F397219
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 187 | 302 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300046537|Ga0495598_0002824|Ga0495598_0002824_806_1420 |
| Length | 204 |
| Sequence | LRSWLDVNGVTRARIRIAMAPRIRVPHPIPNRKAEAMGLFSKDIKTMDDLFVHTLRDIYYAENQILKALPEMIEKATDAQLRQALQSHLAETKNQVKRVEQVFQMHGVEAKGIDCPAIDGIIEEADDVAGEIADKEVLDAALAGAAQAVEHYEIARYGTLIAWAKQLGRNDCASVLQKNLDEEKAADKKLTEIAEARLNLKAAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 2 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003568 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 26 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 27 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 30 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 31 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 32 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 36 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 44 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 64 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 70 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 71 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 72 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 97 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 98 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 100 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 101 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 102 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 103 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 104 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 105 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 106 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 107 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 108 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 109 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 110 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 111 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 112 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 113 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 114 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 117 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 152 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 153 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 154 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 155 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 161 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 162 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 163 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 164 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 165 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 172 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 173 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 174 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.17 |
| Metatranscriptomes | 16.5 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.96 |
| Nodule | 0.33 |
| Rhizoplane | 14.85 |
| Rhizosphere | 79.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006778J45830_1030199 | 3300003162 | Bacteria | 578 |
| 2 | JGI25153J46596_10007746 | 3300003215 | Bacteria | 5227 |
| 3 | Ga0006777J48905_1013333 | 3300003308 | Bacteria | 593 |
| 4 | Ga0006777J48905_1051874 | 3300003308 | Bacteria | 1198 |
| 5 | Ga0006777J48905_1083851 | 3300003308 | Bacteria | 639 |
| 6 | Ga0007427J51700_118976 | 3300003559 | Bacteria | 580 |
| 7 | Ga0006781J51513_1007265 | 3300003568 | Bacteria | 585 |
| 8 | Ga0007429J51699_1007098 | 3300003579 | Bacteria | 581 |
| 9 | Ga0007429J51699_1021955 | 3300003579 | Bacteria | 594 |
| 10 | Ga0007429J51699_1028379 | 3300003579 | Bacteria | 579 |
| 11 | Ga0007429J51699_1037095 | 3300003579 | Bacteria | 1267 |
| 12 | Ga0007429J51699_1050522 | 3300003579 | Bacteria | 793 |
| 13 | Ga0007429J51699_1074524 | 3300003579 | Bacteria | 613 |
| 14 | Ga0007429J51699_1123885 | 3300003579 | Bacteria | 663 |
| 15 | Ga0032354_1018101 | 3300003693 | Bacteria | 592 |
| 16 | Ga0032354_1037823 | 3300003693 | Bacteria | 967 |
| 17 | Ga0032354_1114330 | 3300003693 | Bacteria | 597 |
| 18 | Ga0006780_1007617 | 3300003735 | Bacteria | 588 |
| 19 | Ga0006780_1015204 | 3300003735 | Bacteria | 747 |
| 20 | Ga0006780_1036199 | 3300003735 | Bacteria | 611 |
| 21 | Ga0058860_11921752 | 3300004801 | Bacteria | 855 |
| 22 | Ga0070690_100051757 | 3300005330 | Bacteria | 2623 |
| 23 | Ga0070670_100015821 | 3300005331 | Bacteria | 6475 |
| 24 | Ga0068868_100135639 | 3300005338 | Bacteria | 2017 |
| 25 | Ga0068868_100220094 | 3300005338 | Bacteria | 1589 |
| 26 | Ga0070689_100736971 | 3300005340 | Bacteria | 863 |
| 27 | Ga0070689_101046081 | 3300005340 | Bacteria | 728 |
| 28 | Ga0070667_100060898 | 3300005367 | Bacteria | 3195 |
| 29 | Ga0070667_101459900 | 3300005367 | Bacteria | 642 |
| 30 | Ga0070709_10532331 | 3300005434 | Bacteria | 897 |
| 31 | Ga0070714_101293683 | 3300005435 | Bacteria | 712 |
| 32 | Ga0070713_100050287 | 3300005436 | Bacteria | 3442 |
| 33 | Ga0070705_101127483 | 3300005440 | Bacteria | 643 |
| 34 | Ga0070681_10383750 | 3300005458 | Bacteria | 1316 |
| 35 | Ga0070681_10749667 | 3300005458 | Bacteria | 893 |
| 36 | Ga0070681_11016435 | 3300005458 | Bacteria | 749 |
| 37 | Ga0070698_101096596 | 3300005471 | Bacteria | 744 |
| 38 | Ga0070679_100039816 | 3300005530 | Bacteria | 4673 |
| 39 | Ga0070665_100591266 | 3300005548 | Bacteria | 1123 |
| 40 | Ga0070664_100322385 | 3300005564 | Bacteria | 1400 |
| 41 | Ga0070664_101108248 | 3300005564 | Bacteria | 746 |
| 42 | Ga0068856_100056664 | 3300005614 | Bacteria | 3868 |
| 43 | Ga0068856_100777180 | 3300005614 | Bacteria | 977 |
| 44 | Ga0068859_101758433 | 3300005617 | Bacteria | 685 |
| 45 | Ga0068864_100296345 | 3300005618 | Bacteria | 1513 |
| 46 | Ga0068863_100386388 | 3300005841 | Bacteria | 1367 |
| 47 | Ga0068858_100845081 | 3300005842 | Bacteria | 894 |
| 48 | Ga0068860_100582562 | 3300005843 | Bacteria | 1123 |
| 49 | Ga0081538_10061755 | 3300005981 | Bacteria | 2142 |
| 50 | Ga0081539_10042081 | 3300005985 | Bacteria | 2664 |
| 51 | Ga0070717_10022298 | 3300006028 | Bacteria | 5002 |
| 52 | Ga0070717_10110211 | 3300006028 | Bacteria | 2347 |
| 53 | Ga0075365_10003837 | 3300006038 | Bacteria | 7843 |
| 54 | Ga0075365_10010356 | 3300006038 | Bacteria | 5424 |
| 55 | Ga0075363_100391171 | 3300006048 | Bacteria | 816 |
| 56 | Ga0070716_100353036 | 3300006173 | Bacteria | 1041 |
| 57 | Ga0075428_100025201 | 3300006844 | Bacteria | 6581 |
| 58 | Ga0075428_100157647 | 3300006844 | Bacteria | 2465 |
| 59 | Ga0075428_100232448 | 3300006844 | Bacteria | 1990 |
| 60 | Ga0075428_100283548 | 3300006844 | Bacteria | 1782 |
| 61 | Ga0075428_100717944 | 3300006844 | Bacteria | 1064 |
| 62 | Ga0075428_100775730 | 3300006844 | Bacteria | 1019 |
| 63 | Ga0075428_102008882 | 3300006844 | Bacteria | 599 |
| 64 | Ga0075430_100000071 | 3300006846 | Bacteria | 55634 |
| 65 | Ga0075430_100459628 | 3300006846 | Bacteria | 1050 |
| 66 | Ga0075430_100968320 | 3300006846 | Bacteria | 701 |
| 67 | Ga0075431_100086773 | 3300006847 | Bacteria | 3229 |
| 68 | Ga0075431_100311856 | 3300006847 | Bacteria | 1588 |
| 69 | Ga0075431_100982799 | 3300006847 | Bacteria | 811 |
| 70 | Ga0075434_100021671 | 3300006871 | Bacteria | 6249 |
| 71 | Ga0075429_100075959 | 3300006880 | Bacteria | 2926 |
| 72 | Ga0075429_100766783 | 3300006880 | Bacteria | 845 |
| 73 | Ga0075429_101021715 | 3300006880 | Bacteria | 723 |
| 74 | Ga0068865_100322853 | 3300006881 | Bacteria | 1242 |
| 75 | Ga0075436_100401146 | 3300006914 | Bacteria | 994 |
| 76 | Ga0097620_101758562 | 3300006931 | Bacteria | 685 |
| 77 | Ga0075435_100247976 | 3300007076 | Bacteria | 1515 |
| 78 | Ga0075435_100694965 | 3300007076 | Bacteria | 884 |
| 79 | Ga0105240_10455083 | 3300009093 | Bacteria | 1431 |
| 80 | Ga0111539_10051000 | 3300009094 | Bacteria | 4929 |
| 81 | Ga0114129_10009443 | 3300009147 | Bacteria | 13902 |
| 82 | Ga0114129_10064619 | 3300009147 | Bacteria | 5107 |
| 83 | Ga0105243_10160510 | 3300009148 | Bacteria | 1938 |
| 84 | Ga0105241_12023300 | 3300009174 | Bacteria | 567 |
| 85 | Ga0105242_10116810 | 3300009176 | Bacteria | 2283 |
| 86 | Ga0105242_12552172 | 3300009176 | Bacteria | 560 |
| 87 | Ga0105248_10085668 | 3300009177 | Bacteria | 3546 |
| 88 | Ga0105238_10031659 | 3300009551 | Bacteria | 5384 |
| 89 | Ga0105246_10038629 | 3300011119 | Bacteria | 3211 |
| 90 | Ga0105246_11460630 | 3300011119 | Bacteria | 640 |
| 91 | Ga0157370_10558654 | 3300013104 | Bacteria | 1049 |
| 92 | Ga0157374_10133126 | 3300013296 | Bacteria | 2407 |
| 93 | Ga0157374_10499739 | 3300013296 | Bacteria | 1221 |
| 94 | Ga0157372_11369860 | 3300013307 | Bacteria | 816 |
| 95 | Ga0163163_10005938 | 3300014325 | Bacteria | 10628 |
| 96 | Ga0157380_10917286 | 3300014326 | Bacteria | 903 |
| 97 | Ga0197907_10213847 | 3300020069 | Bacteria | 631 |
| 98 | Ga0197907_11106567 | 3300020069 | Bacteria | 599 |
| 99 | Ga0206356_10495149 | 3300020070 | Bacteria | 611 |
| 100 | Ga0206356_11417417 | 3300020070 | Bacteria | 1189 |
| 101 | Ga0206356_11438375 | 3300020070 | Bacteria | 889 |
| 102 | Ga0206349_1251754 | 3300020075 | Bacteria | 895 |
| 103 | Ga0206355_1246740 | 3300020076 | Bacteria | 599 |
| 104 | Ga0206351_10296349 | 3300020077 | Bacteria | 836 |
| 105 | Ga0206351_10385539 | 3300020077 | Bacteria | 889 |
| 106 | Ga0206351_10652214 | 3300020077 | Bacteria | 1311 |
| 107 | Ga0206352_10076733 | 3300020078 | Bacteria | 619 |
| 108 | Ga0206352_10169809 | 3300020078 | Bacteria | 543 |
| 109 | Ga0206352_10384936 | 3300020078 | Bacteria | 910 |
| 110 | Ga0206352_10467591 | 3300020078 | Bacteria | 706 |
| 111 | Ga0206350_10452236 | 3300020080 | Bacteria | 611 |
| 112 | Ga0206350_10543441 | 3300020080 | Bacteria | 1338 |
| 113 | Ga0206350_10548868 | 3300020080 | Bacteria | 611 |
| 114 | Ga0206350_10768345 | 3300020080 | Bacteria | 1008 |
| 115 | Ga0206354_10322786 | 3300020081 | Bacteria | 611 |
| 116 | Ga0206354_10443892 | 3300020081 | Bacteria | 564 |
| 117 | Ga0206354_11225901 | 3300020081 | Bacteria | 740 |
| 118 | Ga0206353_10460892 | 3300020082 | Bacteria | 901 |
| 119 | Ga0206353_10632836 | 3300020082 | Bacteria | 778 |
| 120 | Ga0154015_1313385 | 3300020610 | Bacteria | 744 |
| 121 | Ga0154015_1611676 | 3300020610 | Bacteria | 573 |
| 122 | Ga0213872_10073245 | 3300021361 | Bacteria | 1543 |
| 123 | Ga0213874_10105728 | 3300021377 | Bacteria | 941 |
| 124 | Ga0224712_10093517 | 3300022467 | Bacteria | 1263 |
| 125 | Ga0224712_10450136 | 3300022467 | Bacteria | 618 |
| 126 | Ga0224712_10476911 | 3300022467 | Bacteria | 601 |
| 127 | Ga0224712_10489939 | 3300022467 | Bacteria | 593 |
| 128 | Ga0209758_1000619 | 3300025297 | Bacteria | 54561 |
| 129 | Ga0209758_1016709 | 3300025297 | Bacteria | 3707 |
| 130 | Ga0207426_1102496 | 3300025302 | Bacteria | 736 |
| 131 | Ga0207680_10325017 | 3300025903 | Bacteria | 1076 |
| 132 | Ga0207684_10308000 | 3300025910 | Bacteria | 1365 |
| 133 | Ga0207684_10370562 | 3300025910 | Bacteria | 1232 |
| 134 | Ga0207707_10247153 | 3300025912 | Bacteria | 1550 |
| 135 | Ga0207707_11311830 | 3300025912 | Bacteria | 581 |
| 136 | Ga0207663_10014437 | 3300025916 | Bacteria | 4323 |
| 137 | Ga0207663_10505604 | 3300025916 | Bacteria | 939 |
| 138 | Ga0207660_10211240 | 3300025917 | Bacteria | 1520 |
| 139 | Ga0207652_10028688 | 3300025921 | Bacteria | 4646 |
| 140 | Ga0207652_10778038 | 3300025921 | Bacteria | 851 |
| 141 | Ga0207650_10000743 | 3300025925 | Bacteria | 25164 |
| 142 | Ga0207687_10010301 | 3300025927 | Bacteria | 6108 |
| 143 | Ga0207700_11175309 | 3300025928 | Bacteria | 685 |
| 144 | Ga0207686_10057439 | 3300025934 | Bacteria | 2450 |
| 145 | Ga0207665_11151072 | 3300025939 | Bacteria | 619 |
| 146 | Ga0207711_10045664 | 3300025941 | Bacteria | 3744 |
| 147 | Ga0207689_10460406 | 3300025942 | Bacteria | 1063 |
| 148 | Ga0207679_10385977 | 3300025945 | Bacteria | 1229 |
| 149 | Ga0207679_10570652 | 3300025945 | Bacteria | 1017 |
| 150 | Ga0207658_11070725 | 3300025986 | Bacteria | 736 |
| 151 | Ga0207639_11617140 | 3300026041 | Bacteria | 608 |
| 152 | Ga0207702_10519413 | 3300026078 | Bacteria | 1162 |
| 153 | Ga0207676_10419106 | 3300026095 | Bacteria | 1255 |
| 154 | Ga0268266_10439837 | 3300028379 | Bacteria | 1238 |
| 155 | Ga0268264_10251080 | 3300028381 | Bacteria | 1643 |
| 156 | Ga0265330_10129924 | 3300031235 | Bacteria | 1072 |
| 157 | Ga0265325_10015602 | 3300031241 | Bacteria | 4268 |
| 158 | Ga0265340_10209874 | 3300031247 | Bacteria | 874 |
| 159 | Ga0265316_10035898 | 3300031344 | Bacteria | 4012 |
| 160 | Ga0373939_0332116 | 3300035114 | Bacteria | 614 |
| 161 | Ga0373945_0023312 | 3300035116 | Bacteria | 2137 |
| 162 | Ga0373943_0141312 | 3300035170 | Bacteria | 1297 |
| 163 | Ga0373943_0437968 | 3300035170 | Bacteria | 758 |
| 164 | Ga0373955_0170252 | 3300035172 | Bacteria | 1289 |
| 165 | Ga0373935_0446030 | 3300035692 | Bacteria | 934 |
| 166 | Ga0373935_0503682 | 3300035692 | Bacteria | 879 |
| 167 | Ga0373935_0681837 | 3300035692 | Bacteria | 755 |
| 168 | Ga0373927_0018836 | 3300035695 | Bacteria | 4529 |
| 169 | Ga0373933_0067855 | 3300035724 | Bacteria | 2165 |
| 170 | Ga0373933_0320915 | 3300035724 | Bacteria | 1004 |
| 171 | Ga0373947_0381045 | 3300035725 | Bacteria | 949 |
| 172 | Ga0373937_0336914 | 3300036401 | Bacteria | 1428 |
| 173 | Ga0373925_1141558 | 3300037068 | Bacteria | 641 |
| 174 | Ga0395898_1403801 | 3300037466 | Bacteria | 626 |
| 175 | Ga0436365_0682972 | 3300039437 | Bacteria | 8452 |
| 176 | Ga0436360_0704230 | 3300039438 | Bacteria | 953 |
| 177 | Ga0436360_0708825 | 3300039438 | Bacteria | 820 |
| 178 | Ga0436361_0001602 | 3300039447 | Bacteria | 633 |
| 179 | Ga0436363_0122032 | 3300039450 | Bacteria | 1035 |
| 180 | Ga0436363_0132120 | 3300039450 | Bacteria | 1033 |
| 181 | Ga0466957_0144827 | 3300044842 | Bacteria | 1533 |
| 182 | Ga0466959_0667333 | 3300045049 | Bacteria | 697 |
| 183 | Ga0466958_0172205 | 3300045836 | Bacteria | 1371 |
| 184 | Ga0495629_0041844 | 3300046459 | Bacteria | 3221 |
| 185 | Ga0495629_0071983 | 3300046459 | Bacteria | 2413 |
| 186 | Ga0495641_0066256 | 3300046461 | Bacteria | 1625 |
| 187 | Ga0495651_0047797 | 3300046462 | Bacteria | 3306 |
| 188 | Ga0495582_0017850 | 3300046473 | Bacteria | 3878 |
| 189 | Ga0495639_0059851 | 3300046475 | Bacteria | 1744 |
| 190 | Ga0495664_0296148 | 3300046477 | Bacteria | 977 |
| 191 | Ga0495584_0196281 | 3300046491 | Bacteria | 1026 |
| 192 | Ga0495585_0341944 | 3300046492 | Bacteria | 728 |
| 193 | Ga0495594_0640784 | 3300046499 | Bacteria | 602 |
| 194 | Ga0495631_0103505 | 3300046518 | Bacteria | 1225 |
| 195 | Ga0495652_0112811 | 3300046529 | Bacteria | 2183 |
| 196 | Ga0495652_0448019 | 3300046529 | Bacteria | 904 |
| 197 | Ga0495640_0212713 | 3300046533 | Bacteria | 1222 |
| 198 | Ga0495598_0002824 | 3300046537 | Bacteria | 3619 |
| 199 | Ga0495598_0057202 | 3300046537 | Bacteria | 1193 |
| 200 | Ga0495656_0095259 | 3300046615 | Bacteria | 1368 |
| 201 | Ga0495611_0156014 | 3300046648 | Bacteria | 1066 |
| 202 | Ga0495661_0131043 | 3300046665 | Bacteria | 1374 |
| 203 | Ga0495599_0084788 | 3300046678 | Bacteria | 1979 |
| 204 | Ga0495599_0565339 | 3300046678 | Bacteria | 665 |
| 205 | Ga0495658_0127967 | 3300046683 | Bacteria | 1543 |
| 206 | Ga0495658_0587224 | 3300046683 | Bacteria | 714 |
| 207 | Ga0495613_0098928 | 3300046689 | Bacteria | 2108 |
| 208 | Ga0495624_0064848 | 3300046690 | Bacteria | 2282 |
| 209 | Ga0495670_0076032 | 3300046691 | Bacteria | 1706 |
| 210 | Ga0495670_0095881 | 3300046691 | Bacteria | 1522 |
| 211 | Ga0495589_0036434 | 3300046794 | Bacteria | 2466 |
| 212 | Ga0495660_0343919 | 3300046810 | Bacteria | 665 |
| 213 | Ga0495604_0234964 | 3300047317 | Bacteria | 1256 |
| 214 | Ga0495674_1022755 | 3300047319 | Bacteria | 632 |
| 215 | Ga0495676_0100812 | 3300047321 | Bacteria | 2137 |
| 216 | Ga0495680_0262244 | 3300047322 | Bacteria | 1222 |
| 217 | Ga0495675_0145507 | 3300047444 | Bacteria | 1467 |
| 218 | Ga0495684_0144714 | 3300047471 | Bacteria | 1781 |
| 219 | Ga0495602_0470482 | 3300048088 | Bacteria | 884 |
| 220 | Ga0495615_0139149 | 3300048090 | Bacteria | 715 |
| 221 | Ga0495626_0109121 | 3300048091 | Bacteria | 1200 |
| 222 | Ga0496100_0089459 | 3300048903 | Bacteria | 2097 |
| 223 | Ga0496100_0225120 | 3300048903 | Bacteria | 1378 |
| 224 | Ga0496100_1011318 | 3300048903 | Bacteria | 654 |
| 225 | Ga0496101_0253617 | 3300048904 | Bacteria | 1371 |
| 226 | Ga0496101_0543574 | 3300048904 | Bacteria | 918 |
| 227 | Ga0496102_0155968 | 3300048905 | Bacteria | 2146 |
| 228 | Ga0496102_0388757 | 3300048905 | Bacteria | 1312 |
| 229 | Ga0496102_0728799 | 3300048905 | Bacteria | 914 |
| 230 | Ga0496103_0012827 | 3300048906 | Bacteria | 4970 |
| 231 | Ga0496103_0018692 | 3300048906 | Bacteria | 4158 |
| 232 | Ga0496104_0000434 | 3300048907 | Bacteria | 36228 |
| 233 | Ga0496104_0001436 | 3300048907 | Bacteria | 20595 |
| 234 | Ga0496104_0032502 | 3300048907 | Bacteria | 4856 |
| 235 | Ga0496104_0240567 | 3300048907 | Bacteria | 1722 |
| 236 | Ga0496105_0009775 | 3300048908 | Bacteria | 7512 |
| 237 | Ga0496105_0012650 | 3300048908 | Bacteria | 6685 |
| 238 | Ga0496105_0068466 | 3300048908 | Bacteria | 2933 |
| 239 | Ga0496105_0394708 | 3300048908 | Bacteria | 1099 |
| 240 | Ga0496106_0002479 | 3300048909 | Bacteria | 13755 |
| 241 | Ga0496106_0082704 | 3300048909 | Bacteria | 2468 |
| 242 | Ga0496107_0002030 | 3300048910 | Bacteria | 12929 |
| 243 | Ga0496108_0001203 | 3300048911 | Bacteria | 20288 |
| 244 | Ga0496108_0026286 | 3300048911 | Bacteria | 4800 |
| 245 | Ga0496108_1231711 | 3300048911 | Bacteria | 632 |
| 246 | Ga0496109_0004657 | 3300048912 | Bacteria | 11452 |
| 247 | Ga0496109_0010855 | 3300048912 | Bacteria | 7796 |
| 248 | Ga0496109_0518945 | 3300048912 | Bacteria | 1124 |
| 249 | Ga0496110_0023519 | 3300048913 | Bacteria | 5242 |
| 250 | Ga0496110_0416541 | 3300048913 | Bacteria | 1225 |
| 251 | Ga0496110_0581342 | 3300048913 | Bacteria | 1017 |
| 252 | Ga0496110_0740956 | 3300048913 | Bacteria | 885 |
| 253 | Ga0496111_0005844 | 3300048914 | Bacteria | 7933 |
| 254 | Ga0496111_0020110 | 3300048914 | Bacteria | 4643 |
| 255 | Ga0496112_0006422 | 3300048915 | Bacteria | 10319 |
| 256 | Ga0496112_0162994 | 3300048915 | Bacteria | 2196 |
| 257 | Ga0496112_0186473 | 3300048915 | Bacteria | 2037 |
| 258 | Ga0496113_0000215 | 3300048916 | Bacteria | 27020 |
| 259 | Ga0496113_0097767 | 3300048916 | Bacteria | 2271 |
| 260 | Ga0496113_0117345 | 3300048916 | Bacteria | 2078 |
| 261 | Ga0496113_0905692 | 3300048916 | Bacteria | 697 |
| 262 | Ga0496114_0081906 | 3300048917 | Bacteria | 2727 |
| 263 | Ga0496114_1041976 | 3300048917 | Bacteria | 702 |
| 264 | Ga0496115_0051685 | 3300048918 | Bacteria | 3295 |
| 265 | Ga0496115_0087190 | 3300048918 | Bacteria | 2547 |
| 266 | Ga0496115_0258281 | 3300048918 | Bacteria | 1433 |
| 267 | Ga0501036_0762794 | 3300049572 | Bacteria | 798 |
| 268 | Ga0501067_0438183 | 3300049583 | Bacteria | 729 |
| 269 | Ga0501072_0010338 | 3300049588 | Bacteria | 7110 |
| 270 | Ga0501072_0092360 | 3300049588 | Bacteria | 2404 |
| 271 | Ga0501075_0072870 | 3300049591 | Bacteria | 2597 |
| 272 | Ga0501076_0065933 | 3300049592 | Bacteria | 2889 |
| 273 | Ga0501083_0161767 | 3300049744 | Bacteria | 1464 |
| 274 | nmdc:mga00v17_225618_c1 | 3300050491 | Bacteria | 1213 |
| 275 | nmdc:mga0yw44_70019_c1 | 3300050492 | Bacteria | 2174 |
| 276 | nmdc:mga0k408_633567_c1 | 3300050493 | Bacteria | 629 |
| 277 | nmdc:mga06z11_144211_c1 | 3300050494 | Bacteria | 1348 |
| 278 | nmdc:mga06z11_288944_c1 | 3300050494 | Bacteria | 972 |
| 279 | nmdc:mga05p37_1326173_c1 | 3300050507 | Bacteria | 731 |
| 280 | nmdc:mga05p37_472626_c1 | 3300050507 | Bacteria | 1446 |
| 281 | nmdc:mga05p37_965_c1 | 3300050507 | Bacteria | 32561 |
| 282 | nmdc:mga09592_649391_c1 | 3300050508 | Bacteria | 901 |
| 283 | nmdc:mga09592_77317_c1 | 3300050508 | Bacteria | 2831 |
| 284 | nmdc:mga0qj67_1190587_c1 | 3300050509 | Bacteria | 593 |
| 285 | nmdc:mga0qj67_153_c1 | 3300050509 | Bacteria | 46326 |
| 286 | nmdc:mga0qj67_325912_c1 | 3300050509 | Bacteria | 1243 |
| 287 | nmdc:mga06r32_1047391_c1 | 3300050510 | Bacteria | 767 |
| 288 | nmdc:mga06r32_590347_c1 | 3300050510 | Bacteria | 1082 |
| 289 | nmdc:mga06r32_648817_c1 | 3300050510 | Bacteria | 1024 |
| 290 | nmdc:mga06r32_970266_c1 | 3300050510 | Bacteria | 804 |
| 291 | nmdc:mga08y16_255043_c1 | 3300050511 | Bacteria | 1812 |
| 292 | nmdc:mga0n895_345469_c1 | 3300050512 | Bacteria | 1507 |
| 293 | nmdc:mga0n895_65534_c1 | 3300050512 | Bacteria | 3595 |
| 294 | Ga0495601_0023867 | 3300053077 | Bacteria | 3761 |
| 295 | Ga0495655_0010294 | 3300053083 | Bacteria | 1842 |
| 296 | Ga0495595_0289564 | 3300053084 | Bacteria | 823 |
| 297 | Ga0495619_0052756 | 3300053085 | Bacteria | 2689 |
| 298 | Ga0495619_0138947 | 3300053085 | Bacteria | 1672 |
| 299 | Ga0495619_0474774 | 3300053085 | Bacteria | 861 |
| 300 | Ga0501084_0797580 | 3300054114 | Bacteria | 795 |
| 301 | Ga0587107_051911 | 3300059652 | Bacteria | 698 |
| 302 | Ga0530510_0010972 | 3300061734 | Bacteria | 6355 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049583 | Ga0501067_0438183 | Ga0501067_0438183_175_684 | 153 |
| 2 | 3300005331 | Ga0070670_100015821 | Ga0070670_1000158217 | 157 |
| 3 | 3300005564 | Ga0070664_101108248 | Ga0070664_1011082481 | 157 |
| 4 | 3300006844 | Ga0075428_100232448 | Ga0075428_1002324482 | 157 |
| 5 | 3300006871 | Ga0075434_100021671 | Ga0075434_1000216712 | 157 |
| 6 | 3300006880 | Ga0075429_100766783 | Ga0075429_1007667832 | 157 |
| 7 | 3300011119 | Ga0105246_10038629 | Ga0105246_100386293 | 157 |
| 8 | 3300014325 | Ga0163163_10005938 | Ga0163163_100059382 | 157 |
| 9 | 3300020069 | Ga0197907_10213847 | Ga0197907_102138471 | 157 |
| 10 | 3300020078 | Ga0206352_10467591 | Ga0206352_104675911 | 157 |
| 11 | 3300020080 | Ga0206350_10548868 | Ga0206350_105488681 | 157 |
| 12 | 3300022467 | Ga0224712_10476911 | Ga0224712_104769111 | 157 |
| 13 | 3300025925 | Ga0207650_10000743 | Ga0207650_100007438 | 157 |
| 14 | 3300025945 | Ga0207679_10570652 | Ga0207679_105706522 | 157 |
| 15 | 3300035170 | Ga0373943_0437968 | Ga0373943_0437968_139_645 | 157 |
| 16 | 3300048904 | Ga0496101_0253617 | Ga0496101_0253617_233_739 | 157 |
| 17 | 3300048906 | Ga0496103_0012827 | Ga0496103_0012827_47_553 | 157 |
| 18 | 3300048907 | Ga0496104_0032502 | Ga0496104_0032502_142_648 | 157 |
| 19 | 3300048908 | Ga0496105_0009775 | Ga0496105_0009775_4015_4521 | 157 |
| 20 | 3300048909 | Ga0496106_0082704 | Ga0496106_0082704_485_991 | 157 |
| 21 | 3300048911 | Ga0496108_0001203 | Ga0496108_0001203_8911_9417 | 157 |
| 22 | 3300048912 | Ga0496109_0004657 | Ga0496109_0004657_930_1436 | 157 |
| 23 | 3300048913 | Ga0496110_0023519 | Ga0496110_0023519_4421_4927 | 157 |
| 24 | 3300048914 | Ga0496111_0005844 | Ga0496111_0005844_1535_2041 | 157 |
| 25 | 3300048915 | Ga0496112_0006422 | Ga0496112_0006422_6835_7341 | 157 |
| 26 | 3300048916 | Ga0496113_0000215 | Ga0496113_0000215_16431_16937 | 157 |
| 27 | 3300050508 | nmdc:mga09592_649391_c1 | nmdc:mga09592_649391_c1_143_649 | 157 |
| 28 | 3300050512 | nmdc:mga0n895_65534_c1 | nmdc:mga0n895_65534_c1_918_1424 | 157 |
| 29 | 3300053085 | Ga0495619_0474774 | Ga0495619_0474774_181_687 | 157 |
| 30 | iso_pu_bacteria | 2513237087 | 2513590552 | 158 |
| 31 | 3300003215 | JGI25153J46596_10007746 | JGI25153J46596_100077462 | 161 |
| 32 | 3300003308 | Ga0006777J48905_1083851 | Ga0006777J48905_10838511 | 161 |
| 33 | 3300003579 | Ga0007429J51699_1021955 | Ga0007429J51699_10219551 | 161 |
| 34 | 3300003579 | Ga0007429J51699_1050522 | Ga0007429J51699_10505221 | 161 |
| 35 | 3300003579 | Ga0007429J51699_1074524 | Ga0007429J51699_10745241 | 161 |
| 36 | 3300003579 | Ga0007429J51699_1123885 | Ga0007429J51699_11238851 | 161 |
| 37 | 3300003693 | Ga0032354_1018101 | Ga0032354_10181011 | 161 |
| 38 | 3300003735 | Ga0006780_1036199 | Ga0006780_10361991 | 161 |
| 39 | 3300005330 | Ga0070690_100051757 | Ga0070690_1000517573 | 161 |
| 40 | 3300005338 | Ga0068868_100135639 | Ga0068868_1001356392 | 161 |
| 41 | 3300005340 | Ga0070689_100736971 | Ga0070689_1007369711 | 161 |
| 42 | 3300005340 | Ga0070689_101046081 | Ga0070689_1010460811 | 161 |
| 43 | 3300005367 | Ga0070667_100060898 | Ga0070667_1000608982 | 161 |
| 44 | 3300005367 | Ga0070667_101459900 | Ga0070667_1014599001 | 161 |
| 45 | 3300005434 | Ga0070709_10532331 | Ga0070709_105323312 | 161 |
| 46 | 3300005435 | Ga0070714_101293683 | Ga0070714_1012936831 | 161 |
| 47 | 3300005436 | Ga0070713_100050287 | Ga0070713_1000502872 | 161 |
| 48 | 3300005440 | Ga0070705_101127483 | Ga0070705_1011274831 | 161 |
| 49 | 3300005458 | Ga0070681_10383750 | Ga0070681_103837502 | 161 |
| 50 | 3300005458 | Ga0070681_10749667 | Ga0070681_107496671 | 161 |
| 51 | 3300005471 | Ga0070698_101096596 | Ga0070698_1010965961 | 161 |
| 52 | 3300005530 | Ga0070679_100039816 | Ga0070679_1000398167 | 161 |
| 53 | 3300005548 | Ga0070665_100591266 | Ga0070665_1005912662 | 161 |
| 54 | 3300005564 | Ga0070664_100322385 | Ga0070664_1003223852 | 161 |
| 55 | 3300005614 | Ga0068856_100777180 | Ga0068856_1007771802 | 161 |
| 56 | 3300005617 | Ga0068859_101758433 | Ga0068859_1017584331 | 161 |
| 57 | 3300005618 | Ga0068864_100296345 | Ga0068864_1002963452 | 161 |
| 58 | 3300005843 | Ga0068860_100582562 | Ga0068860_1005825622 | 161 |
| 59 | 3300005981 | Ga0081538_10061755 | Ga0081538_100617552 | 161 |
| 60 | 3300005985 | Ga0081539_10042081 | Ga0081539_100420813 | 161 |
| 61 | 3300006028 | Ga0070717_10022298 | Ga0070717_100222988 | 161 |
| 62 | 3300006028 | Ga0070717_10110211 | Ga0070717_101102113 | 161 |
| 63 | 3300006038 | Ga0075365_10003837 | Ga0075365_100038372 | 161 |
| 64 | 3300006173 | Ga0070716_100353036 | Ga0070716_1003530361 | 161 |
| 65 | 3300006844 | Ga0075428_100025201 | Ga0075428_1000252012 | 161 |
| 66 | 3300006844 | Ga0075428_102008882 | Ga0075428_1020088821 | 161 |
| 67 | 3300006847 | Ga0075431_100982799 | Ga0075431_1009827992 | 161 |
| 68 | 3300006880 | Ga0075429_101021715 | Ga0075429_1010217151 | 161 |
| 69 | 3300006914 | Ga0075436_100401146 | Ga0075436_1004011462 | 161 |
| 70 | 3300006931 | Ga0097620_101758562 | Ga0097620_1017585621 | 161 |
| 71 | 3300007076 | Ga0075435_100694965 | Ga0075435_1006949652 | 161 |
| 72 | 3300009093 | Ga0105240_10455083 | Ga0105240_104550832 | 161 |
| 73 | 3300009148 | Ga0105243_10160510 | Ga0105243_101605102 | 161 |
| 74 | 3300009176 | Ga0105242_10116810 | Ga0105242_101168103 | 161 |
| 75 | 3300009177 | Ga0105248_10085668 | Ga0105248_100856682 | 161 |
| 76 | 3300009551 | Ga0105238_10031659 | Ga0105238_100316596 | 161 |
| 77 | 3300013104 | Ga0157370_10558654 | Ga0157370_105586542 | 161 |
| 78 | 3300013296 | Ga0157374_10499739 | Ga0157374_104997391 | 161 |
| 79 | 3300013307 | Ga0157372_11369860 | Ga0157372_113698601 | 161 |
| 80 | 3300014326 | Ga0157380_10917286 | Ga0157380_109172861 | 161 |
| 81 | 3300020069 | Ga0197907_11106567 | Ga0197907_111065671 | 161 |
| 82 | 3300020070 | Ga0206356_11417417 | Ga0206356_114174172 | 161 |
| 83 | 3300020076 | Ga0206355_1246740 | Ga0206355_12467401 | 161 |
| 84 | 3300020077 | Ga0206351_10296349 | Ga0206351_102963491 | 161 |
| 85 | 3300020077 | Ga0206351_10652214 | Ga0206351_106522141 | 161 |
| 86 | 3300020078 | Ga0206352_10076733 | Ga0206352_100767331 | 161 |
| 87 | 3300020078 | Ga0206352_10169809 | Ga0206352_101698091 | 161 |
| 88 | 3300020080 | Ga0206350_10452236 | Ga0206350_104522361 | 161 |
| 89 | 3300020080 | Ga0206350_10543441 | Ga0206350_105434412 | 161 |
| 90 | 3300020081 | Ga0206354_10443892 | Ga0206354_104438921 | 161 |
| 91 | 3300020081 | Ga0206354_11225901 | Ga0206354_112259011 | 161 |
| 92 | 3300021361 | Ga0213872_10073245 | Ga0213872_100732452 | 161 |
| 93 | 3300021377 | Ga0213874_10105728 | Ga0213874_101057281 | 161 |
| 94 | 3300022467 | Ga0224712_10093517 | Ga0224712_100935171 | 161 |
| 95 | 3300022467 | Ga0224712_10450136 | Ga0224712_104501361 | 161 |
| 96 | 3300022467 | Ga0224712_10489939 | Ga0224712_104899391 | 161 |
| 97 | 3300025297 | Ga0209758_1000619 | Ga0209758_100061955 | 161 |
| 98 | 3300025297 | Ga0209758_1016709 | Ga0209758_10167094 | 161 |
| 99 | 3300025302 | Ga0207426_1102496 | Ga0207426_11024961 | 161 |
| 100 | 3300025903 | Ga0207680_10325017 | Ga0207680_103250172 | 161 |
| 101 | 3300025910 | Ga0207684_10308000 | Ga0207684_103080003 | 161 |
| 102 | 3300025910 | Ga0207684_10370562 | Ga0207684_103705622 | 161 |
| 103 | 3300025912 | Ga0207707_10247153 | Ga0207707_102471532 | 161 |
| 104 | 3300025912 | Ga0207707_11311830 | Ga0207707_113118301 | 161 |
| 105 | 3300025916 | Ga0207663_10014437 | Ga0207663_100144372 | 161 |
| 106 | 3300025916 | Ga0207663_10505604 | Ga0207663_105056042 | 161 |
| 107 | 3300025917 | Ga0207660_10211240 | Ga0207660_102112404 | 161 |
| 108 | 3300025921 | Ga0207652_10028688 | Ga0207652_100286884 | 161 |
| 109 | 3300025921 | Ga0207652_10778038 | Ga0207652_107780381 | 161 |
| 110 | 3300025927 | Ga0207687_10010301 | Ga0207687_100103014 | 161 |
| 111 | 3300025928 | Ga0207700_11175309 | Ga0207700_111753092 | 161 |
| 112 | 3300025934 | Ga0207686_10057439 | Ga0207686_100574393 | 161 |
| 113 | 3300025939 | Ga0207665_11151072 | Ga0207665_111510721 | 161 |
| 114 | 3300025941 | Ga0207711_10045664 | Ga0207711_100456645 | 161 |
| 115 | 3300025942 | Ga0207689_10460406 | Ga0207689_104604061 | 161 |
| 116 | 3300025945 | Ga0207679_10385977 | Ga0207679_103859772 | 161 |
| 117 | 3300025986 | Ga0207658_11070725 | Ga0207658_110707251 | 161 |
| 118 | 3300026095 | Ga0207676_10419106 | Ga0207676_104191061 | 161 |
| 119 | 3300028379 | Ga0268266_10439837 | Ga0268266_104398372 | 161 |
| 120 | 3300028381 | Ga0268264_10251080 | Ga0268264_102510803 | 161 |
| 121 | 3300031235 | Ga0265330_10129924 | Ga0265330_101299242 | 161 |
| 122 | 3300031241 | Ga0265325_10015602 | Ga0265325_100156023 | 161 |
| 123 | 3300031247 | Ga0265340_10209874 | Ga0265340_102098741 | 161 |
| 124 | 3300031344 | Ga0265316_10035898 | Ga0265316_100358983 | 161 |
| 125 | 3300035172 | Ga0373955_0170252 | Ga0373955_0170252_30_533 | 161 |
| 126 | 3300035692 | Ga0373935_0503682 | Ga0373935_0503682_265_768 | 161 |
| 127 | 3300035692 | Ga0373935_0681837 | Ga0373935_0681837_126_629 | 161 |
| 128 | 3300035724 | Ga0373933_0067855 | Ga0373933_0067855_1468_1971 | 161 |
| 129 | 3300035724 | Ga0373933_0320915 | Ga0373933_0320915_390_893 | 161 |
| 130 | 3300036401 | Ga0373937_0336914 | Ga0373937_0336914_311_814 | 161 |
| 131 | 3300037068 | Ga0373925_1141558 | Ga0373925_1141558_19_522 | 161 |
| 132 | 3300037466 | Ga0395898_1403801 | Ga0395898_1403801_27_530 | 161 |
| 133 | 3300039438 | Ga0436360_0704230 | Ga0436360_0704230_415_918 | 161 |
| 134 | 3300039438 | Ga0436360_0708825 | Ga0436360_0708825_85_588 | 161 |
| 135 | 3300039447 | Ga0436361_0001602 | Ga0436361_0001602_10_513 | 161 |
| 136 | 3300039450 | Ga0436363_0122032 | Ga0436363_0122032_200_703 | 161 |
| 137 | 3300039450 | Ga0436363_0132120 | Ga0436363_0132120_400_903 | 161 |
| 138 | 3300044842 | Ga0466957_0144827 | Ga0466957_0144827_524_1027 | 161 |
| 139 | 3300045049 | Ga0466959_0667333 | Ga0466959_0667333_153_656 | 161 |
| 140 | 3300045836 | Ga0466958_0172205 | Ga0466958_0172205_586_1089 | 161 |
| 141 | 3300046459 | Ga0495629_0071983 | Ga0495629_0071983_1625_2128 | 161 |
| 142 | 3300046462 | Ga0495651_0047797 | Ga0495651_0047797_331_834 | 161 |
| 143 | 3300046477 | Ga0495664_0296148 | Ga0495664_0296148_73_576 | 161 |
| 144 | 3300046529 | Ga0495652_0112811 | Ga0495652_0112811_1166_1669 | 161 |
| 145 | 3300046529 | Ga0495652_0448019 | Ga0495652_0448019_38_541 | 161 |
| 146 | 3300046678 | Ga0495599_0084788 | Ga0495599_0084788_165_668 | 161 |
| 147 | 3300046678 | Ga0495599_0565339 | Ga0495599_0565339_151_654 | 161 |
| 148 | 3300046683 | Ga0495658_0587224 | Ga0495658_0587224_159_662 | 161 |
| 149 | 3300047317 | Ga0495604_0234964 | Ga0495604_0234964_619_1122 | 161 |
| 150 | 3300047319 | Ga0495674_1022755 | Ga0495674_1022755_28_531 | 161 |
| 151 | 3300047322 | Ga0495680_0262244 | Ga0495680_0262244_589_1092 | 161 |
| 152 | 3300047444 | Ga0495675_0145507 | Ga0495675_0145507_667_1170 | 161 |
| 153 | 3300047471 | Ga0495684_0144714 | Ga0495684_0144714_812_1315 | 161 |
| 154 | 3300048088 | Ga0495602_0470482 | Ga0495602_0470482_364_867 | 161 |
| 155 | 3300048090 | Ga0495615_0139149 | Ga0495615_0139149_143_646 | 161 |
| 156 | 3300048903 | Ga0496100_0225120 | Ga0496100_0225120_694_1197 | 161 |
| 157 | 3300048905 | Ga0496102_0155968 | Ga0496102_0155968_1001_1504 | 161 |
| 158 | 3300048905 | Ga0496102_0728799 | Ga0496102_0728799_331_834 | 161 |
| 159 | 3300048907 | Ga0496104_0000434 | Ga0496104_0000434_20581_21084 | 161 |
| 160 | 3300048907 | Ga0496104_0001436 | Ga0496104_0001436_5931_6434 | 161 |
| 161 | 3300048907 | Ga0496104_0240567 | Ga0496104_0240567_507_1010 | 161 |
| 162 | 3300048908 | Ga0496105_0012650 | Ga0496105_0012650_729_1232 | 161 |
| 163 | 3300048908 | Ga0496105_0068466 | Ga0496105_0068466_2338_2841 | 161 |
| 164 | 3300048908 | Ga0496105_0394708 | Ga0496105_0394708_554_1057 | 161 |
| 165 | 3300048911 | Ga0496108_1231711 | Ga0496108_1231711_33_536 | 161 |
| 166 | 3300048913 | Ga0496110_0416541 | Ga0496110_0416541_403_906 | 161 |
| 167 | 3300048913 | Ga0496110_0581342 | Ga0496110_0581342_224_727 | 161 |
| 168 | 3300048913 | Ga0496110_0740956 | Ga0496110_0740956_103_615 | 161 |
| 169 | 3300048915 | Ga0496112_0162994 | Ga0496112_0162994_786_1289 | 161 |
| 170 | 3300048916 | Ga0496113_0117345 | Ga0496113_0117345_1399_1902 | 161 |
| 171 | 3300048916 | Ga0496113_0905692 | Ga0496113_0905692_88_591 | 161 |
| 172 | 3300048918 | Ga0496115_0051685 | Ga0496115_0051685_160_663 | 161 |
| 173 | 3300048918 | Ga0496115_0087190 | Ga0496115_0087190_1221_1724 | 161 |
| 174 | 3300048918 | Ga0496115_0258281 | Ga0496115_0258281_188_691 | 161 |
| 175 | 3300049588 | Ga0501072_0010338 | Ga0501072_0010338_1643_2146 | 161 |
| 176 | 3300049744 | Ga0501083_0161767 | Ga0501083_0161767_805_1308 | 161 |
| 177 | 3300050491 | nmdc:mga00v17_225618_c1 | nmdc:mga00v17_225618_c1_49_552 | 161 |
| 178 | 3300050492 | nmdc:mga0yw44_70019_c1 | nmdc:mga0yw44_70019_c1_820_1323 | 161 |
| 179 | 3300050494 | nmdc:mga06z11_288944_c1 | nmdc:mga06z11_288944_c1_331_834 | 161 |
| 180 | 3300050509 | nmdc:mga0qj67_325912_c1 | nmdc:mga0qj67_325912_c1_404_907 | 161 |
| 181 | 3300050510 | nmdc:mga06r32_1047391_c1 | nmdc:mga06r32_1047391_c1_124_627 | 161 |
| 182 | 3300050510 | nmdc:mga06r32_970266_c1 | nmdc:mga06r32_970266_c1_41_544 | 161 |
| 183 | 3300053077 | Ga0495601_0023867 | Ga0495601_0023867_482_985 | 161 |
| 184 | 3300053084 | Ga0495595_0289564 | Ga0495595_0289564_207_710 | 161 |
| 185 | 3300053085 | Ga0495619_0052756 | Ga0495619_0052756_246_749 | 161 |
| 186 | 3300053085 | Ga0495619_0138947 | Ga0495619_0138947_1009_1512 | 161 |
| 187 | 3300003308 | Ga0006777J48905_1051874 | Ga0006777J48905_10518741 | 162 |
| 188 | 3300003559 | Ga0007427J51700_118976 | Ga0007427J51700_1189761 | 162 |
| 189 | 3300003568 | Ga0006781J51513_1007265 | Ga0006781J51513_10072651 | 162 |
| 190 | 3300003579 | Ga0007429J51699_1007098 | Ga0007429J51699_10070981 | 162 |
| 191 | 3300003579 | Ga0007429J51699_1037095 | Ga0007429J51699_10370951 | 162 |
| 192 | 3300003693 | Ga0032354_1037823 | Ga0032354_10378231 | 162 |
| 193 | 3300003693 | Ga0032354_1114330 | Ga0032354_11143301 | 162 |
| 194 | 3300003735 | Ga0006780_1015204 | Ga0006780_10152041 | 162 |
| 195 | 3300004801 | Ga0058860_11921752 | Ga0058860_119217522 | 162 |
| 196 | 3300005338 | Ga0068868_100220094 | Ga0068868_1002200942 | 162 |
| 197 | 3300005458 | Ga0070681_11016435 | Ga0070681_110164352 | 162 |
| 198 | 3300005614 | Ga0068856_100056664 | Ga0068856_1000566644 | 162 |
| 199 | 3300005841 | Ga0068863_100386388 | Ga0068863_1003863882 | 162 |
| 200 | 3300005842 | Ga0068858_100845081 | Ga0068858_1008450812 | 162 |
| 201 | 3300006038 | Ga0075365_10010356 | Ga0075365_100103566 | 162 |
| 202 | 3300006048 | Ga0075363_100391171 | Ga0075363_1003911712 | 162 |
| 203 | 3300006844 | Ga0075428_100157647 | Ga0075428_1001576472 | 162 |
| 204 | 3300006844 | Ga0075428_100283548 | Ga0075428_1002835483 | 162 |
| 205 | 3300006844 | Ga0075428_100717944 | Ga0075428_1007179441 | 162 |
| 206 | 3300006844 | Ga0075428_100775730 | Ga0075428_1007757303 | 162 |
| 207 | 3300006846 | Ga0075430_100000071 | Ga0075430_10000007138 | 162 |
| 208 | 3300006846 | Ga0075430_100459628 | Ga0075430_1004596283 | 162 |
| 209 | 3300006846 | Ga0075430_100968320 | Ga0075430_1009683201 | 162 |
| 210 | 3300006847 | Ga0075431_100086773 | Ga0075431_1000867733 | 162 |
| 211 | 3300006847 | Ga0075431_100311856 | Ga0075431_1003118563 | 162 |
| 212 | 3300006880 | Ga0075429_100075959 | Ga0075429_1000759593 | 162 |
| 213 | 3300006881 | Ga0068865_100322853 | Ga0068865_1003228532 | 162 |
| 214 | 3300007076 | Ga0075435_100247976 | Ga0075435_1002479762 | 162 |
| 215 | 3300009094 | Ga0111539_10051000 | Ga0111539_100510001 | 162 |
| 216 | 3300009147 | Ga0114129_10009443 | Ga0114129_1000944312 | 162 |
| 217 | 3300009147 | Ga0114129_10064619 | Ga0114129_100646195 | 162 |
| 218 | 3300009174 | Ga0105241_12023300 | Ga0105241_120233001 | 162 |
| 219 | 3300009176 | Ga0105242_12552172 | Ga0105242_125521721 | 162 |
| 220 | 3300011119 | Ga0105246_11460630 | Ga0105246_114606301 | 162 |
| 221 | 3300013296 | Ga0157374_10133126 | Ga0157374_101331264 | 162 |
| 222 | 3300020070 | Ga0206356_10495149 | Ga0206356_104951491 | 162 |
| 223 | 3300020070 | Ga0206356_11438375 | Ga0206356_114383751 | 162 |
| 224 | 3300020075 | Ga0206349_1251754 | Ga0206349_12517541 | 162 |
| 225 | 3300020077 | Ga0206351_10385539 | Ga0206351_103855391 | 162 |
| 226 | 3300020078 | Ga0206352_10384936 | Ga0206352_103849361 | 162 |
| 227 | 3300020080 | Ga0206350_10768345 | Ga0206350_107683452 | 162 |
| 228 | 3300020081 | Ga0206354_10322786 | Ga0206354_103227861 | 162 |
| 229 | 3300020082 | Ga0206353_10460892 | Ga0206353_104608921 | 162 |
| 230 | 3300020082 | Ga0206353_10632836 | Ga0206353_106328361 | 162 |
| 231 | 3300020610 | Ga0154015_1313385 | Ga0154015_13133852 | 162 |
| 232 | 3300020610 | Ga0154015_1611676 | Ga0154015_16116761 | 162 |
| 233 | 3300026041 | Ga0207639_11617140 | Ga0207639_116171401 | 162 |
| 234 | 3300026078 | Ga0207702_10519413 | Ga0207702_105194131 | 162 |
| 235 | 3300035114 | Ga0373939_0332116 | Ga0373939_0332116_94_600 | 162 |
| 236 | 3300035116 | Ga0373945_0023312 | Ga0373945_0023312_359_865 | 162 |
| 237 | 3300035170 | Ga0373943_0141312 | Ga0373943_0141312_327_833 | 162 |
| 238 | 3300035692 | Ga0373935_0446030 | Ga0373935_0446030_147_653 | 162 |
| 239 | 3300035695 | Ga0373927_0018836 | Ga0373927_0018836_2955_3461 | 162 |
| 240 | 3300035725 | Ga0373947_0381045 | Ga0373947_0381045_33_539 | 162 |
| 241 | 3300039437 | Ga0436365_0682972 | Ga0436365_0682972_5137_5646 | 162 |
| 242 | 3300046459 | Ga0495629_0041844 | Ga0495629_0041844_1715_2221 | 162 |
| 243 | 3300046461 | Ga0495641_0066256 | Ga0495641_0066256_403_909 | 162 |
| 244 | 3300046473 | Ga0495582_0017850 | Ga0495582_0017850_130_636 | 162 |
| 245 | 3300046475 | Ga0495639_0059851 | Ga0495639_0059851_1177_1683 | 162 |
| 246 | 3300046491 | Ga0495584_0196281 | Ga0495584_0196281_192_698 | 162 |
| 247 | 3300046492 | Ga0495585_0341944 | Ga0495585_0341944_173_679 | 162 |
| 248 | 3300046499 | Ga0495594_0640784 | Ga0495594_0640784_65_571 | 162 |
| 249 | 3300046518 | Ga0495631_0103505 | Ga0495631_0103505_177_683 | 162 |
| 250 | 3300046533 | Ga0495640_0212713 | Ga0495640_0212713_518_1024 | 162 |
| 251 | 3300046537 | Ga0495598_0002824 | Ga0495598_0002824_806_1420 | 162 |
| 252 | 3300046537 | Ga0495598_0057202 | Ga0495598_0057202_320_826 | 162 |
| 253 | 3300046615 | Ga0495656_0095259 | Ga0495656_0095259_390_896 | 162 |
| 254 | 3300046648 | Ga0495611_0156014 | Ga0495611_0156014_290_904 | 162 |
| 255 | 3300046665 | Ga0495661_0131043 | Ga0495661_0131043_807_1313 | 162 |
| 256 | 3300046683 | Ga0495658_0127967 | Ga0495658_0127967_704_1210 | 162 |
| 257 | 3300046689 | Ga0495613_0098928 | Ga0495613_0098928_66_572 | 162 |
| 258 | 3300046690 | Ga0495624_0064848 | Ga0495624_0064848_510_1016 | 162 |
| 259 | 3300046691 | Ga0495670_0076032 | Ga0495670_0076032_533_1039 | 162 |
| 260 | 3300046691 | Ga0495670_0095881 | Ga0495670_0095881_385_891 | 162 |
| 261 | 3300046794 | Ga0495589_0036434 | Ga0495589_0036434_1749_2255 | 162 |
| 262 | 3300046810 | Ga0495660_0343919 | Ga0495660_0343919_10_516 | 162 |
| 263 | 3300047321 | Ga0495676_0100812 | Ga0495676_0100812_1208_1714 | 162 |
| 264 | 3300048091 | Ga0495626_0109121 | Ga0495626_0109121_176_682 | 162 |
| 265 | 3300048903 | Ga0496100_0089459 | Ga0496100_0089459_998_1504 | 162 |
| 266 | 3300048903 | Ga0496100_1011318 | Ga0496100_1011318_118_624 | 162 |
| 267 | 3300048904 | Ga0496101_0543574 | Ga0496101_0543574_110_616 | 162 |
| 268 | 3300048905 | Ga0496102_0388757 | Ga0496102_0388757_150_656 | 162 |
| 269 | 3300048906 | Ga0496103_0018692 | Ga0496103_0018692_2749_3255 | 162 |
| 270 | 3300048909 | Ga0496106_0002479 | Ga0496106_0002479_2722_3228 | 162 |
| 271 | 3300048910 | Ga0496107_0002030 | Ga0496107_0002030_12144_12650 | 162 |
| 272 | 3300048911 | Ga0496108_0026286 | Ga0496108_0026286_532_1038 | 162 |
| 273 | 3300048912 | Ga0496109_0010855 | Ga0496109_0010855_3510_4016 | 162 |
| 274 | 3300048912 | Ga0496109_0518945 | Ga0496109_0518945_175_681 | 162 |
| 275 | 3300048914 | Ga0496111_0020110 | Ga0496111_0020110_134_640 | 162 |
| 276 | 3300048915 | Ga0496112_0186473 | Ga0496112_0186473_1225_1731 | 162 |
| 277 | 3300048916 | Ga0496113_0097767 | Ga0496113_0097767_443_949 | 162 |
| 278 | 3300048917 | Ga0496114_0081906 | Ga0496114_0081906_2185_2691 | 162 |
| 279 | 3300048917 | Ga0496114_1041976 | Ga0496114_1041976_17_523 | 162 |
| 280 | 3300049572 | Ga0501036_0762794 | Ga0501036_0762794_47_553 | 162 |
| 281 | 3300049588 | Ga0501072_0092360 | Ga0501072_0092360_1569_2075 | 162 |
| 282 | 3300049591 | Ga0501075_0072870 | Ga0501075_0072870_790_1296 | 162 |
| 283 | 3300049592 | Ga0501076_0065933 | Ga0501076_0065933_1170_1676 | 162 |
| 284 | 3300050493 | nmdc:mga0k408_633567_c1 | nmdc:mga0k408_633567_c1_80_586 | 162 |
| 285 | 3300050494 | nmdc:mga06z11_144211_c1 | nmdc:mga06z11_144211_c1_420_926 | 162 |
| 286 | 3300050507 | nmdc:mga05p37_1326173_c1 | nmdc:mga05p37_1326173_c1_81_587 | 162 |
| 287 | 3300050507 | nmdc:mga05p37_472626_c1 | nmdc:mga05p37_472626_c1_254_760 | 162 |
| 288 | 3300050507 | nmdc:mga05p37_965_c1 | nmdc:mga05p37_965_c1_30114_30620 | 162 |
| 289 | 3300050508 | nmdc:mga09592_77317_c1 | nmdc:mga09592_77317_c1_856_1362 | 162 |
| 290 | 3300050509 | nmdc:mga0qj67_1190587_c1 | nmdc:mga0qj67_1190587_c1_47_553 | 162 |
| 291 | 3300050509 | nmdc:mga0qj67_153_c1 | nmdc:mga0qj67_153_c1_27966_28472 | 162 |
| 292 | 3300050510 | nmdc:mga06r32_590347_c1 | nmdc:mga06r32_590347_c1_494_1000 | 162 |
| 293 | 3300050510 | nmdc:mga06r32_648817_c1 | nmdc:mga06r32_648817_c1_59_565 | 162 |
| 294 | 3300050511 | nmdc:mga08y16_255043_c1 | nmdc:mga08y16_255043_c1_633_1139 | 162 |
| 295 | 3300050512 | nmdc:mga0n895_345469_c1 | nmdc:mga0n895_345469_c1_963_1469 | 162 |
| 296 | 3300053083 | Ga0495655_0010294 | Ga0495655_0010294_861_1475 | 162 |
| 297 | 3300054114 | Ga0501084_0797580 | Ga0501084_0797580_43_549 | 162 |
| 298 | 3300059652 | Ga0587107_051911 | Ga0587107_051911_112_618 | 162 |
| 299 | 3300061734 | Ga0530510_0010972 | Ga0530510_0010972_2604_3110 | 162 |
| 300 | 3300003162 | Ga0006778J45830_1030199 | Ga0006778J45830_10301991 | 163 |
| 301 | 3300003308 | Ga0006777J48905_1013333 | Ga0006777J48905_10133331 | 163 |
| 302 | 3300003579 | Ga0007429J51699_1028379 | Ga0007429J51699_10283791 | 163 |
| 303 | 3300003735 | Ga0006780_1007617 | Ga0006780_10076171 | 163 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5l8g-assembly1.cif.gz_E | crystal structure of rhodospirillum rubrum rru_a0973 mutant h65a | 0.8655 | 4 | 70 |
| 6suw-assembly1.cif.gz_C | crystal structure of rhodospirillum rubrum rru_a0973 e31a variant | 0.8556 | 5 | 70 |
| 2gs4-assembly1.cif.gz_A | the crystal structure of the e.coli stress protein ycif. | 0.8393 | 9 | 157 |
| 4eru-assembly1.cif.gz_B | crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica | 0.8379 | 6 | 154 |
| 2gyq-assembly1.cif.gz_B | ycfi, a putative structural protein from rhodopseudomonas palustris. | 0.8227 | 3 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gyqA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8329 | 1 | 149 | 1.20.1260.10 |
| 5da5A00 | Special;Helix non-globular;Helix Hairpins; | 0.8268 | 1 | 70 | 6.10.140.1960 |
| 2gyqB00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8229 | 3 | 149 | 1.20.1260.10 |
| 5da5M00 | Special;Helix non-globular;Helix Hairpins; | 0.819 | 1 | 70 | 6.10.140.1960 |
| 5da5c00 | Special;Helix non-globular;Helix Hairpins; | 0.8129 | 1 | 70 | 6.10.140.1960 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J3JE18-F1-model_v4 | Uncharacterized protein | 0.8717 | 6 | 153 |
|
| AF-A0A4U9KPX6-F1-model_v4 | deleted | 0.8693 | 11 | 162 |
|
| AF-A0A5E7YSV3-F1-model_v4 | Uncharacterized protein | 0.8673 | 3 | 157 |
|
| AF-A0A2V8FN54-F1-model_v4 | Ferritin-like domain-containing protein | 0.8667 | 2 | 156 |
|
| AF-A0A7Y5CYC9-F1-model_v4 | Ferritin-like domain-containing protein | 0.8661 | 6 | 161 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar