F397458

General Info

Members Datasets Scaffolds Average Seq Length
304 158 304 160

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100000063|Ga0070698_10000006325
Length 171
Sequence MDQWLEDFKQTIDSATPRLLQISEAQSEKPRSEDHWSAKQIIGHLIDSATNNHARFVLGQIKDDLIFPGYEQNRWVEINHYQQAPWSQLVDLWRAYNLHLLHVMSHADPHKMNNRCAQHSLQTIAFETISESKTATLEYLMKDYVVHLKHHLSQILESAAETDHAGESASN

Samples

Sample ID Description Type Environment
1 3300001426 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 Metagenome Rhizosphere
2 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
150 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.66
Rhizosphere 99.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24030J14995_100112 3300001426 Bacteria 1969
2 JGI24034J14986_101297 3300001432 Unclassified 1451
3 JGI24748J21848_1000001 3300002074 Bacteria 444271
4 JGI24034J26672_10000001 3300002239 Bacteria 1118280
5 JGI25406J46586_10017323 3300003203 Bacteria 2982
6 Ga0065704_10451392 3300005289 Unclassified 705
7 Ga0065715_10496410 3300005293 Unclassified 783
8 Ga0065715_10521973 3300005293 Unclassified 749
9 Ga0065707_10084507 3300005295 Bacteria 7130
10 Ga0065707_10191752 3300005295 Bacteria 1357
11 Ga0070676_10283375 3300005328 Bacteria 1117
12 Ga0070690_100071973 3300005330 Bacteria 2247
13 Ga0068869_100261306 3300005334 Bacteria 1386
14 Ga0070689_100367016 3300005340 Unclassified 1211
15 Ga0070691_10829752 3300005341 Unclassified 565
16 Ga0070687_100043858 3300005343 Bacteria 2276
17 Ga0070692_10250874 3300005345 Bacteria 1059
18 Ga0070669_100129282 3300005353 Bacteria 1936
19 Ga0070675_100170986 3300005354 Unclassified 1874
20 Ga0070671_100311708 3300005355 Unclassified 1340
21 Ga0070671_101069089 3300005355 Bacteria 708
22 Ga0070673_100346254 3300005364 Unclassified 1318
23 Ga0070667_101386974 3300005367 Unclassified 659
24 Ga0070703_10000049 3300005406 Bacteria 58073
25 Ga0070703_10026830 3300005406 Bacteria 1714
26 Ga0070710_10537629 3300005437 Unclassified 805
27 Ga0070710_10634778 3300005437 Unclassified 747
28 Ga0070701_10031103 3300005438 Bacteria 2647
29 Ga0070711_100794116 3300005439 Unclassified 802
30 Ga0070705_100202257 3300005440 Bacteria 1363
31 Ga0070700_100001704 3300005441 Bacteria 11035
32 Ga0070700_100241365 3300005441 Bacteria 1291
33 Ga0070694_100005491 3300005444 Bacteria 7680
34 Ga0070694_100052430 3300005444 Bacteria 2757
35 Ga0070694_100067224 3300005444 Bacteria 2460
36 Ga0070694_100134087 3300005444 Bacteria 1793
37 Ga0070694_100293348 3300005444 Unclassified 1244
38 Ga0070694_100318533 3300005444 Unclassified 1196
39 Ga0070694_100759151 3300005444 Bacteria 792
40 Ga0070694_101092993 3300005444 Unclassified 665
41 Ga0070708_100435736 3300005445 Bacteria 1236
42 Ga0070708_100478218 3300005445 Bacteria 1175
43 Ga0070708_101187212 3300005445 Bacteria 714
44 Ga0070681_10375111 3300005458 Bacteria 1333
45 Ga0068867_100475672 3300005459 Bacteria 1069
46 Ga0068867_101804662 3300005459 Unclassified 575
47 Ga0070706_100134623 3300005467 Bacteria 2307
48 Ga0070706_100324028 3300005467 Bacteria 1437
49 Ga0070706_100462704 3300005467 Bacteria 1180
50 Ga0070707_100000107 3300005468 Bacteria 76101
51 Ga0070707_100003181 3300005468 Bacteria 15534
52 Ga0070707_100049227 3300005468 Unclassified 4039
53 Ga0070707_100085947 3300005468 Bacteria 3041
54 Ga0070707_100104089 3300005468 Bacteria 2751
55 Ga0070707_101079124 3300005468 Unclassified 769
56 Ga0070707_101673149 3300005468 Bacteria 603
57 Ga0070707_102004131 3300005468 Unclassified 546
58 Ga0070698_100000063 3300005471 Bacteria 78062
59 Ga0070698_100058886 3300005471 Unclassified 3882
60 Ga0070698_100074006 3300005471 Bacteria 3412
61 Ga0070698_100109499 3300005471 Bacteria 2729
62 Ga0070698_100146747 3300005471 Unclassified 2308
63 Ga0070698_100212472 3300005471 Bacteria 1869
64 Ga0070698_100227677 3300005471 Bacteria 1798
65 Ga0070698_100931300 3300005471 Unclassified 815
66 Ga0070698_101055993 3300005471 Bacteria 760
67 Ga0070699_100128227 3300005518 Bacteria 2235
68 Ga0070699_100180760 3300005518 Bacteria 1872
69 Ga0070699_100436830 3300005518 Bacteria 1186
70 Ga0070699_101623213 3300005518 Unclassified 592
71 Ga0070697_100016574 3300005536 Bacteria 5797
72 Ga0070697_100044328 3300005536 Bacteria 3602
73 Ga0070697_100759141 3300005536 Bacteria 857
74 Ga0070672_100432377 3300005543 Unclassified 1132
75 Ga0070686_100023684 3300005544 Bacteria 3673
76 Ga0070686_100088003 3300005544 Bacteria 2072
77 Ga0070686_100189730 3300005544 Bacteria 1466
78 Ga0070686_101181550 3300005544 Unclassified 635
79 Ga0070695_100119583 3300005545 Bacteria 1800
80 Ga0070695_100145002 3300005545 Bacteria 1651
81 Ga0070695_101027642 3300005545 Unclassified 671
82 Ga0070696_100525297 3300005546 Bacteria 945
83 Ga0070696_100621991 3300005546 Bacteria 873
84 Ga0070693_100098482 3300005547 Bacteria 1777
85 Ga0070704_100000588 3300005549 Bacteria 17506
86 Ga0070704_100077876 3300005549 Bacteria 2430
87 Ga0070704_100415046 3300005549 Bacteria 1152
88 Ga0070704_100617621 3300005549 Bacteria 954
89 Ga0070704_101075062 3300005549 Bacteria 730
90 Ga0068854_100089075 3300005578 Unclassified 2293
91 Ga0068859_100028738 3300005617 Bacteria 5574
92 Ga0068859_100037974 3300005617 Bacteria 4833
93 Ga0068859_100131903 3300005617 Bacteria 2570
94 Ga0068859_100952189 3300005617 Unclassified 942
95 Ga0068864_100276764 3300005618 Bacteria 1565
96 Ga0068861_100048577 3300005719 Bacteria 3209
97 Ga0068863_100362401 3300005841 Unclassified 1413
98 Ga0068858_100000051 3300005842 Bacteria 120692
99 Ga0068858_100108593 3300005842 Bacteria 2590
100 Ga0068858_100147301 3300005842 Bacteria 2212
101 Ga0068858_101501959 3300005842 Unclassified 664
102 Ga0068862_100008314 3300005844 Bacteria 8587
103 Ga0068862_100548437 3300005844 Unclassified 1104
104 Ga0081539_10000666 3300005985 Bacteria 68895
105 Ga0081539_10224887 3300005985 Bacteria 851
106 Ga0070715_10000025 3300006163 Bacteria 107539
107 Ga0070716_100000003 3300006173 Bacteria 312721
108 Ga0097621_101204488 3300006237 Bacteria 713
109 Ga0068871_100660358 3300006358 Bacteria 955
110 Ga0075428_100529202 3300006844 Bacteria 1260
111 Ga0075430_100004320 3300006846 Bacteria 12006
112 Ga0075430_100078261 3300006846 Bacteria 2772
113 Ga0075430_100088096 3300006846 Bacteria 2597
114 Ga0075431_100007356 3300006847 Bacteria 10965
115 Ga0075433_10053966 3300006852 Bacteria 3505
116 Ga0075433_10652530 3300006852 Bacteria 923
117 Ga0075434_100126206 3300006871 Bacteria 2576
118 Ga0075434_100127124 3300006871 Unclassified 2566
119 Ga0075434_100181967 3300006871 Bacteria 2122
120 Ga0075434_100736261 3300006871 Unclassified 1003
121 Ga0075434_100776382 3300006871 Unclassified 975
122 Ga0075434_101208935 3300006871 Bacteria 768
123 Ga0075429_100008602 3300006880 Bacteria 8878
124 Ga0075429_100466295 3300006880 Unclassified 1106
125 Ga0068865_100107062 3300006881 Unclassified 2056
126 Ga0075436_100000002 3300006914 Bacteria 475522
127 Ga0075436_100233025 3300006914 Bacteria 1308
128 Ga0097620_100028740 3300006931 Bacteria 5574
129 Ga0097620_100037976 3300006931 Bacteria 4833
130 Ga0097620_100131901 3300006931 Bacteria 2570
131 Ga0097620_100952085 3300006931 Unclassified 942
132 Ga0075435_100005602 3300007076 Bacteria 8793
133 Ga0075435_100562880 3300007076 Bacteria 988
134 Ga0099794_10005067 3300007265 Bacteria 5251
135 Ga0111539_10144414 3300009094 Bacteria 2786
136 Ga0111539_11081560 3300009094 Unclassified 932
137 Ga0105245_11774761 3300009098 Unclassified 670
138 Ga0105247_10000004 3300009101 Bacteria 455497
139 Ga0105247_10480005 3300009101 Bacteria 902
140 Ga0114129_10143527 3300009147 Bacteria 3271
141 Ga0105243_10000037 3300009148 Bacteria 175237
142 Ga0105243_10000446 3300009148 Bacteria 43049
143 Ga0105243_10257634 3300009148 Unclassified 1561
144 Ga0105243_10406507 3300009148 Bacteria 1266
145 Ga0105242_10001013 3300009176 Bacteria 22070
146 Ga0105242_10003928 3300009176 Bacteria 11551
147 Ga0105242_10365097 3300009176 Bacteria 1337
148 Ga0105242_10845518 3300009176 Unclassified 910
149 Ga0105248_10406121 3300009177 Bacteria 1534
150 Ga0105248_10456400 3300009177 Bacteria 1440
151 Ga0105248_12259484 3300009177 Unclassified 619
152 Ga0105249_10033755 3300009553 Bacteria 4634
153 Ga0105249_10286885 3300009553 Bacteria 1646
154 Ga0105249_11363840 3300009553 Bacteria 781
155 Ga0105249_11476284 3300009553 Unclassified 752
156 Ga0105239_10043633 3300010375 Bacteria 4917
157 Ga0105239_11861548 3300010375 Bacteria 698
158 Ga0157371_10158129 3300013102 Bacteria 1618
159 Ga0157378_10000004 3300013297 Bacteria 201051
160 Ga0157378_10015793 3300013297 Bacteria 6612
161 Ga0157378_10019632 3300013297 Bacteria 5941
162 Ga0157378_10108589 3300013297 Bacteria 2541
163 Ga0157378_10358843 3300013297 Bacteria 1426
164 Ga0157378_10900130 3300013297 Unclassified 915
165 Ga0163162_10010975 3300013306 Bacteria 8821
166 Ga0163162_10207060 3300013306 Bacteria 2091
167 Ga0163162_10990063 3300013306 Bacteria 950
168 Ga0157375_10000479 3300013308 Bacteria 36426
169 Ga0157379_10069966 3300014968 Bacteria 3139
170 Ga0163161_10004588 3300017792 Bacteria 9613
171 Ga0163161_10410790 3300017792 Bacteria 1087
172 Ga0207672_1000002 3300025223 Bacteria 31879
173 Ga0207653_10000163 3300025885 Bacteria 47337
174 Ga0207653_10009719 3300025885 Bacteria 2999
175 Ga0207710_10000002 3300025900 Bacteria 1251998
176 Ga0207685_10000008 3300025905 Bacteria 273136
177 Ga0207699_10057965 3300025906 Bacteria 2315
178 Ga0207684_10003514 3300025910 Bacteria 15286
179 Ga0207684_10253717 3300025910 Bacteria 1517
180 Ga0207684_10305621 3300025910 Bacteria 1371
181 Ga0207684_10521104 3300025910 Bacteria 1018
182 Ga0207662_10016043 3300025918 Unclassified 4222
183 Ga0207662_10064160 3300025918 Bacteria 2209
184 Ga0207662_10084795 3300025918 Bacteria 1939
185 Ga0207646_10000543 3300025922 Bacteria 49799
186 Ga0207646_10004949 3300025922 Bacteria 14244
187 Ga0207646_10011440 3300025922 Bacteria 8598
188 Ga0207646_10042513 3300025922 Unclassified 4082
189 Ga0207646_10089140 3300025922 Bacteria 2761
190 Ga0207646_11255484 3300025922 Unclassified 648
191 Ga0207646_11474283 3300025922 Unclassified 590
192 Ga0207644_10000179 3300025931 Bacteria 45397
193 Ga0207686_10000003 3300025934 Bacteria 376934
194 Ga0207686_10000127 3300025934 Bacteria 61880
195 Ga0207686_10000965 3300025934 Bacteria 17144
196 Ga0207686_10731715 3300025934 Bacteria 789
197 Ga0207686_11433044 3300025934 Unclassified 569
198 Ga0207709_10000017 3300025935 Bacteria 470753
199 Ga0207709_10003560 3300025935 Bacteria 9208
200 Ga0207709_10297372 3300025935 Bacteria 1199
201 Ga0207709_10417971 3300025935 Bacteria 1029
202 Ga0207709_10465579 3300025935 Bacteria 980
203 Ga0207670_10365169 3300025936 Unclassified 1146
204 Ga0207704_10072800 3300025938 Unclassified 2186
205 Ga0207665_10000003 3300025939 Bacteria 220666
206 Ga0207691_10707558 3300025940 Bacteria 849
207 Ga0207689_10073696 3300025942 Bacteria 2805
208 Ga0207651_10083005 3300025960 Bacteria 2316
209 Ga0207651_10399521 3300025960 Bacteria 1169
210 Ga0207712_10093283 3300025961 Bacteria 2221
211 Ga0207712_10622255 3300025961 Bacteria 936
212 Ga0207640_10438705 3300025981 Bacteria 1073
213 Ga0207658_11555560 3300025986 Unclassified 605
214 Ga0207703_10000114 3300026035 Bacteria 96051
215 Ga0207703_10155723 3300026035 Bacteria 1996
216 Ga0207703_10425079 3300026035 Bacteria 1237
217 Ga0207708_10003764 3300026075 Bacteria 11175
218 Ga0207708_10621143 3300026075 Bacteria 917
219 Ga0207708_10812654 3300026075 Bacteria 805
220 Ga0207641_10167637 3300026088 Unclassified 2002
221 Ga0207641_10340009 3300026088 Unclassified 1428
222 Ga0207648_10211489 3300026089 Bacteria 1722
223 Ga0207676_10179495 3300026095 Bacteria 1853
224 Ga0207676_10379037 3300026095 Unclassified 1316
225 Ga0207675_100045308 3300026118 Bacteria 4109
226 Ga0207675_100519333 3300026118 Bacteria 1187
227 Ga0207428_10001780 3300027907 Bacteria 22062
228 Ga0268265_10072698 3300028380 Bacteria 2683
229 Ga0268265_12611582 3300028380 Unclassified 511
230 Ga0268264_10122673 3300028381 Unclassified 2292
231 Ga0307410_10027216 3300031852 Bacteria 3612
232 Ga0307416_101194398 3300032002 Bacteria 866
233 Ga0307411_10073993 3300032005 Bacteria 2320
234 Ga0373936_0026640 3300035113 Bacteria 2264
235 Ga0373953_0518907 3300035117 Unclassified 529
236 Ga0373956_0107550 3300035119 Bacteria 1297
237 Ga0373943_0006056 3300035170 Bacteria 5431
238 Ga0373946_0009458 3300035171 Bacteria 3591
239 Ga0373955_0008814 3300035172 Bacteria 4702
240 Ga0373947_0009269 3300035725 Bacteria 5656
241 Ga0373937_0231304 3300036401 Unclassified 1741
242 Ga0373937_0616211 3300036401 Bacteria 1030
243 Ga0373937_1101152 3300036401 Unclassified 743
244 Ga0395905_0172119 3300037471 Bacteria 2034
245 Ga0451577_0098499 3300042876 Bacteria 2611
246 Ga0453683_0185042 3300044673 Bacteria 1321
247 Ga0453684_0490336 3300044712 Unclassified 1362
248 Ga0451576_0095940 3300045051 Unclassified 3084
249 Ga0451576_1020669 3300045051 Bacteria 867
250 Ga0451576_1429816 3300045051 Unclassified 719
251 Ga0495580_0444293 3300046472 Unclassified 871
252 Ga0495580_0579152 3300046472 Unclassified 743
253 Ga0495608_0025785 3300046511 Bacteria 4012
254 Ga0495628_0197385 3300046516 Bacteria 1517
255 Ga0495630_0005097 3300046517 Bacteria 9238
256 Ga0495630_0082283 3300046517 Bacteria 2430
257 Ga0495640_0036447 3300046533 Bacteria 3475
258 Ga0495598_0014643 3300046537 Bacteria 1965
259 Ga0495621_0187321 3300046539 Bacteria 828
260 Ga0495634_0192203 3300046642 Bacteria 1272
261 Ga0495634_0196055 3300046642 Bacteria 1257
262 Ga0495635_0282491 3300046663 Unclassified 1115
263 Ga0495657_0092452 3300046675 Bacteria 1938
264 Ga0495599_0118054 3300046678 Bacteria 1650
265 Ga0495613_0000599 3300046689 Bacteria 29031
266 Ga0495613_0213678 3300046689 Unclassified 1356
267 Ga0495613_0349725 3300046689 Unclassified 1015
268 Ga0495624_0127090 3300046690 Bacteria 1564
269 Ga0495600_0251266 3300046809 Bacteria 1124
270 Ga0495600_0255127 3300046809 Bacteria 1115
271 Ga0495581_0028412 3300047315 Bacteria 3242
272 Ga0495636_0014016 3300047318 Bacteria 3186
273 Ga0495674_0065054 3300047319 Bacteria 3168
274 Ga0495675_0134875 3300047444 Bacteria 1533
275 Ga0495684_0000310 3300047471 Bacteria 39859
276 Ga0495684_0094079 3300047471 Bacteria 2270
277 Ga0495602_0469266 3300048088 Unclassified 885
278 Ga0496101_0756520 3300048904 Unclassified 767
279 Ga0496106_0001061 3300048909 Bacteria 20265
280 nmdc:mga05p37_199802_c1 3300050507 Bacteria 2422
281 nmdc:mga09592_57792_c1 3300050508 Bacteria 3279
282 nmdc:mga0qj67_134307_c1 3300050509 Bacteria 2005
283 nmdc:mga0qj67_45884_c1 3300050509 Bacteria 3448
284 nmdc:mga0qj67_5713_c1 3300050509 Bacteria 9101
285 nmdc:mga06r32_38885_c1 3300050510 Bacteria 4510
286 nmdc:mga06r32_95493_c1 3300050510 Bacteria 2910
287 nmdc:mga08y16_387161_c1 3300050511 Bacteria 1433
288 nmdc:mga08y16_746696_c1 3300050511 Unclassified 975
289 nmdc:mga0n895_1138939_c1 3300050512 Unclassified 756
290 nmdc:mga0n895_180557_c1 3300050512 Bacteria 2142
291 nmdc:mga0n895_733951_c1 3300050512 Bacteria 982
292 nmdc:mga0n895_8996_c1 3300050512 Bacteria 8705
293 nmdc:mga0rr50_3767_c1 3300050513 Bacteria 8793
294 nmdc:mga0rr50_995962_c1 3300050513 Unclassified 714
295 nmdc:mga08x19_279000_c1 3300050514 Unclassified 1157
296 nmdc:mga08x19_696326_c1 3300050514 Bacteria 721
297 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
298 nmdc:mga0a205_120621_c1 3300050515 Bacteria 2521
299 nmdc:mga0a205_172244_c1 3300050515 Bacteria 1022
300 nmdc:mga0a205_96516_c1 3300050515 Bacteria 2855
301 Ga0495612_0115744 3300053078 Bacteria 1151
302 Ga0495595_0048143 3300053084 Bacteria 1968
303 Ga0495619_0009340 3300053085 Bacteria 6190
304 Ga0495619_0178323 3300053085 Bacteria 1470

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_1101152 Ga0373937_1101152_42_431 129
2 3300046472 Ga0495580_0444293 Ga0495580_0444293_469_858 129
3 3300005328 Ga0070676_10283375 Ga0070676_102833752 138
4 3300006881 Ga0068865_100107062 Ga0068865_1001070624 138
5 3300025935 Ga0207709_10297372 Ga0207709_102973722 138
6 3300025938 Ga0207704_10072800 Ga0207704_100728004 138
7 3300005468 Ga0070707_100000107 Ga0070707_10000010761 143
8 3300025922 Ga0207646_10000543 Ga0207646_1000054321 143
9 3300006871 Ga0075434_100776382 Ga0075434_1007763822 144
10 3300009147 Ga0114129_10143527 Ga0114129_101435272 144
11 3300050507 nmdc:mga05p37_199802_c1 nmdc:mga05p37_199802_c1_1247_1729 144
12 3300050515 nmdc:mga0a205_120621_c1 nmdc:mga0a205_120621_c1_1454_1936 144
13 3300005471 Ga0070698_100212472 Ga0070698_1002124722 145
14 3300005439 Ga0070711_100794116 Ga0070711_1007941162 147
15 3300005458 Ga0070681_10375111 Ga0070681_103751112 147
16 3300035113 Ga0373936_0026640 Ga0373936_0026640_77_547 147
17 3300035117 Ga0373953_0518907 Ga0373953_0518907_58_519 147
18 3300035119 Ga0373956_0107550 Ga0373956_0107550_109_567 147
19 3300035170 Ga0373943_0006056 Ga0373943_0006056_2417_2887 147
20 3300035171 Ga0373946_0009458 Ga0373946_0009458_847_1317 147
21 3300035172 Ga0373955_0008814 Ga0373955_0008814_4192_4650 147
22 3300035725 Ga0373947_0009269 Ga0373947_0009269_4543_5013 147
23 3300036401 Ga0373937_0231304 Ga0373937_0231304_1014_1484 147
24 3300036401 Ga0373937_0616211 Ga0373937_0616211_436_897 147
25 3300046472 Ga0495580_0579152 Ga0495580_0579152_254_706 147
26 3300046511 Ga0495608_0025785 Ga0495608_0025785_2443_2901 147
27 3300046516 Ga0495628_0197385 Ga0495628_0197385_249_707 147
28 3300046517 Ga0495630_0005097 Ga0495630_0005097_8353_8811 147
29 3300046533 Ga0495640_0036447 Ga0495640_0036447_221_679 147
30 3300046642 Ga0495634_0192203 Ga0495634_0192203_620_1078 147
31 3300046663 Ga0495635_0282491 Ga0495635_0282491_229_687 147
32 3300046675 Ga0495657_0092452 Ga0495657_0092452_1063_1521 147
33 3300046678 Ga0495599_0118054 Ga0495599_0118054_466_924 147
34 3300046689 Ga0495613_0000599 Ga0495613_0000599_17292_17750 147
35 3300046689 Ga0495613_0349725 Ga0495613_0349725_44_514 147
36 3300046690 Ga0495624_0127090 Ga0495624_0127090_383_841 147
37 3300046809 Ga0495600_0251266 Ga0495600_0251266_222_680 147
38 3300047315 Ga0495581_0028412 Ga0495581_0028412_2146_2604 147
39 3300047319 Ga0495674_0065054 Ga0495674_0065054_954_1412 147
40 3300047444 Ga0495675_0134875 Ga0495675_0134875_868_1326 147
41 3300047471 Ga0495684_0000310 Ga0495684_0000310_10929_11387 147
42 3300048088 Ga0495602_0469266 Ga0495602_0469266_300_761 147
43 3300053078 Ga0495612_0115744 Ga0495612_0115744_318_776 147
44 3300053084 Ga0495595_0048143 Ga0495595_0048143_1231_1692 147
45 3300053085 Ga0495619_0009340 Ga0495619_0009340_3019_3477 147
46 3300053085 Ga0495619_0178323 Ga0495619_0178323_980_1441 147
47 3300009553 Ga0105249_11476284 Ga0105249_114762841 152
48 3300005293 Ga0065715_10521973 Ga0065715_105219732 156
49 3300005471 Ga0070698_101055993 Ga0070698_1010559932 157
50 3300005549 Ga0070704_101075062 Ga0070704_1010750621 157
51 3300005437 Ga0070710_10537629 Ga0070710_105376292 158
52 3300005444 Ga0070694_100052430 Ga0070694_1000524303 158
53 3300005544 Ga0070686_101181550 Ga0070686_1011815501 158
54 3300005547 Ga0070693_100098482 Ga0070693_1000984823 158
55 3300005617 Ga0068859_100952189 Ga0068859_1009521892 158
56 3300005719 Ga0068861_100048577 Ga0068861_1000485774 158
57 3300005842 Ga0068858_100147301 Ga0068858_1001473013 158
58 3300006237 Ga0097621_101204488 Ga0097621_1012044882 158
59 3300006358 Ga0068871_100660358 Ga0068871_1006603582 158
60 3300006871 Ga0075434_101208935 Ga0075434_1012089352 158
61 3300006931 Ga0097620_100952085 Ga0097620_1009520852 158
62 3300009101 Ga0105247_10480005 Ga0105247_104800052 158
63 3300009148 Ga0105243_10257634 Ga0105243_102576342 158
64 3300009176 Ga0105242_10365097 Ga0105242_103650972 158
65 3300009177 Ga0105248_10406121 Ga0105248_104061212 158
66 3300009177 Ga0105248_10456400 Ga0105248_104564002 158
67 3300013297 Ga0157378_10358843 Ga0157378_103588432 158
68 3300013297 Ga0157378_10900130 Ga0157378_109001302 158
69 3300013306 Ga0163162_10207060 Ga0163162_102070603 158
70 3300013306 Ga0163162_10990063 Ga0163162_109900632 158
71 3300017792 Ga0163161_10410790 Ga0163161_104107902 158
72 3300025918 Ga0207662_10016043 Ga0207662_100160435 158
73 3300025934 Ga0207686_10000127 Ga0207686_1000012721 158
74 3300025935 Ga0207709_10417971 Ga0207709_104179712 158
75 3300025935 Ga0207709_10465579 Ga0207709_104655792 158
76 3300025960 Ga0207651_10083005 Ga0207651_100830052 158
77 3300026035 Ga0207703_10155723 Ga0207703_101557231 158
78 3300026095 Ga0207676_10179495 Ga0207676_101794952 158
79 3300026118 Ga0207675_100519333 Ga0207675_1005193332 158
80 3300028380 Ga0268265_12611582 Ga0268265_126115821 158
81 3300046642 Ga0495634_0196055 Ga0495634_0196055_47_529 158
82 3300001426 JGI24030J14995_100112 JGI24030J14995_1001122 159
83 3300001432 JGI24034J14986_101297 JGI24034J14986_1012972 159
84 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001340 159
85 3300002239 JGI24034J26672_10000001 JGI24034J26672_1000000177 159
86 3300003203 JGI25406J46586_10017323 JGI25406J46586_100173232 159
87 3300005289 Ga0065704_10451392 Ga0065704_104513922 159
88 3300005293 Ga0065715_10496410 Ga0065715_104964101 159
89 3300005295 Ga0065707_10084507 Ga0065707_100845075 159
90 3300005295 Ga0065707_10191752 Ga0065707_101917522 159
91 3300005330 Ga0070690_100071973 Ga0070690_1000719733 159
92 3300005334 Ga0068869_100261306 Ga0068869_1002613062 159
93 3300005340 Ga0070689_100367016 Ga0070689_1003670162 159
94 3300005341 Ga0070691_10829752 Ga0070691_108297521 159
95 3300005343 Ga0070687_100043858 Ga0070687_1000438582 159
96 3300005345 Ga0070692_10250874 Ga0070692_102508741 159
97 3300005353 Ga0070669_100129282 Ga0070669_1001292823 159
98 3300005354 Ga0070675_100170986 Ga0070675_1001709862 159
99 3300005355 Ga0070671_100311708 Ga0070671_1003117082 159
100 3300005355 Ga0070671_101069089 Ga0070671_1010690891 159
101 3300005364 Ga0070673_100346254 Ga0070673_1003462542 159
102 3300005367 Ga0070667_101386974 Ga0070667_1013869742 159
103 3300005406 Ga0070703_10000049 Ga0070703_1000004914 159
104 3300005406 Ga0070703_10026830 Ga0070703_100268302 159
105 3300005437 Ga0070710_10634778 Ga0070710_106347782 159
106 3300005438 Ga0070701_10031103 Ga0070701_100311032 159
107 3300005440 Ga0070705_100202257 Ga0070705_1002022572 159
108 3300005441 Ga0070700_100001704 Ga0070700_1000017046 159
109 3300005441 Ga0070700_100241365 Ga0070700_1002413652 159
110 3300005444 Ga0070694_100005491 Ga0070694_1000054915 159
111 3300005444 Ga0070694_100067224 Ga0070694_1000672242 159
112 3300005444 Ga0070694_100134087 Ga0070694_1001340872 159
113 3300005444 Ga0070694_100293348 Ga0070694_1002933482 159
114 3300005444 Ga0070694_100318533 Ga0070694_1003185332 159
115 3300005444 Ga0070694_100759151 Ga0070694_1007591512 159
116 3300005444 Ga0070694_101092993 Ga0070694_1010929931 159
117 3300005445 Ga0070708_100435736 Ga0070708_1004357362 159
118 3300005445 Ga0070708_100478218 Ga0070708_1004782182 159
119 3300005445 Ga0070708_101187212 Ga0070708_1011872121 159
120 3300005459 Ga0068867_100475672 Ga0068867_1004756721 159
121 3300005459 Ga0068867_101804662 Ga0068867_1018046621 159
122 3300005467 Ga0070706_100134623 Ga0070706_1001346233 159
123 3300005467 Ga0070706_100324028 Ga0070706_1003240282 159
124 3300005467 Ga0070706_100462704 Ga0070706_1004627042 159
125 3300005468 Ga0070707_100003181 Ga0070707_10000318112 159
126 3300005468 Ga0070707_100049227 Ga0070707_1000492272 159
127 3300005468 Ga0070707_100085947 Ga0070707_1000859474 159
128 3300005468 Ga0070707_100104089 Ga0070707_1001040892 159
129 3300005468 Ga0070707_101079124 Ga0070707_1010791241 159
130 3300005468 Ga0070707_101673149 Ga0070707_1016731491 159
131 3300005468 Ga0070707_102004131 Ga0070707_1020041311 159
132 3300005471 Ga0070698_100000063 Ga0070698_10000006325 159
133 3300005471 Ga0070698_100058886 Ga0070698_1000588866 159
134 3300005471 Ga0070698_100074006 Ga0070698_1000740063 159
135 3300005471 Ga0070698_100109499 Ga0070698_1001094993 159
136 3300005471 Ga0070698_100146747 Ga0070698_1001467472 159
137 3300005471 Ga0070698_100227677 Ga0070698_1002276773 159
138 3300005471 Ga0070698_100931300 Ga0070698_1009313002 159
139 3300005518 Ga0070699_100128227 Ga0070699_1001282272 159
140 3300005518 Ga0070699_100180760 Ga0070699_1001807602 159
141 3300005518 Ga0070699_100436830 Ga0070699_1004368302 159
142 3300005518 Ga0070699_101623213 Ga0070699_1016232131 159
143 3300005536 Ga0070697_100016574 Ga0070697_1000165747 159
144 3300005536 Ga0070697_100044328 Ga0070697_1000443282 159
145 3300005536 Ga0070697_100759141 Ga0070697_1007591412 159
146 3300005543 Ga0070672_100432377 Ga0070672_1004323772 159
147 3300005544 Ga0070686_100023684 Ga0070686_1000236844 159
148 3300005544 Ga0070686_100088003 Ga0070686_1000880032 159
149 3300005544 Ga0070686_100189730 Ga0070686_1001897302 159
150 3300005545 Ga0070695_100119583 Ga0070695_1001195832 159
151 3300005545 Ga0070695_100145002 Ga0070695_1001450022 159
152 3300005545 Ga0070695_101027642 Ga0070695_1010276421 159
153 3300005546 Ga0070696_100525297 Ga0070696_1005252972 159
154 3300005546 Ga0070696_100621991 Ga0070696_1006219912 159
155 3300005549 Ga0070704_100000588 Ga0070704_1000005886 159
156 3300005549 Ga0070704_100077876 Ga0070704_1000778762 159
157 3300005549 Ga0070704_100415046 Ga0070704_1004150462 159
158 3300005549 Ga0070704_100617621 Ga0070704_1006176211 159
159 3300005578 Ga0068854_100089075 Ga0068854_1000890753 159
160 3300005617 Ga0068859_100028738 Ga0068859_1000287383 159
161 3300005617 Ga0068859_100037974 Ga0068859_1000379743 159
162 3300005617 Ga0068859_100131903 Ga0068859_1001319035 159
163 3300005618 Ga0068864_100276764 Ga0068864_1002767642 159
164 3300005841 Ga0068863_100362401 Ga0068863_1003624012 159
165 3300005842 Ga0068858_100000051 Ga0068858_10000005130 159
166 3300005842 Ga0068858_100108593 Ga0068858_1001085932 159
167 3300005842 Ga0068858_101501959 Ga0068858_1015019592 159
168 3300005844 Ga0068862_100008314 Ga0068862_1000083145 159
169 3300005844 Ga0068862_100548437 Ga0068862_1005484371 159
170 3300005985 Ga0081539_10000666 Ga0081539_1000066660 159
171 3300005985 Ga0081539_10224887 Ga0081539_102248871 159
172 3300006163 Ga0070715_10000025 Ga0070715_1000002575 159
173 3300006173 Ga0070716_100000003 Ga0070716_10000000337 159
174 3300006844 Ga0075428_100529202 Ga0075428_1005292022 159
175 3300006846 Ga0075430_100004320 Ga0075430_1000043208 159
176 3300006846 Ga0075430_100078261 Ga0075430_1000782614 159
177 3300006846 Ga0075430_100088096 Ga0075430_1000880962 159
178 3300006847 Ga0075431_100007356 Ga0075431_10000735611 159
179 3300006852 Ga0075433_10053966 Ga0075433_100539663 159
180 3300006852 Ga0075433_10652530 Ga0075433_106525302 159
181 3300006871 Ga0075434_100126206 Ga0075434_1001262062 159
182 3300006871 Ga0075434_100127124 Ga0075434_1001271242 159
183 3300006871 Ga0075434_100181967 Ga0075434_1001819672 159
184 3300006871 Ga0075434_100736261 Ga0075434_1007362612 159
185 3300006880 Ga0075429_100008602 Ga0075429_1000086028 159
186 3300006880 Ga0075429_100466295 Ga0075429_1004662952 159
187 3300006914 Ga0075436_100000002 Ga0075436_100000002228 159
188 3300006914 Ga0075436_100233025 Ga0075436_1002330252 159
189 3300006931 Ga0097620_100028740 Ga0097620_1000287403 159
190 3300006931 Ga0097620_100037976 Ga0097620_1000379763 159
191 3300006931 Ga0097620_100131901 Ga0097620_1001319015 159
192 3300007076 Ga0075435_100005602 Ga0075435_10000560210 159
193 3300007076 Ga0075435_100562880 Ga0075435_1005628802 159
194 3300007265 Ga0099794_10005067 Ga0099794_100050674 159
195 3300009094 Ga0111539_10144414 Ga0111539_101444143 159
196 3300009094 Ga0111539_11081560 Ga0111539_110815601 159
197 3300009098 Ga0105245_11774761 Ga0105245_117747611 159
198 3300009101 Ga0105247_10000004 Ga0105247_10000004122 159
199 3300009148 Ga0105243_10000037 Ga0105243_1000003738 159
200 3300009148 Ga0105243_10000446 Ga0105243_100004464 159
201 3300009148 Ga0105243_10406507 Ga0105243_104065072 159
202 3300009176 Ga0105242_10001013 Ga0105242_1000101314 159
203 3300009176 Ga0105242_10003928 Ga0105242_100039285 159
204 3300009176 Ga0105242_10845518 Ga0105242_108455182 159
205 3300009177 Ga0105248_12259484 Ga0105248_122594841 159
206 3300009553 Ga0105249_10033755 Ga0105249_100337552 159
207 3300009553 Ga0105249_10286885 Ga0105249_102868851 159
208 3300009553 Ga0105249_11363840 Ga0105249_113638401 159
209 3300010375 Ga0105239_10043633 Ga0105239_100436332 159
210 3300010375 Ga0105239_11861548 Ga0105239_118615481 159
211 3300013102 Ga0157371_10158129 Ga0157371_101581291 159
212 3300013297 Ga0157378_10000004 Ga0157378_10000004104 159
213 3300013297 Ga0157378_10015793 Ga0157378_100157935 159
214 3300013297 Ga0157378_10019632 Ga0157378_100196323 159
215 3300013297 Ga0157378_10108589 Ga0157378_101085893 159
216 3300013306 Ga0163162_10010975 Ga0163162_100109754 159
217 3300013308 Ga0157375_10000479 Ga0157375_1000047915 159
218 3300014968 Ga0157379_10069966 Ga0157379_100699661 159
219 3300017792 Ga0163161_10004588 Ga0163161_100045882 159
220 3300025223 Ga0207672_1000002 Ga0207672_10000026 159
221 3300025885 Ga0207653_10000163 Ga0207653_1000016334 159
222 3300025885 Ga0207653_10009719 Ga0207653_100097192 159
223 3300025900 Ga0207710_10000002 Ga0207710_10000002892 159
224 3300025905 Ga0207685_10000008 Ga0207685_10000008119 159
225 3300025906 Ga0207699_10057965 Ga0207699_100579653 159
226 3300025910 Ga0207684_10003514 Ga0207684_100035142 159
227 3300025910 Ga0207684_10253717 Ga0207684_102537172 159
228 3300025910 Ga0207684_10305621 Ga0207684_103056212 159
229 3300025910 Ga0207684_10521104 Ga0207684_105211042 159
230 3300025918 Ga0207662_10064160 Ga0207662_100641603 159
231 3300025918 Ga0207662_10084795 Ga0207662_100847952 159
232 3300025922 Ga0207646_10004949 Ga0207646_100049492 159
233 3300025922 Ga0207646_10011440 Ga0207646_100114404 159
234 3300025922 Ga0207646_10042513 Ga0207646_100425134 159
235 3300025922 Ga0207646_10089140 Ga0207646_100891402 159
236 3300025922 Ga0207646_11255484 Ga0207646_112554842 159
237 3300025922 Ga0207646_11474283 Ga0207646_114742831 159
238 3300025931 Ga0207644_10000179 Ga0207644_1000017931 159
239 3300025934 Ga0207686_10000003 Ga0207686_10000003227 159
240 3300025934 Ga0207686_10000965 Ga0207686_1000096514 159
241 3300025934 Ga0207686_10731715 Ga0207686_107317152 159
242 3300025934 Ga0207686_11433044 Ga0207686_114330441 159
243 3300025935 Ga0207709_10000017 Ga0207709_10000017286 159
244 3300025935 Ga0207709_10003560 Ga0207709_100035608 159
245 3300025936 Ga0207670_10365169 Ga0207670_103651692 159
246 3300025939 Ga0207665_10000003 Ga0207665_1000000381 159
247 3300025940 Ga0207691_10707558 Ga0207691_107075582 159
248 3300025942 Ga0207689_10073696 Ga0207689_100736963 159
249 3300025960 Ga0207651_10399521 Ga0207651_103995212 159
250 3300025961 Ga0207712_10093283 Ga0207712_100932832 159
251 3300025961 Ga0207712_10622255 Ga0207712_106222552 159
252 3300025981 Ga0207640_10438705 Ga0207640_104387052 159
253 3300025986 Ga0207658_11555560 Ga0207658_115555601 159
254 3300026035 Ga0207703_10000114 Ga0207703_1000011442 159
255 3300026035 Ga0207703_10425079 Ga0207703_104250792 159
256 3300026075 Ga0207708_10003764 Ga0207708_100037642 159
257 3300026075 Ga0207708_10621143 Ga0207708_106211432 159
258 3300026075 Ga0207708_10812654 Ga0207708_108126542 159
259 3300026088 Ga0207641_10167637 Ga0207641_101676372 159
260 3300026088 Ga0207641_10340009 Ga0207641_103400092 159
261 3300026089 Ga0207648_10211489 Ga0207648_102114892 159
262 3300026095 Ga0207676_10379037 Ga0207676_103790373 159
263 3300026118 Ga0207675_100045308 Ga0207675_1000453082 159
264 3300027907 Ga0207428_10001780 Ga0207428_100017808 159
265 3300028380 Ga0268265_10072698 Ga0268265_100726981 159
266 3300028381 Ga0268264_10122673 Ga0268264_101226732 159
267 3300031852 Ga0307410_10027216 Ga0307410_100272165 159
268 3300032002 Ga0307416_101194398 Ga0307416_1011943982 159
269 3300032005 Ga0307411_10073993 Ga0307411_100739933 159
270 3300037471 Ga0395905_0172119 Ga0395905_0172119_1304_1828 159
271 3300042876 Ga0451577_0098499 Ga0451577_0098499_317_802 159
272 3300044673 Ga0453683_0185042 Ga0453683_0185042_584_1069 159
273 3300044712 Ga0453684_0490336 Ga0453684_0490336_764_1249 159
274 3300045051 Ga0451576_0095940 Ga0451576_0095940_133_618 159
275 3300045051 Ga0451576_1020669 Ga0451576_1020669_331_816 159
276 3300045051 Ga0451576_1429816 Ga0451576_1429816_193_678 159
277 3300046517 Ga0495630_0082283 Ga0495630_0082283_1488_1988 159
278 3300046537 Ga0495598_0014643 Ga0495598_0014643_716_1201 159
279 3300046539 Ga0495621_0187321 Ga0495621_0187321_102_587 159
280 3300046689 Ga0495613_0213678 Ga0495613_0213678_495_995 159
281 3300046809 Ga0495600_0255127 Ga0495600_0255127_135_635 159
282 3300047318 Ga0495636_0014016 Ga0495636_0014016_1235_1720 159
283 3300047471 Ga0495684_0094079 Ga0495684_0094079_87_587 159
284 3300048904 Ga0496101_0756520 Ga0496101_0756520_208_693 159
285 3300048909 Ga0496106_0001061 Ga0496106_0001061_13218_13703 159
286 3300050508 nmdc:mga09592_57792_c1 nmdc:mga09592_57792_c1_1252_1737 159
287 3300050509 nmdc:mga0qj67_134307_c1 nmdc:mga0qj67_134307_c1_157_693 159
288 3300050509 nmdc:mga0qj67_45884_c1 nmdc:mga0qj67_45884_c1_303_833 159
289 3300050509 nmdc:mga0qj67_5713_c1 nmdc:mga0qj67_5713_c1_7949_8473 159
290 3300050510 nmdc:mga06r32_38885_c1 nmdc:mga06r32_38885_c1_3122_3646 159
291 3300050510 nmdc:mga06r32_95493_c1 nmdc:mga06r32_95493_c1_1388_1918 159
292 3300050511 nmdc:mga08y16_387161_c1 nmdc:mga08y16_387161_c1_353_838 159
293 3300050511 nmdc:mga08y16_746696_c1 nmdc:mga08y16_746696_c1_210_695 159
294 3300050512 nmdc:mga0n895_1138939_c1 nmdc:mga0n895_1138939_c1_118_603 159
295 3300050512 nmdc:mga0n895_180557_c1 nmdc:mga0n895_180557_c1_1315_1794 159
296 3300050512 nmdc:mga0n895_733951_c1 nmdc:mga0n895_733951_c1_95_580 159
297 3300050512 nmdc:mga0n895_8996_c1 nmdc:mga0n895_8996_c1_7979_8467 159
298 3300050513 nmdc:mga0rr50_3767_c1 nmdc:mga0rr50_3767_c1_7149_7631 159
299 3300050513 nmdc:mga0rr50_995962_c1 nmdc:mga0rr50_995962_c1_214_693 159
300 3300050514 nmdc:mga08x19_279000_c1 nmdc:mga08x19_279000_c1_211_690 159
301 3300050514 nmdc:mga08x19_696326_c1 nmdc:mga08x19_696326_c1_145_630 159
302 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_152496_152978 159
303 3300050515 nmdc:mga0a205_172244_c1 nmdc:mga0a205_172244_c1_242_727 159
304 3300050515 nmdc:mga0a205_96516_c1 nmdc:mga0a205_96516_c1_1153_1638 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

7

155

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.7896 1 156
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.7828 1 157
5cqv-assembly1.cif.gz_B crystal structure of uncharacterized protein q8dwv2 from streptococcus agalactiae 0.7651 4 115
3gor-assembly2.cif.gz_D crystal structure of putative metal-dependent hydrolase apc36150 0.7592 4 157
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.7569 1 157
ID Description Score Start End Superfamily
5cqvB01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7651 4 115 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7615 1 157 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7557 1 157 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7177 5 153 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7156 1 157 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1Q8AJA5-F1-model_v4 DinB-like domain-containing protein 0.9933 22 156
AF-A0A7W0JEZ4-F1-model_v4 DinB family protein 0.9909 1 157
AF-A0A849NEV3-F1-model_v4 DinB family protein 0.988 1 156
AF-A0A2V7HCF2-F1-model_v4 DinB family protein 0.9869 1 155
AF-A0A2V8QA31-F1-model_v4 DinB-like domain-containing protein 0.9868 4 159

Feature Viewer

pLDDT pTM Quality
94.86 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map