10207060 | Ga0163162_102070603 | 158 |
| 70 | 3300013306 | Ga0163162_10990063 | Ga0163162_109900632 | 158 |
| 71 | 3300017792 | Ga0163161_10410790 | Ga0163161_104107902 | 158 |
| 72 | 3300025918 | Ga0207662_10016043 | Ga0207662_100160435 | 158 |
| 73 | 3300025934 | Ga0207686_10000127 | Ga0207686_1000012721 | 158 |
| 74 | 3300025935 | Ga0207709_10417971 | Ga0207709_104179712 | 158 |
| 75 | 3300025935 | Ga0207709_10465579 | Ga0207709_104655792 | 158 |
| 76 | 3300025960 | Ga0207651_10083005 | Ga0207651_100830052 | 158 |
| 77 | 3300026035 | Ga0207703_10155723 | Ga0207703_101557231 | 158 |
| 78 | 3300026095 | Ga0207676_10179495 | Ga0207676_101794952 | 158 |
| 79 | 3300026118 | Ga0207675_100519333 | Ga0207675_1005193332 | 158 |
| 80 | 3300028380 | Ga0268265_12611582 | Ga0268265_126115821 | 158 |
| 81 | 3300046642 | Ga0495634_0196055 | Ga0495634_0196055_47_529 | 158 |
| 82 | 3300001426 | JGI24030J14995_100112 | JGI24030J14995_1001122 | 159 |
| 83 | 3300001432 | JGI24034J14986_101297 | JGI24034J14986_1012972 | 159 |
| 84 | 3300002074 | JGI24748J21848_1000001 | JGI24748J21848_1000001340 | 159 |
| 85 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_1000000177 | 159 |
| 86 | 3300003203 | JGI25406J46586_10017323 | JGI25406J46586_100173232 | 159 |
| 87 | 3300005289 | Ga0065704_10451392 | Ga0065704_104513922 | 159 |
| 88 | 3300005293 | Ga0065715_10496410 | Ga0065715_104964101 | 159 |
| 89 | 3300005295 | Ga0065707_10084507 | Ga0065707_100845075 | 159 |
| 90 | 3300005295 | Ga0065707_10191752 | Ga0065707_101917522 | 159 |
| 91 | 3300005330 | Ga0070690_100071973 | Ga0070690_1000719733 | 159 |
| 92 | 3300005334 | Ga0068869_100261306 | Ga0068869_1002613062 | 159 |
| 93 | 3300005340 | Ga0070689_100367016 | Ga0070689_1003670162 | 159 |
| 94 | 3300005341 | Ga0070691_10829752 | Ga0070691_108297521 | 159 |
| 95 | 3300005343 | Ga0070687_100043858 | Ga0070687_1000438582 | 159 |
| 96 | 3300005345 | Ga0070692_10250874 | Ga0070692_102508741 | 159 |
| 97 | 3300005353 | Ga0070669_100129282 | Ga0070669_1001292823 | 159 |
| 98 | 3300005354 | Ga0070675_100170986 | Ga0070675_1001709862 | 159 |
| 99 | 3300005355 | Ga0070671_100311708 | Ga0070671_1003117082 | 159 |
| 100 | 3300005355 | Ga0070671_101069089 | Ga0070671_1010690891 | 159 |
| 101 | 3300005364 | Ga0070673_100346254 | Ga0070673_1003462542 | 159 |
| 102 | 3300005367 | Ga0070667_101386974 | Ga0070667_1013869742 | 159 |
| 103 | 3300005406 | Ga0070703_10000049 | Ga0070703_1000004914 | 159 |
| 104 | 3300005406 | Ga0070703_10026830 | Ga0070703_100268302 | 159 |
| 105 | 3300005437 | Ga0070710_10634778 | Ga0070710_106347782 | 159 |
| 106 | 3300005438 | Ga0070701_10031103 | Ga0070701_100311032 | 159 |
| 107 | 3300005440 | Ga0070705_100202257 | Ga0070705_1002022572 | 159 |
| 108 | 3300005441 | Ga0070700_100001704 | Ga0070700_1000017046 | 159 |
| 109 | 3300005441 | Ga0070700_100241365 | Ga0070700_1002413652 | 159 |
| 110 | 3300005444 | Ga0070694_100005491 | Ga0070694_1000054915 | 159 |
| 111 | 3300005444 | Ga0070694_100067224 | Ga0070694_1000672242 | 159 |
| 112 | 3300005444 | Ga0070694_100134087 | Ga0070694_1001340872 | 159 |
| 113 | 3300005444 | Ga0070694_100293348 | Ga0070694_1002933482 | 159 |
| 114 | 3300005444 | Ga0070694_100318533 | Ga0070694_1003185332 | 159 |
| 115 | 3300005444 | Ga0070694_100759151 | Ga0070694_1007591512 | 159 |
| 116 | 3300005444 | Ga0070694_101092993 | Ga0070694_1010929931 | 159 |
| 117 | 3300005445 | Ga0070708_100435736 | Ga0070708_1004357362 | 159 |
| 118 | 3300005445 | Ga0070708_100478218 | Ga0070708_1004782182 | 159 |
| 119 | 3300005445 | Ga0070708_101187212 | Ga0070708_1011872121 | 159 |
| 120 | 3300005459 | Ga0068867_100475672 | Ga0068867_1004756721 | 159 |
| 121 | 3300005459 | Ga0068867_101804662 | Ga0068867_1018046621 | 159 |
| 122 | 3300005467 | Ga0070706_100134623 | Ga0070706_1001346233 | 159 |
| 123 | 3300005467 | Ga0070706_100324028 | Ga0070706_1003240282 | 159 |
| 124 | 3300005467 | Ga0070706_100462704 | Ga0070706_1004627042 | 159 |
| 125 | 3300005468 | Ga0070707_100003181 | Ga0070707_10000318112 | 159 |
| 126 | 3300005468 | Ga0070707_100049227 | Ga0070707_1000492272 | 159 |
| 127 | 3300005468 | Ga0070707_100085947 | Ga0070707_1000859474 | 159 |
| 128 | 3300005468 | Ga0070707_100104089 | Ga0070707_1001040892 | 159 |
| 129 | 3300005468 | Ga0070707_101079124 | Ga0070707_1010791241 | 159 |
| 130 | 3300005468 | Ga0070707_101673149 | Ga0070707_1016731491 | 159 |
| 131 | 3300005468 | Ga0070707_102004131 | Ga0070707_1020041311 | 159 |
| 132 | 3300005471 | Ga0070698_100000063 | Ga0070698_10000006325 | 159 |
| 133 | 3300005471 | Ga0070698_100058886 | Ga0070698_1000588866 | 159 |
| 134 | 3300005471 | Ga0070698_100074006 | Ga0070698_1000740063 | 159 |
| 135 | 3300005471 | Ga0070698_100109499 | Ga0070698_1001094993 | 159 |
| 136 | 3300005471 | Ga0070698_100146747 | Ga0070698_1001467472 | 159 |
| 137 | 3300005471 | Ga0070698_100227677 | Ga0070698_1002276773 | 159 |
| 138 | 3300005471 | Ga0070698_100931300 | Ga0070698_1009313002 | 159 |
| 139 | 3300005518 | Ga0070699_100128227 | Ga0070699_1001282272 | 159 |
| 140 | 3300005518 | Ga0070699_100180760 | Ga0070699_1001807602 | 159 |
| 141 | 3300005518 | Ga0070699_100436830 | Ga0070699_1004368302 | 159 |
| 142 | 3300005518 | Ga0070699_101623213 | Ga0070699_1016232131 | 159 |
| 143 | 3300005536 | Ga0070697_100016574 | Ga0070697_1000165747 | 159 |
| 144 | 3300005536 | Ga0070697_100044328 | Ga0070697_1000443282 | 159 |
| 145 | 3300005536 | Ga0070697_100759141 | Ga0070697_1007591412 | 159 |
| 146 | 3300005543 | Ga0070672_100432377 | Ga0070672_1004323772 | 159 |
| 147 | 3300005544 | Ga0070686_100023684 | Ga0070686_1000236844 | 159 |
| 148 | 3300005544 | Ga0070686_100088003 | Ga0070686_1000880032 | 159 |
| 149 | 3300005544 | Ga0070686_100189730 | Ga0070686_1001897302 | 159 |
| 150 | 3300005545 | Ga0070695_100119583 | Ga0070695_1001195832 | 159 |
| 151 | 3300005545 | Ga0070695_100145002 | Ga0070695_1001450022 | 159 |
| 152 | 3300005545 | Ga0070695_101027642 | Ga0070695_1010276421 | 159 |
| 153 | 3300005546 | Ga0070696_100525297 | Ga0070696_1005252972 | 159 |
| 154 | 3300005546 | Ga0070696_100621991 | Ga0070696_1006219912 | 159 |
| 155 | 3300005549 | Ga0070704_100000588 | Ga0070704_1000005886 | 159 |
| 156 | 3300005549 | Ga0070704_100077876 | Ga0070704_1000778762 | 159 |
| 157 | 3300005549 | Ga0070704_100415046 | Ga0070704_1004150462 | 159 |
| 158 | 3300005549 | Ga0070704_100617621 | Ga0070704_1006176211 | 159 |
| 159 | 3300005578 | Ga0068854_100089075 | Ga0068854_1000890753 | 159 |
| 160 | 3300005617 | Ga0068859_100028738 | Ga0068859_1000287383 | 159 |
| 161 | 3300005617 | Ga0068859_100037974 | Ga0068859_1000379743 | 159 |
| 162 | 3300005617 | Ga0068859_100131903 | Ga0068859_1001319035 | 159 |
| 163 | 3300005618 | Ga0068864_100276764 | Ga0068864_1002767642 | 159 |
| 164 | 3300005841 | Ga0068863_100362401 | Ga0068863_1003624012 | 159 |
| 165 | 3300005842 | Ga0068858_100000051 | Ga0068858_10000005130 | 159 |
| 166 | 3300005842 | Ga0068858_100108593 | Ga0068858_1001085932 | 159 |
| 167 | 3300005842 | Ga0068858_101501959 | Ga0068858_1015019592 | 159 |
| 168 | 3300005844 | Ga0068862_100008314 | Ga0068862_1000083145 | 159 |
| 169 | 3300005844 | Ga0068862_100548437 | Ga0068862_1005484371 | 159 |
| 170 | 3300005985 | Ga0081539_10000666 | Ga0081539_1000066660 | 159 |
| 171 | 3300005985 | Ga0081539_10224887 | Ga0081539_102248871 | 159 |
| 172 | 3300006163 | Ga0070715_10000025 | Ga0070715_1000002575 | 159 |
| 173 | 3300006173 | Ga0070716_100000003 | Ga0070716_10000000337 | 159 |
| 174 | 3300006844 | Ga0075428_100529202 | Ga0075428_1005292022 | 159 |
| 175 | 3300006846 | Ga0075430_100004320 | Ga0075430_1000043208 | 159 |
| 176 | 3300006846 | Ga0075430_100078261 | Ga0075430_1000782614 | 159 |
| 177 | 3300006846 | Ga0075430_100088096 | Ga0075430_1000880962 | 159 |
| 178 | 3300006847 | Ga0075431_100007356 | Ga0075431_10000735611 | 159 |
| 179 | 3300006852 | Ga0075433_10053966 | Ga0075433_100539663 | 159 |
| 180 | 3300006852 | Ga0075433_10652530 | Ga0075433_106525302 | 159 |
| 181 | 3300006871 | Ga0075434_100126206 | Ga0075434_1001262062 | 159 |
| 182 | 3300006871 | Ga0075434_100127124 | Ga0075434_1001271242 | 159 |
| 183 | 3300006871 | Ga0075434_100181967 | Ga0075434_1001819672 | 159 |
| 184 | 3300006871 | Ga0075434_100736261 | Ga0075434_1007362612 | 159 |
| 185 | 3300006880 | Ga0075429_100008602 | Ga0075429_1000086028 | 159 |
| 186 | 3300006880 | Ga0075429_100466295 | Ga0075429_1004662952 | 159 |
| 187 | 3300006914 | Ga0075436_100000002 | Ga0075436_100000002228 | 159 |
| 188 | 3300006914 | Ga0075436_100233025 | Ga0075436_1002330252 | 159 |
| 189 | 3300006931 | Ga0097620_100028740 | Ga0097620_1000287403 | 159 |
| 190 | 3300006931 | Ga0097620_100037976 | Ga0097620_1000379763 | 159 |
| 191 | 3300006931 | Ga0097620_100131901 | Ga0097620_1001319015 | 159 |
| 192 | 3300007076 | Ga0075435_100005602 | Ga0075435_10000560210 | 159 |
| 193 | 3300007076 | Ga0075435_100562880 | Ga0075435_1005628802 | 159 |
| 194 | 3300007265 | Ga0099794_10005067 | Ga0099794_100050674 | 159 |
| 195 | 3300009094 | Ga0111539_10144414 | Ga0111539_101444143 | 159 |
| 196 | 3300009094 | Ga0111539_11081560 | Ga0111539_110815601 | 159 |
| 197 | 3300009098 | Ga0105245_11774761 | Ga0105245_117747611 | 159 |
| 198 | 3300009101 | Ga0105247_10000004 | Ga0105247_10000004122 | 159 |
| 199 | 3300009148 | Ga0105243_10000037 | Ga0105243_1000003738 | 159 |
| 200 | 3300009148 | Ga0105243_10000446 | Ga0105243_100004464 | 159 |
| 201 | 3300009148 | Ga0105243_10406507 | Ga0105243_104065072 | 159 |
| 202 | 3300009176 | Ga0105242_10001013 | Ga0105242_1000101314 | 159 |
| 203 | 3300009176 | Ga0105242_10003928 | Ga0105242_100039285 | 159 |
| 204 | 3300009176 | Ga0105242_10845518 | Ga0105242_108455182 | 159 |
| 205 | 3300009177 | Ga0105248_12259484 | Ga0105248_122594841 | 159 |
| 206 | 3300009553 | Ga0105249_10033755 | Ga0105249_100337552 | 159 |
| 207 | 3300009553 | Ga0105249_10286885 | Ga0105249_102868851 | 159 |
| 208 | 3300009553 | Ga0105249_11363840 | Ga0105249_113638401 | 159 |
| 209 | 3300010375 | Ga0105239_10043633 | Ga0105239_100436332 | 159 |
| 210 | 3300010375 | Ga0105239_11861548 | Ga0105239_118615481 | 159 |
| 211 | 3300013102 | Ga0157371_10158129 | Ga0157371_101581291 | 159 |
| 212 | 3300013297 | Ga0157378_10000004 | Ga0157378_10000004104 | 159 |
| 213 | 3300013297 | Ga0157378_10015793 | Ga0157378_100157935 | 159 |
| 214 | 3300013297 | Ga0157378_10019632 | Ga0157378_100196323 | 159 |
| 215 | 3300013297 | Ga0157378_10108589 | Ga0157378_101085893 | 159 |
| 216 | 3300013306 | Ga0163162_10010975 | Ga0163162_100109754 | 159 |
| 217 | 3300013308 | Ga0157375_10000479 | Ga0157375_1000047915 | 159 |
| 218 | 3300014968 | Ga0157379_10069966 | Ga0157379_100699661 | 159 |
| 219 | 3300017792 | Ga0163161_10004588 | Ga0163161_100045882 | 159 |
| 220 | 3300025223 | Ga0207672_1000002 | Ga0207672_10000026 | 159 |
| 221 | 3300025885 | Ga0207653_10000163 | Ga0207653_1000016334 | 159 |
| 222 | 3300025885 | Ga0207653_10009719 | Ga0207653_100097192 | 159 |
| 223 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002892 | 159 |
| 224 | 3300025905 | Ga0207685_10000008 | Ga0207685_10000008119 | 159 |
| 225 | 3300025906 | Ga0207699_10057965 | Ga0207699_100579653 | 159 |
| 226 | 3300025910 | Ga0207684_10003514 | Ga0207684_100035142 | 159 |
| 227 | 3300025910 | Ga0207684_10253717 | Ga0207684_102537172 | 159 |
| 228 | 3300025910 | Ga0207684_10305621 | Ga0207684_103056212 | 159 |
| 229 | 3300025910 | Ga0207684_10521104 | Ga0207684_105211042 | 159 |
| 230 | 3300025918 | Ga0207662_10064160 | Ga0207662_100641603 | 159 |
| 231 | 3300025918 | Ga0207662_10084795 | Ga0207662_100847952 | 159 |
| 232 | 3300025922 | Ga0207646_10004949 | Ga0207646_100049492 | 159 |
| 233 | 3300025922 | Ga0207646_10011440 | Ga0207646_100114404 | 159 |
| 234 | 3300025922 | Ga0207646_10042513 | Ga0207646_100425134 | 159 |
| 235 | 3300025922 | Ga0207646_10089140 | Ga0207646_100891402 | 159 |
| 236 | 3300025922 | Ga0207646_11255484 | Ga0207646_112554842 | 159 |
| 237 | 3300025922 | Ga0207646_11474283 | Ga0207646_114742831 | 159 |
| 238 | 3300025931 | Ga0207644_10000179 | Ga0207644_1000017931 | 159 |
| 239 | 3300025934 | Ga0207686_10000003 | Ga0207686_10000003227 | 159 |
| 240 | 3300025934 | Ga0207686_10000965 | Ga0207686_1000096514 | 159 |
| 241 | 3300025934 | Ga0207686_10731715 | Ga0207686_107317152 | 159 |
| 242 | 3300025934 | Ga0207686_11433044 | Ga0207686_114330441 | 159 |
| 243 | 3300025935 | Ga0207709_10000017 | Ga0207709_10000017286 | 159 |
| 244 | 3300025935 | Ga0207709_10003560 | Ga0207709_100035608 | 159 |
| 245 | 3300025936 | Ga0207670_10365169 | Ga0207670_103651692 | 159 |
| 246 | 3300025939 | Ga0207665_10000003 | Ga0207665_1000000381 | 159 |
| 247 | 3300025940 | Ga0207691_10707558 | Ga0207691_107075582 | 159 |
| 248 | 3300025942 | Ga0207689_10073696 | Ga0207689_100736963 | 159 |
| 249 | 3300025960 | Ga0207651_10399521 | Ga0207651_103995212 | 159 |
| 250 | 3300025961 | Ga0207712_10093283 | Ga0207712_100932832 | 159 |
| 251 | 3300025961 | Ga0207712_10622255 | Ga0207712_106222552 | 159 |
| 252 | 3300025981 | Ga0207640_10438705 | Ga0207640_104387052 | 159 |
| 253 | 3300025986 | Ga0207658_11555560 | Ga0207658_115555601 | 159 |
| 254 | 3300026035 | Ga0207703_10000114 | Ga0207703_1000011442 | 159 |
| 255 | 3300026035 | Ga0207703_10425079 | Ga0207703_104250792 | 159 |
| 256 | 3300026075 | Ga0207708_10003764 | Ga0207708_100037642 | 159 |
| 257 | 3300026075 | Ga0207708_10621143 | Ga0207708_106211432 | 159 |
| 258 | 3300026075 | Ga0207708_10812654 | Ga0207708_108126542 | 159 |
| 259 | 3300026088 | Ga0207641_10167637 | Ga0207641_101676372 | 159 |
| 260 | 3300026088 | Ga0207641_10340009 | Ga0207641_103400092 | 159 |
| 261 | 3300026089 | Ga0207648_10211489 | Ga0207648_102114892 | 159 |
| 262 | 3300026095 | Ga0207676_10379037 | Ga0207676_103790373 | 159 |
| 263 | 3300026118 | Ga0207675_100045308 | Ga0207675_1000453082 | 159 |
| 264 | 3300027907 | Ga0207428_10001780 | Ga0207428_100017808 | 159 |
| 265 | 3300028380 | Ga0268265_10072698 | Ga0268265_100726981 | 159 |
| 266 | 3300028381 | Ga0268264_10122673 | Ga0268264_101226732 | 159 |
| 267 | 3300031852 | Ga0307410_10027216 | Ga0307410_100272165 | 159 |
| 268 | 3300032002 | Ga0307416_101194398 | Ga0307416_1011943982 | 159 |
| 269 | 3300032005 | Ga0307411_10073993 | Ga0307411_100739933 | 159 |
| 270 | 3300037471 | Ga0395905_0172119 | Ga0395905_0172119_1304_1828 | 159 |
| 271 | 3300042876 | Ga0451577_0098499 | Ga0451577_0098499_317_802 | 159 |
| 272 | 3300044673 | Ga0453683_0185042 | Ga0453683_0185042_584_1069 | 159 |
| 273 | 3300044712 | Ga0453684_0490336 | Ga0453684_0490336_764_1249 | 159 |
| 274 | 3300045051 | Ga0451576_0095940 | Ga0451576_0095940_133_618 | 159 |
| 275 | 3300045051 | Ga0451576_1020669 | Ga0451576_1020669_331_816 | 159 |
| 276 | 3300045051 | Ga0451576_1429816 | Ga0451576_1429816_193_678 | 159 |
| 277 | 3300046517 | Ga0495630_0082283 | Ga0495630_0082283_1488_1988 | 159 |
| 278 | 3300046537 | Ga0495598_0014643 | Ga0495598_0014643_716_1201 | 159 |
| 279 | 3300046539 | Ga0495621_0187321 | Ga0495621_0187321_102_587 | 159 |
| 280 | 3300046689 | Ga0495613_0213678 | Ga0495613_0213678_495_995 | 159 |
| 281 | 3300046809 | Ga0495600_0255127 | Ga0495600_0255127_135_635 | 159 |
| 282 | 3300047318 | Ga0495636_0014016 | Ga0495636_0014016_1235_1720 | 159 |
| 283 | 3300047471 | Ga0495684_0094079 | Ga0495684_0094079_87_587 | 159 |
| 284 | 3300048904 | Ga0496101_0756520 | Ga0496101_0756520_208_693 | 159 |
| 285 | 3300048909 | Ga0496106_0001061 | Ga0496106_0001061_13218_13703 | 159 |
| 286 | 3300050508 | nmdc:mga09592_57792_c1 | nmdc:mga09592_57792_c1_1252_1737 | 159 |
| 287 | 3300050509 | nmdc:mga0qj67_134307_c1 | nmdc:mga0qj67_134307_c1_157_693 | 159 |
| 288 | 3300050509 | nmdc:mga0qj67_45884_c1 | nmdc:mga0qj67_45884_c1_303_833 | 159 |
| 289 | 3300050509 | nmdc:mga0qj67_5713_c1 | nmdc:mga0qj67_5713_c1_7949_8473 | 159 |
| 290 | 3300050510 | nmdc:mga06r32_38885_c1 | nmdc:mga06r32_38885_c1_3122_3646 | 159 |
| 291 | 3300050510 | nmdc:mga06r32_95493_c1 | nmdc:mga06r32_95493_c1_1388_1918 | 159 |
| 292 | 3300050511 | nmdc:mga08y16_387161_c1 | nmdc:mga08y16_387161_c1_353_838 | 159 |
| 293 | 3300050511 | nmdc:mga08y16_746696_c1 | nmdc:mga08y16_746696_c1_210_695 | 159 |
| 294 | 3300050512 | nmdc:mga0n895_1138939_c1 | nmdc:mga0n895_1138939_c1_118_603 | 159 |
| 295 | 3300050512 | nmdc:mga0n895_180557_c1 | nmdc:mga0n895_180557_c1_1315_1794 | 159 |
| 296 | 3300050512 | nmdc:mga0n895_733951_c1 | nmdc:mga0n895_733951_c1_95_580 | 159 |
| 297 | 3300050512 | nmdc:mga0n895_8996_c1 | nmdc:mga0n895_8996_c1_7979_8467 | 159 |
| 298 | 3300050513 | nmdc:mga0rr50_3767_c1 | nmdc:mga0rr50_3767_c1_7149_7631 | 159 |
| 299 | 3300050513 | nmdc:mga0rr50_995962_c1 | nmdc:mga0rr50_995962_c1_214_693 | 159 |
| 300 | 3300050514 | nmdc:mga08x19_279000_c1 | nmdc:mga08x19_279000_c1_211_690 | 159 |
| 301 | 3300050514 | nmdc:mga08x19_696326_c1 | nmdc:mga08x19_696326_c1_145_630 | 159 |
| 302 | 3300050514 | nmdc:mga08x19_9_c1 | nmdc:mga08x19_9_c1_152496_152978 | 159 |
| 303 | 3300050515 | nmdc:mga0a205_172244_c1 | nmdc:mga0a205_172244_c1_242_727 | 159 |
| 304 | 3300050515 | nmdc:mga0a205_96516_c1 | nmdc:mga0a205_96516_c1_1153_1638 | 159 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rd9-assembly1.cif.gz_A | crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution | 0.7896 | 1 | 156 |
| 1rxq-assembly1.cif.gz_B | yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology | 0.7828 | 1 | 157 |
| 5cqv-assembly1.cif.gz_B | crystal structure of uncharacterized protein q8dwv2 from streptococcus agalactiae | 0.7651 | 4 | 115 |
| 3gor-assembly2.cif.gz_D | crystal structure of putative metal-dependent hydrolase apc36150 | 0.7592 | 4 | 157 |
| 2rd9-assembly3.cif.gz_B | crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution | 0.7569 | 1 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5cqvB01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7651 | 4 | 115 | 1.20.120.450 |
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7615 | 1 | 157 | 1.20.120.450 |
| 2rd9B01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7557 | 1 | 157 | 1.20.120.450 |
| 2nsgA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7177 | 5 | 153 | 1.20.120.450 |
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7156 | 1 | 157 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q8AJA5-F1-model_v4 | DinB-like domain-containing protein | 0.9933 | 22 | 156 |
|
| AF-A0A7W0JEZ4-F1-model_v4 | DinB family protein | 0.9909 | 1 | 157 |
|
| AF-A0A849NEV3-F1-model_v4 | DinB family protein | 0.988 | 1 | 156 |
|
| AF-A0A2V7HCF2-F1-model_v4 | DinB family protein | 0.9869 | 1 | 155 |
|
| AF-A0A2V8QA31-F1-model_v4 | DinB-like domain-containing protein | 0.9868 | 4 | 159 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar