F397275

General Info

Members Datasets Scaffolds Average Seq Length
303 194 606 141

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0049124|Ga0501041_0049124_1561_2070
Length 169
Sequence MKAEGQAAAGGTPAPDCNPERRTTMRFMVMVKASKDSEAGKLPSEEGLAAMAKFNEEMVKAGVMLDGNGLQSSSKGARIRFTGGRLGDRTSPRAVIDGPFAETKELIAGYWIIQVRDRAEAIEWIKRCPKPHDGDCEIEIRQMFELEDFGESPAVEQHRKLGEEIAGKK

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
138 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
139 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
140 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
188 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
189 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
191 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
192 2643221616 Leifsonia sp. Root227 Isolate Unclassified
193 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
194 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.91
Nodule 0
Rhizoplane 2.31
Rhizosphere 84.49
Stem 0
Stem Tuber 0.33
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0049124 3300049577 Bacteria 2570
2 JGI25164J39214_1001029 3300002772 Bacteria 8515
3 JGI25406J46586_10011181 3300003203 Bacteria 3945
4 JGI25165J46597_1000269 3300003214 Bacteria 67008
5 Ga0065704_10245363 3300005289 Bacteria 1004
6 Ga0065715_10151347 3300005293 Unclassified 1725
7 Ga0065707_10087064 3300005295 Bacteria 5183
8 Ga0070676_10648489 3300005328 Bacteria 766
9 Ga0070690_100732703 3300005330 Bacteria 762
10 Ga0068869_100002739 3300005334 Bacteria 10667
11 Ga0070689_100078869 3300005340 Bacteria 2582
12 Ga0070689_100780765 3300005340 Bacteria 839
13 Ga0070668_100348384 3300005347 Bacteria 1253
14 Ga0070674_100653303 3300005356 Bacteria 894
15 Ga0070703_10385033 3300005406 Bacteria 607
16 Ga0070709_10055671 3300005434 Bacteria 2498
17 Ga0070709_10066129 3300005434 Bacteria 2318
18 Ga0070709_10159461 3300005434 Bacteria 1567
19 Ga0070709_10801434 3300005434 Bacteria 739
20 Ga0070701_10555321 3300005438 Bacteria 754
21 Ga0070711_100013600 3300005439 Bacteria 5113
22 Ga0070711_100126763 3300005439 Bacteria 1896
23 Ga0070711_101668518 3300005439 Bacteria 558
24 Ga0070705_100061952 3300005440 Bacteria 2225
25 Ga0070705_100064876 3300005440 Bacteria 2184
26 Ga0070700_100715236 3300005441 Bacteria 798
27 Ga0070694_101110294 3300005444 Bacteria 660
28 Ga0070694_101859588 3300005444 Bacteria 514
29 Ga0070708_100014351 3300005445 Bacteria 6516
30 Ga0070708_100025998 3300005445 Bacteria 5006
31 Ga0070708_100553904 3300005445 Bacteria 1084
32 Ga0070708_100900409 3300005445 Bacteria 831
33 Ga0070708_101160026 3300005445 Bacteria 723
34 Ga0070706_100000511 3300005467 Bacteria 45508
35 Ga0070706_100001077 3300005467 Bacteria 29535
36 Ga0070706_100027598 3300005467 Bacteria 5224
37 Ga0070706_100145223 3300005467 Bacteria 2215
38 Ga0070706_100215955 3300005467 Bacteria 1790
39 Ga0070706_100429439 3300005467 Bacteria 1229
40 Ga0070707_100064491 3300005468 Bacteria 3517
41 Ga0070707_100101931 3300005468 Bacteria 2781
42 Ga0070707_101577047 3300005468 Bacteria 623
43 Ga0070707_101619511 3300005468 Bacteria 614
44 Ga0070698_100000604 3300005471 Bacteria 38578
45 Ga0070698_100000976 3300005471 Bacteria 31424
46 Ga0070698_100001953 3300005471 Bacteria 22886
47 Ga0070698_100032981 3300005471 Bacteria 5365
48 Ga0070698_100034809 3300005471 Bacteria 5211
49 Ga0070698_100087828 3300005471 Bacteria 3095
50 Ga0070698_100318556 3300005471 Bacteria 1486
51 Ga0070699_100000756 3300005518 Bacteria 29876
52 Ga0070699_100017249 3300005518 Bacteria 6200
53 Ga0070699_100127273 3300005518 Bacteria 2243
54 Ga0070699_100187699 3300005518 Bacteria 1836
55 Ga0070699_100822749 3300005518 Bacteria 850
56 Ga0070697_100006794 3300005536 Bacteria 8878
57 Ga0070697_100345477 3300005536 Bacteria 1284
58 Ga0070697_100748280 3300005536 Bacteria 864
59 Ga0070672_102162430 3300005543 Bacteria 502
60 Ga0070695_100052097 3300005545 Bacteria 2629
61 Ga0070695_100179658 3300005545 Bacteria 1499
62 Ga0070696_100003969 3300005546 Bacteria 9870
63 Ga0070693_100852691 3300005547 Bacteria 679
64 Ga0070665_100172036 3300005548 Bacteria 2167
65 Ga0070704_100078393 3300005549 Bacteria 2424
66 Ga0070664_101641297 3300005564 Bacteria 609
67 Ga0070664_102204321 3300005564 Bacteria 523
68 Ga0068854_100401916 3300005578 Bacteria 1134
69 Ga0068864_101402623 3300005618 Bacteria 700
70 Ga0068866_10435182 3300005718 Bacteria 854
71 Ga0068863_100002866 3300005841 Bacteria 17075
72 Ga0068858_100246341 3300005842 Bacteria 1697
73 Ga0068860_102121323 3300005843 Bacteria 583
74 Ga0068862_100045877 3300005844 Bacteria 3729
75 Ga0068862_100882276 3300005844 Bacteria 878
76 Ga0081455_10024574 3300005937 Bacteria 5577
77 Ga0081539_10010617 3300005985 Bacteria 7435
78 Ga0075368_10064180 3300006042 Bacteria 1474
79 Ga0075363_100007280 3300006048 Bacteria 5075
80 Ga0075363_100835119 3300006048 Bacteria 562
81 Ga0070716_100396640 3300006173 Bacteria 991
82 Ga0070712_100024805 3300006175 Bacteria 3978
83 Ga0075362_10002292 3300006177 Bacteria 6389
84 Ga0075362_10119054 3300006177 Bacteria 1249
85 Ga0075367_10192900 3300006178 Bacteria 1271
86 Ga0097621_100661289 3300006237 Bacteria 959
87 Ga0075370_10184709 3300006353 Bacteria 1228
88 Ga0068871_101508635 3300006358 Bacteria 635
89 Ga0075428_100002094 3300006844 Bacteria 21519
90 Ga0075428_100024290 3300006844 Bacteria 6705
91 Ga0075430_100000157 3300006846 Bacteria 44474
92 Ga0075430_100313710 3300006846 Bacteria 1297
93 Ga0075431_100437080 3300006847 Bacteria 1306
94 Ga0075433_10006639 3300006852 Bacteria 9161
95 Ga0075434_100003017 3300006871 Bacteria 14963
96 Ga0075434_100008615 3300006871 Bacteria 9497
97 Ga0075434_100030637 3300006871 Bacteria 5299
98 Ga0075434_101549351 3300006871 Bacteria 672
99 Ga0075429_100668696 3300006880 Bacteria 910
100 Ga0075429_100858306 3300006880 Bacteria 795
101 Ga0068865_101749244 3300006881 Bacteria 561
102 Ga0075436_100016510 3300006914 Bacteria 5054
103 Ga0075435_100018843 3300007076 Bacteria 5259
104 Ga0075435_100134514 3300007076 Bacteria 2070
105 Ga0075435_100880422 3300007076 Bacteria 781
106 Ga0105244_10017725 3300009036 Bacteria 4016
107 Ga0105250_10259975 3300009092 Bacteria 743
108 Ga0105245_10925338 3300009098 Bacteria 914
109 Ga0114129_10095768 3300009147 Bacteria 4111
110 Ga0114129_10225706 3300009147 Bacteria 2524
111 Ga0114129_10365509 3300009147 Bacteria 1908
112 Ga0105237_10038643 3300009545 Bacteria 4819
113 Ga0105249_11341887 3300009553 Bacteria 787
114 Ga0157370_11443607 3300013104 Bacteria 619
115 Ga0157374_10409533 3300013296 Bacteria 1353
116 Ga0157378_10048584 3300013297 Bacteria 3773
117 Ga0157372_10056909 3300013307 Bacteria 4370
118 Ga0157375_12580754 3300013308 Bacteria 607
119 Ga0157379_10360499 3300014968 Bacteria 1332
120 Ga0157379_10903970 3300014968 Bacteria 838
121 Ga0182005_1143398 3300015265 Bacteria 691
122 Ga0213876_10031222 3300021384 Bacteria 2812
123 Ga0207427_100054 3300025231 Bacteria 216315
124 Ga0209437_101532 3300025233 Bacteria 5427
125 Ga0209233_1000001 3300025261 Bacteria 2992747
126 Ga0207653_10437377 3300025885 Bacteria 513
127 Ga0207699_10137202 3300025906 Bacteria 1603
128 Ga0207699_10455044 3300025906 Bacteria 919
129 Ga0207645_10243793 3300025907 Bacteria 1188
130 Ga0207684_10009982 3300025910 Bacteria 8370
131 Ga0207684_10121230 3300025910 Bacteria 2242
132 Ga0207684_10162917 3300025910 Bacteria 1921
133 Ga0207684_10215289 3300025910 Bacteria 1657
134 Ga0207671_10148007 3300025914 Bacteria 1813
135 Ga0207693_10076627 3300025915 Bacteria 2619
136 Ga0207663_10133424 3300025916 Bacteria 1719
137 Ga0207663_10159470 3300025916 Bacteria 1591
138 Ga0207646_10006460 3300025922 Bacteria 12102
139 Ga0207646_10065825 3300025922 Bacteria 3235
140 Ga0207646_10622119 3300025922 Bacteria 968
141 Ga0207670_10178895 3300025936 Bacteria 1596
142 Ga0207691_10390498 3300025940 Bacteria 1187
143 Ga0207711_11698828 3300025941 Bacteria 575
144 Ga0207689_10006937 3300025942 Bacteria 9957
145 Ga0207689_10272279 3300025942 Bacteria 1402
146 Ga0207679_10921592 3300025945 Bacteria 799
147 Ga0207651_10767069 3300025960 Bacteria 853
148 Ga0207708_10211007 3300026075 Bacteria 1552
149 Ga0207708_10335677 3300026075 Bacteria 1237
150 Ga0207641_10001417 3300026088 Bacteria 23642
151 Ga0207676_11251388 3300026095 Bacteria 736
152 Ga0207675_101570651 3300026118 Bacteria 678
153 Ga0209813_10044143 3300027866 Bacteria 1369
154 Ga0207428_10788309 3300027907 Bacteria 676
155 Ga0268266_10223017 3300028379 Bacteria 1734
156 Ga0268265_10144324 3300028380 Bacteria 1997
157 Ga0268265_11512125 3300028380 Bacteria 675
158 Ga0307508_10452193 3300031616 Bacteria 877
159 Ga0307516_10809486 3300031730 Unclassified 599
160 Ga0307413_10022508 3300031824 Bacteria 3398
161 Ga0373945_0189218 3300035116 Bacteria 850
162 Ga0373955_0042107 3300035172 Bacteria 2451
163 Ga0373924_0150783 3300035410 Bacteria 1017
164 Ga0373931_0723482 3300035691 Bacteria 659
165 Ga0373935_0592304 3300035692 Bacteria 810
166 Ga0373927_0293601 3300035695 Bacteria 1070
167 Ga0373937_0159101 3300036401 Bacteria 2117
168 Ga0395905_0288143 3300037471 Bacteria 1529
169 Ga0436364_1096788 3300037853 Bacteria 785
170 Ga0436365_1112648 3300039437 Bacteria 1174
171 Ga0436365_1202517 3300039437 Bacteria 2974
172 Ga0436362_0581029 3300039453 Bacteria 951
173 Ga0495629_0815358 3300046459 Bacteria 615
174 Ga0495580_0262306 3300046472 Bacteria 1181
175 Ga0495582_0100466 3300046473 Bacteria 1619
176 Ga0495664_0046762 3300046477 Bacteria 2568
177 Ga0495628_0032232 3300046516 Bacteria 4232
178 Ga0495628_0275430 3300046516 Bacteria 1251
179 Ga0495665_0444805 3300046531 Bacteria 655
180 Ga0495586_0039386 3300046535 Bacteria 2541
181 Ga0495645_0007169 3300046543 Bacteria 7758
182 Ga0495645_0077572 3300046543 Bacteria 2388
183 Ga0495622_0195884 3300046557 Bacteria 902
184 Ga0495599_0044689 3300046678 Bacteria 2778
185 Ga0495658_0022018 3300046683 Bacteria 3366
186 Ga0495604_0185038 3300047317 Bacteria 1455
187 Ga0495672_0179599 3300047320 Bacteria 1073
188 Ga0495680_0082851 3300047322 Bacteria 2420
189 Ga0495602_0204388 3300048088 Bacteria 1504
190 Ga0495614_0081188 3300048089 Bacteria 1405
191 Ga0496102_0729386 3300048905 Bacteria 914
192 Ga0496104_0000058 3300048907 Bacteria 118768
193 Ga0496105_0000021 3300048908 Bacteria 164255
194 Ga0496106_0881963 3300048909 Bacteria 707
195 Ga0496112_0191705 3300048915 Bacteria 2006
196 Ga0496112_0374985 3300048915 Bacteria 1364
197 Ga0496114_0021498 3300048917 Bacteria 5249
198 Ga0496120_0408148 3300048923 Bacteria 599
199 Ga0496123_0008572 3300048926 Bacteria 9370
200 Ga0496125_0002721 3300048928 Bacteria 22456
201 Ga0496126_0651805 3300048929 Bacteria 824
202 Ga0501031_0001399 3300049568 Bacteria 14904
203 Ga0501032_0000997 3300049569 Bacteria 22803
204 Ga0501033_0003411 3300049570 Bacteria 13087
205 Ga0501034_0012704 3300049571 Bacteria 8688
206 Ga0501036_0009669 3300049572 Bacteria 7933
207 Ga0501037_0002737 3300049573 Bacteria 12744
208 Ga0501037_0418833 3300049573 Bacteria 917
209 Ga0501038_0002410 3300049574 Bacteria 17431
210 Ga0501039_0026096 3300049575 Bacteria 4490
211 Ga0501039_0120273 3300049575 Bacteria 2058
212 Ga0501039_0489319 3300049575 Bacteria 966
213 Ga0501039_0829024 3300049575 Bacteria 721
214 Ga0501040_0108147 3300049576 Bacteria 1944
215 Ga0501042_0662942 3300049578 Bacteria 759
216 Ga0501042_1086405 3300049578 Bacteria 583
217 Ga0501043_0001958 3300049579 Bacteria 17596
218 Ga0501046_0009390 3300049580 Bacteria 8455
219 Ga0501046_0129087 3300049580 Bacteria 1918
220 Ga0501046_0219405 3300049580 Bacteria 1409
221 Ga0501047_0083564 3300049581 Bacteria 3068
222 Ga0501048_0016221 3300049582 Bacteria 5492
223 Ga0501048_0133478 3300049582 Bacteria 1754
224 Ga0501067_0011986 3300049583 Bacteria 4803
225 Ga0501067_0309266 3300049583 Bacteria 880
226 Ga0501068_0000088 3300049584 Bacteria 38453
227 Ga0501069_0000306 3300049585 Bacteria 22374
228 Ga0501070_0005635 3300049586 Bacteria 10680
229 Ga0501072_0003204 3300049588 Bacteria 12289
230 Ga0501073_0000459 3300049589 Bacteria 28199
231 Ga0501074_0032345 3300049590 Bacteria 3789
232 Ga0501075_0035122 3300049591 Bacteria 3738
233 Ga0501075_0090312 3300049591 Bacteria 2324
234 Ga0501075_0188977 3300049591 Bacteria 1571
235 Ga0501076_0013027 3300049592 Bacteria 6226
236 Ga0501076_0029423 3300049592 Bacteria 4273
237 Ga0501076_0173362 3300049592 Bacteria 1758
238 Ga0501077_0001420 3300049593 Bacteria 14386
239 Ga0501077_0027959 3300049593 Bacteria 3583
240 Ga0501077_0157945 3300049593 Bacteria 1440
241 Ga0501077_0218796 3300049593 Bacteria 1210
242 Ga0501077_0651393 3300049593 Bacteria 677
243 Ga0501079_0098232 3300049741 Bacteria 2270
244 Ga0501079_0202827 3300049741 Bacteria 1549
245 Ga0501079_0265393 3300049741 Bacteria 1342
246 Ga0501080_0002207 3300049742 Bacteria 16924
247 Ga0501081_0421803 3300049743 Bacteria 989
248 Ga0501035_0015379 3300049822 Bacteria 7059
249 Ga0501045_0042224 3300049824 Bacteria 3320
250 Ga0501045_0338183 3300049824 Bacteria 1120
251 Ga0501045_0488635 3300049824 Bacteria 914
252 Ga0501045_0828810 3300049824 Bacteria 681
253 nmdc:mga03683_11066_c1 3300050489 Bacteria 3252
254 nmdc:mga03n38_217514_c1 3300050490 Bacteria 996
255 nmdc:mga00v17_80414_c2 3300050491 Bacteria 1628
256 nmdc:mga0k408_155332_c1 3300050493 Bacteria 1363
257 nmdc:mga0k408_79825_c1 3300050493 Bacteria 1915
258 nmdc:mga06z11_147680_c1 3300050494 Bacteria 1334
259 nmdc:mga06z11_19155_c1 3300050494 Bacteria 3141
260 nmdc:mga06z11_39990_c1 3300050494 Bacteria 2337
261 nmdc:mga04h51_117932_c1 3300050495 Bacteria 986
262 nmdc:mga07m45_125575_c1 3300050496 Bacteria 1483
263 nmdc:mga05p37_219176_c1 3300050507 Bacteria 2297
264 nmdc:mga05p37_411604_c1 3300050507 Bacteria 1576
265 nmdc:mga05p37_508287_c2 3300050507 Bacteria 776
266 nmdc:mga09592_1577049_c1 3300050508 Bacteria 532
267 nmdc:mga09592_191035_c1 3300050508 Bacteria 1772
268 nmdc:mga09592_417639_c1 3300050508 Bacteria 1159
269 nmdc:mga09592_706235_c1 3300050508 Bacteria 858
270 nmdc:mga0qj67_453427_c1 3300050509 Bacteria 1033
271 nmdc:mga0qj67_500184_c1 3300050509 Bacteria 977
272 nmdc:mga0qj67_549326_c1 3300050509 Bacteria 926
273 nmdc:mga06r32_101898_c1 3300050510 Bacteria 2818
274 nmdc:mga06r32_33750_c1 3300050510 Bacteria 4821
275 nmdc:mga06r32_790144_c1 3300050510 Bacteria 910
276 nmdc:mga08y16_851188_c1 3300050511 Bacteria 901
277 nmdc:mga0n895_108467_c1 3300050512 Bacteria 2791
278 nmdc:mga0n895_1234596_c1 3300050512 Bacteria 720
279 nmdc:mga0n895_24990_c1 3300050512 Bacteria 5638
280 nmdc:mga0n895_28279_c1 3300050512 Bacteria 5333
281 nmdc:mga0n895_367024_c1 3300050512 Bacteria 1457
282 nmdc:mga0n895_6001_c1 3300050512 Bacteria 10234
283 nmdc:mga0rr50_13741_c1 3300050513 Bacteria 5285
284 nmdc:mga0rr50_34283_c1 3300050513 Bacteria 3634
285 nmdc:mga0rr50_77071_c2 3300050513 Bacteria 2087
286 nmdc:mga08x19_48881_c1 3300050514 Bacteria 2711
287 nmdc:mga0a205_582165_c1 3300050515 Bacteria 973
288 nmdc:mga0a205_6049_c1 3300050515 Bacteria 10918
289 Ga0495601_0120794 3300053077 Bacteria 1701
290 Ga0495601_0686602 3300053077 Bacteria 654
291 Ga0500635_0000108 3300053080 Bacteria 49899
292 Ga0500566_0400878 3300053094 Bacteria 614
293 Ga0500562_044247 3300053108 Bacteria 1185
294 Ga0500614_241575 3300053123 Bacteria 562
295 Ga0501084_0005620 3300054114 Bacteria 10297
296 Ga0501084_0286872 3300054114 Bacteria 1390
297 Ga0501082_0017785 3300060353 Bacteria 6124
298 Ga0501082_0144579 3300060353 Bacteria 2064
299 Ga0501082_0180845 3300060353 Bacteria 1834
300 Ga0501082_0852355 3300060353 Bacteria 797
301 2644096347 2643221616 Bacteria 4066575
302 2644183703 2643221632 Bacteria 3406696
303 2884766449 2884763398 Bacteria 4091164
304 Ga0501041_0049124
305 JGI25164J39214_1001029
306 JGI25406J46586_10011181
307 JGI25165J46597_1000269
308 Ga0065704_10245363
309 Ga0065715_10151347
310 Ga0065707_10087064
311 Ga0070676_10648489
312 Ga0070690_100732703
313 Ga0068869_100002739
314 Ga0070689_100078869
315 Ga0070689_100780765
316 Ga0070668_100348384
317 Ga0070674_100653303
318 Ga0070703_10385033
319 Ga0070709_10055671
320 Ga0070709_10066129
321 Ga0070709_10159461
322 Ga0070709_10801434
323 Ga0070701_10555321
324 Ga0070711_100013600
325 Ga0070711_100126763
326 Ga0070711_101668518
327 Ga0070705_100061952
328 Ga0070705_100064876
329 Ga0070700_100715236
330 Ga0070694_101110294
331 Ga0070694_101859588
332 Ga0070708_100014351
333 Ga0070708_100025998
334 Ga0070708_100553904
335 Ga0070708_100900409
336 Ga0070708_101160026
337 Ga0070706_100000511
338 Ga0070706_100001077
339 Ga0070706_100027598
340 Ga0070706_100145223
341 Ga0070706_100215955
342 Ga0070706_100429439
343 Ga0070707_100064491
344 Ga0070707_100101931
345 Ga0070707_101577047
346 Ga0070707_101619511
347 Ga0070698_100000604
348 Ga0070698_100000976
349 Ga0070698_100001953
350 Ga0070698_100032981
351 Ga0070698_100034809
352 Ga0070698_100087828
353 Ga0070698_100318556
354 Ga0070699_100000756
355 Ga0070699_100017249
356 Ga0070699_100127273
357 Ga0070699_100187699
358 Ga0070699_100822749
359 Ga0070697_100006794
360 Ga0070697_100345477
361 Ga0070697_100748280
362 Ga0070672_102162430
363 Ga0070695_100052097
364 Ga0070695_100179658
365 Ga0070696_100003969
366 Ga0070693_100852691
367 Ga0070665_100172036
368 Ga0070704_100078393
369 Ga0070664_101641297
370 Ga0070664_102204321
371 Ga0068854_100401916
372 Ga0068864_101402623
373 Ga0068866_10435182
374 Ga0068863_100002866
375 Ga0068858_100246341
376 Ga0068860_102121323
377 Ga0068862_100045877
378 Ga0068862_100882276
379 Ga0081455_10024574
380 Ga0081539_10010617
381 Ga0075368_10064180
382 Ga0075363_100007280
383 Ga0075363_100835119
384 Ga0070716_100396640
385 Ga0070712_100024805
386 Ga0075362_10002292
387 Ga0075362_10119054
388 Ga0075367_10192900
389 Ga0097621_100661289
390 Ga0075370_10184709
391 Ga0068871_101508635
392 Ga0075428_100002094
393 Ga0075428_100024290
394 Ga0075430_100000157
395 Ga0075430_100313710
396 Ga0075431_100437080
397 Ga0075433_10006639
398 Ga0075434_100003017
399 Ga0075434_100008615
400 Ga0075434_100030637
401 Ga0075434_101549351
402 Ga0075429_100668696
403 Ga0075429_100858306
404 Ga0068865_101749244
405 Ga0075436_100016510
406 Ga0075435_100018843
407 Ga0075435_100134514
408 Ga0075435_100880422
409 Ga0105244_10017725
410 Ga0105250_10259975
411 Ga0105245_10925338
412 Ga0114129_10095768
413 Ga0114129_10225706
414 Ga0114129_10365509
415 Ga0105237_10038643
416 Ga0105249_11341887
417 Ga0157370_11443607
418 Ga0157374_10409533
419 Ga0157378_10048584
420 Ga0157372_10056909
421 Ga0157375_12580754
422 Ga0157379_10360499
423 Ga0157379_10903970
424 Ga0182005_1143398
425 Ga0213876_10031222
426 Ga0207427_100054
427 Ga0209437_101532
428 Ga0209233_1000001
429 Ga0207653_10437377
430 Ga0207699_10137202
431 Ga0207699_10455044
432 Ga0207645_10243793
433 Ga0207684_10009982
434 Ga0207684_10121230
435 Ga0207684_10162917
436 Ga0207684_10215289
437 Ga0207671_10148007
438 Ga0207693_10076627
439 Ga0207663_10133424
440 Ga0207663_10159470
441 Ga0207646_10006460
442 Ga0207646_10065825
443 Ga0207646_10622119
444 Ga0207670_10178895
445 Ga0207691_10390498
446 Ga0207711_11698828
447 Ga0207689_10006937
448 Ga0207689_10272279
449 Ga0207679_10921592
450 Ga0207651_10767069
451 Ga0207708_10211007
452 Ga0207708_10335677
453 Ga0207641_10001417
454 Ga0207676_11251388
455 Ga0207675_101570651
456 Ga0209813_10044143
457 Ga0207428_10788309
458 Ga0268266_10223017
459 Ga0268265_10144324
460 Ga0268265_11512125
461 Ga0307508_10452193
462 Ga0307516_10809486
463 Ga0307413_10022508
464 Ga0373945_0189218
465 Ga0373955_0042107
466 Ga0373924_0150783
467 Ga0373931_0723482
468 Ga0373935_0592304
469 Ga0373927_0293601
470 Ga0373937_0159101
471 Ga0395905_0288143
472 Ga0436364_1096788
473 Ga0436365_1112648
474 Ga0436365_1202517
475 Ga0436362_0581029
476 Ga0495629_0815358
477 Ga0495580_0262306
478 Ga0495582_0100466
479 Ga0495664_0046762
480 Ga0495628_0032232
481 Ga0495628_0275430
482 Ga0495665_0444805
483 Ga0495586_0039386
484 Ga0495645_0007169
485 Ga0495645_0077572
486 Ga0495622_0195884
487 Ga0495599_0044689
488 Ga0495658_0022018
489 Ga0495604_0185038
490 Ga0495672_0179599
491 Ga0495680_0082851
492 Ga0495602_0204388
493 Ga0495614_0081188
494 Ga0496102_0729386
495 Ga0496104_0000058
496 Ga0496105_0000021
497 Ga0496106_0881963
498 Ga0496112_0191705
499 Ga0496112_0374985
500 Ga0496114_0021498
501 Ga0496120_0408148
502 Ga0496123_0008572
503 Ga0496125_0002721
504 Ga0496126_0651805
505 Ga0501031_0001399
506 Ga0501032_0000997
507 Ga0501033_0003411
508 Ga0501034_0012704
509 Ga0501036_0009669
510 Ga0501037_0002737
511 Ga0501037_0418833
512 Ga0501038_0002410
513 Ga0501039_0026096
514 Ga0501039_0120273
515 Ga0501039_0489319
516 Ga0501039_0829024
517 Ga0501040_0108147
518 Ga0501042_0662942
519 Ga0501042_1086405
520 Ga0501043_0001958
521 Ga0501046_0009390
522 Ga0501046_0129087
523 Ga0501046_0219405
524 Ga0501047_0083564
525 Ga0501048_0016221
526 Ga0501048_0133478
527 Ga0501067_0011986
528 Ga0501067_0309266
529 Ga0501068_0000088
530 Ga0501069_0000306
531 Ga0501070_0005635
532 Ga0501072_0003204
533 Ga0501073_0000459
534 Ga0501074_0032345
535 Ga0501075_0035122
536 Ga0501075_0090312
537 Ga0501075_0188977
538 Ga0501076_0013027
539 Ga0501076_0029423
540 Ga0501076_0173362
541 Ga0501077_0001420
542 Ga0501077_0027959
543 Ga0501077_0157945
544 Ga0501077_0218796
545 Ga0501077_0651393
546 Ga0501079_0098232
547 Ga0501079_0202827
548 Ga0501079_0265393
549 Ga0501080_0002207
550 Ga0501081_0421803
551 Ga0501035_0015379
552 Ga0501045_0042224
553 Ga0501045_0338183
554 Ga0501045_0488635
555 Ga0501045_0828810
556 nmdc:mga03683_11066_c1
557 nmdc:mga03n38_217514_c1
558 nmdc:mga00v17_80414_c2
559 nmdc:mga0k408_155332_c1
560 nmdc:mga0k408_79825_c1
561 nmdc:mga06z11_147680_c1
562 nmdc:mga06z11_19155_c1
563 nmdc:mga06z11_39990_c1
564 nmdc:mga04h51_117932_c1
565 nmdc:mga07m45_125575_c1
566 nmdc:mga05p37_219176_c1
567 nmdc:mga05p37_411604_c1
568 nmdc:mga05p37_508287_c2
569 nmdc:mga09592_1577049_c1
570 nmdc:mga09592_191035_c1
571 nmdc:mga09592_417639_c1
572 nmdc:mga09592_706235_c1
573 nmdc:mga0qj67_453427_c1
574 nmdc:mga0qj67_500184_c1
575 nmdc:mga0qj67_549326_c1
576 nmdc:mga06r32_101898_c1
577 nmdc:mga06r32_33750_c1
578 nmdc:mga06r32_790144_c1
579 nmdc:mga08y16_851188_c1
580 nmdc:mga0n895_108467_c1
581 nmdc:mga0n895_1234596_c1
582 nmdc:mga0n895_24990_c1
583 nmdc:mga0n895_28279_c1
584 nmdc:mga0n895_367024_c1
585 nmdc:mga0n895_6001_c1
586 nmdc:mga0rr50_13741_c1
587 nmdc:mga0rr50_34283_c1
588 nmdc:mga0rr50_77071_c2
589 nmdc:mga08x19_48881_c1
590 nmdc:mga0a205_582165_c1
591 nmdc:mga0a205_6049_c1
592 Ga0495601_0120794
593 Ga0495601_0686602
594 Ga0500635_0000108
595 Ga0500566_0400878
596 Ga0500562_044247
597 Ga0500614_241575
598 Ga0501084_0005620
599 Ga0501084_0286872
600 Ga0501082_0017785
601 Ga0501082_0144579
602 Ga0501082_0180845
603 Ga0501082_0852355
604 2644096347
605 2644183703
606 2884766449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

25

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.8541 1 111
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.765 1 111
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7008 1 111
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.6597 1 111
3zo7-assembly1.cif.gz_F crystal structure of clcfe27a with substrate 0.6542 1 111
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8541 1 111 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.765 1 111 3.30.70.1060
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6625 1 120 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6617 1 112 3.30.70.1060
af_Q58177_47_134_3.30.70.1150 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT-like. Chain A, domain 2 0.654 1 108 3.30.70.1150
ID Description Score Start End GO Terms
AF-A0A0K9XFK5-F1-model_v4 Dehydrogenase 0.9874 1 116
AF-A0A0K3AZ59-F1-model_v4 PhnB protein 0.9839 1 116
AF-J3DD56-F1-model_v4 YCII-related domain-containing protein 0.9804 1 98
AF-A0A1V2QDZ9-F1-model_v4 YCII-related domain-containing protein 0.9776 1 115
AF-A0A178XAC8-F1-model_v4 YCII-related domain protein 0.9775 1 109

Map