F397219

General Info

Members Datasets Scaffolds Average Seq Length
303 187 302 168

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0002824|Ga0495598_0002824_806_1420
Length 204
Sequence LRSWLDVNGVTRARIRIAMAPRIRVPHPIPNRKAEAMGLFSKDIKTMDDLFVHTLRDIYYAENQILKALPEMIEKATDAQLRQALQSHLAETKNQVKRVEQVFQMHGVEAKGIDCPAIDGIIEEADDVAGEIADKEVLDAALAGAAQAVEHYEIARYGTLIAWAKQLGRNDCASVLQKNLDEEKAADKKLTEIAEARLNLKAAS

Samples

Sample ID Description Type Environment
1 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
64 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
70 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
71 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
74 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
105 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
106 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
121 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
124 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
125 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
129 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
133 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
182 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.17
Metatranscriptomes 16.5
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0.33
Rhizoplane 14.85
Rhizosphere 79.21
Stem 0
Stem Tuber 0
Unclassified 1.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006778J45830_1030199 3300003162 Bacteria 578
2 JGI25153J46596_10007746 3300003215 Bacteria 5227
3 Ga0006777J48905_1013333 3300003308 Bacteria 593
4 Ga0006777J48905_1051874 3300003308 Bacteria 1198
5 Ga0006777J48905_1083851 3300003308 Bacteria 639
6 Ga0007427J51700_118976 3300003559 Bacteria 580
7 Ga0006781J51513_1007265 3300003568 Bacteria 585
8 Ga0007429J51699_1007098 3300003579 Bacteria 581
9 Ga0007429J51699_1021955 3300003579 Bacteria 594
10 Ga0007429J51699_1028379 3300003579 Bacteria 579
11 Ga0007429J51699_1037095 3300003579 Bacteria 1267
12 Ga0007429J51699_1050522 3300003579 Bacteria 793
13 Ga0007429J51699_1074524 3300003579 Bacteria 613
14 Ga0007429J51699_1123885 3300003579 Bacteria 663
15 Ga0032354_1018101 3300003693 Bacteria 592
16 Ga0032354_1037823 3300003693 Bacteria 967
17 Ga0032354_1114330 3300003693 Bacteria 597
18 Ga0006780_1007617 3300003735 Bacteria 588
19 Ga0006780_1015204 3300003735 Bacteria 747
20 Ga0006780_1036199 3300003735 Bacteria 611
21 Ga0058860_11921752 3300004801 Bacteria 855
22 Ga0070690_100051757 3300005330 Bacteria 2623
23 Ga0070670_100015821 3300005331 Bacteria 6475
24 Ga0068868_100135639 3300005338 Bacteria 2017
25 Ga0068868_100220094 3300005338 Bacteria 1589
26 Ga0070689_100736971 3300005340 Bacteria 863
27 Ga0070689_101046081 3300005340 Bacteria 728
28 Ga0070667_100060898 3300005367 Bacteria 3195
29 Ga0070667_101459900 3300005367 Bacteria 642
30 Ga0070709_10532331 3300005434 Bacteria 897
31 Ga0070714_101293683 3300005435 Bacteria 712
32 Ga0070713_100050287 3300005436 Bacteria 3442
33 Ga0070705_101127483 3300005440 Bacteria 643
34 Ga0070681_10383750 3300005458 Bacteria 1316
35 Ga0070681_10749667 3300005458 Bacteria 893
36 Ga0070681_11016435 3300005458 Bacteria 749
37 Ga0070698_101096596 3300005471 Bacteria 744
38 Ga0070679_100039816 3300005530 Bacteria 4673
39 Ga0070665_100591266 3300005548 Bacteria 1123
40 Ga0070664_100322385 3300005564 Bacteria 1400
41 Ga0070664_101108248 3300005564 Bacteria 746
42 Ga0068856_100056664 3300005614 Bacteria 3868
43 Ga0068856_100777180 3300005614 Bacteria 977
44 Ga0068859_101758433 3300005617 Bacteria 685
45 Ga0068864_100296345 3300005618 Bacteria 1513
46 Ga0068863_100386388 3300005841 Bacteria 1367
47 Ga0068858_100845081 3300005842 Bacteria 894
48 Ga0068860_100582562 3300005843 Bacteria 1123
49 Ga0081538_10061755 3300005981 Bacteria 2142
50 Ga0081539_10042081 3300005985 Bacteria 2664
51 Ga0070717_10022298 3300006028 Bacteria 5002
52 Ga0070717_10110211 3300006028 Bacteria 2347
53 Ga0075365_10003837 3300006038 Bacteria 7843
54 Ga0075365_10010356 3300006038 Bacteria 5424
55 Ga0075363_100391171 3300006048 Bacteria 816
56 Ga0070716_100353036 3300006173 Bacteria 1041
57 Ga0075428_100025201 3300006844 Bacteria 6581
58 Ga0075428_100157647 3300006844 Bacteria 2465
59 Ga0075428_100232448 3300006844 Bacteria 1990
60 Ga0075428_100283548 3300006844 Bacteria 1782
61 Ga0075428_100717944 3300006844 Bacteria 1064
62 Ga0075428_100775730 3300006844 Bacteria 1019
63 Ga0075428_102008882 3300006844 Bacteria 599
64 Ga0075430_100000071 3300006846 Bacteria 55634
65 Ga0075430_100459628 3300006846 Bacteria 1050
66 Ga0075430_100968320 3300006846 Bacteria 701
67 Ga0075431_100086773 3300006847 Bacteria 3229
68 Ga0075431_100311856 3300006847 Bacteria 1588
69 Ga0075431_100982799 3300006847 Bacteria 811
70 Ga0075434_100021671 3300006871 Bacteria 6249
71 Ga0075429_100075959 3300006880 Bacteria 2926
72 Ga0075429_100766783 3300006880 Bacteria 845
73 Ga0075429_101021715 3300006880 Bacteria 723
74 Ga0068865_100322853 3300006881 Bacteria 1242
75 Ga0075436_100401146 3300006914 Bacteria 994
76 Ga0097620_101758562 3300006931 Bacteria 685
77 Ga0075435_100247976 3300007076 Bacteria 1515
78 Ga0075435_100694965 3300007076 Bacteria 884
79 Ga0105240_10455083 3300009093 Bacteria 1431
80 Ga0111539_10051000 3300009094 Bacteria 4929
81 Ga0114129_10009443 3300009147 Bacteria 13902
82 Ga0114129_10064619 3300009147 Bacteria 5107
83 Ga0105243_10160510 3300009148 Bacteria 1938
84 Ga0105241_12023300 3300009174 Bacteria 567
85 Ga0105242_10116810 3300009176 Bacteria 2283
86 Ga0105242_12552172 3300009176 Bacteria 560
87 Ga0105248_10085668 3300009177 Bacteria 3546
88 Ga0105238_10031659 3300009551 Bacteria 5384
89 Ga0105246_10038629 3300011119 Bacteria 3211
90 Ga0105246_11460630 3300011119 Bacteria 640
91 Ga0157370_10558654 3300013104 Bacteria 1049
92 Ga0157374_10133126 3300013296 Bacteria 2407
93 Ga0157374_10499739 3300013296 Bacteria 1221
94 Ga0157372_11369860 3300013307 Bacteria 816
95 Ga0163163_10005938 3300014325 Bacteria 10628
96 Ga0157380_10917286 3300014326 Bacteria 903
97 Ga0197907_10213847 3300020069 Bacteria 631
98 Ga0197907_11106567 3300020069 Bacteria 599
99 Ga0206356_10495149 3300020070 Bacteria 611
100 Ga0206356_11417417 3300020070 Bacteria 1189
101 Ga0206356_11438375 3300020070 Bacteria 889
102 Ga0206349_1251754 3300020075 Bacteria 895
103 Ga0206355_1246740 3300020076 Bacteria 599
104 Ga0206351_10296349 3300020077 Bacteria 836
105 Ga0206351_10385539 3300020077 Bacteria 889
106 Ga0206351_10652214 3300020077 Bacteria 1311
107 Ga0206352_10076733 3300020078 Bacteria 619
108 Ga0206352_10169809 3300020078 Bacteria 543
109 Ga0206352_10384936 3300020078 Bacteria 910
110 Ga0206352_10467591 3300020078 Bacteria 706
111 Ga0206350_10452236 3300020080 Bacteria 611
112 Ga0206350_10543441 3300020080 Bacteria 1338
113 Ga0206350_10548868 3300020080 Bacteria 611
114 Ga0206350_10768345 3300020080 Bacteria 1008
115 Ga0206354_10322786 3300020081 Bacteria 611
116 Ga0206354_10443892 3300020081 Bacteria 564
117 Ga0206354_11225901 3300020081 Bacteria 740
118 Ga0206353_10460892 3300020082 Bacteria 901
119 Ga0206353_10632836 3300020082 Bacteria 778
120 Ga0154015_1313385 3300020610 Bacteria 744
121 Ga0154015_1611676 3300020610 Bacteria 573
122 Ga0213872_10073245 3300021361 Bacteria 1543
123 Ga0213874_10105728 3300021377 Bacteria 941
124 Ga0224712_10093517 3300022467 Bacteria 1263
125 Ga0224712_10450136 3300022467 Bacteria 618
126 Ga0224712_10476911 3300022467 Bacteria 601
127 Ga0224712_10489939 3300022467 Bacteria 593
128 Ga0209758_1000619 3300025297 Bacteria 54561
129 Ga0209758_1016709 3300025297 Bacteria 3707
130 Ga0207426_1102496 3300025302 Bacteria 736
131 Ga0207680_10325017 3300025903 Bacteria 1076
132 Ga0207684_10308000 3300025910 Bacteria 1365
133 Ga0207684_10370562 3300025910 Bacteria 1232
134 Ga0207707_10247153 3300025912 Bacteria 1550
135 Ga0207707_11311830 3300025912 Bacteria 581
136 Ga0207663_10014437 3300025916 Bacteria 4323
137 Ga0207663_10505604 3300025916 Bacteria 939
138 Ga0207660_10211240 3300025917 Bacteria 1520
139 Ga0207652_10028688 3300025921 Bacteria 4646
140 Ga0207652_10778038 3300025921 Bacteria 851
141 Ga0207650_10000743 3300025925 Bacteria 25164
142 Ga0207687_10010301 3300025927 Bacteria 6108
143 Ga0207700_11175309 3300025928 Bacteria 685
144 Ga0207686_10057439 3300025934 Bacteria 2450
145 Ga0207665_11151072 3300025939 Bacteria 619
146 Ga0207711_10045664 3300025941 Bacteria 3744
147 Ga0207689_10460406 3300025942 Bacteria 1063
148 Ga0207679_10385977 3300025945 Bacteria 1229
149 Ga0207679_10570652 3300025945 Bacteria 1017
150 Ga0207658_11070725 3300025986 Bacteria 736
151 Ga0207639_11617140 3300026041 Bacteria 608
152 Ga0207702_10519413 3300026078 Bacteria 1162
153 Ga0207676_10419106 3300026095 Bacteria 1255
154 Ga0268266_10439837 3300028379 Bacteria 1238
155 Ga0268264_10251080 3300028381 Bacteria 1643
156 Ga0265330_10129924 3300031235 Bacteria 1072
157 Ga0265325_10015602 3300031241 Bacteria 4268
158 Ga0265340_10209874 3300031247 Bacteria 874
159 Ga0265316_10035898 3300031344 Bacteria 4012
160 Ga0373939_0332116 3300035114 Bacteria 614
161 Ga0373945_0023312 3300035116 Bacteria 2137
162 Ga0373943_0141312 3300035170 Bacteria 1297
163 Ga0373943_0437968 3300035170 Bacteria 758
164 Ga0373955_0170252 3300035172 Bacteria 1289
165 Ga0373935_0446030 3300035692 Bacteria 934
166 Ga0373935_0503682 3300035692 Bacteria 879
167 Ga0373935_0681837 3300035692 Bacteria 755
168 Ga0373927_0018836 3300035695 Bacteria 4529
169 Ga0373933_0067855 3300035724 Bacteria 2165
170 Ga0373933_0320915 3300035724 Bacteria 1004
171 Ga0373947_0381045 3300035725 Bacteria 949
172 Ga0373937_0336914 3300036401 Bacteria 1428
173 Ga0373925_1141558 3300037068 Bacteria 641
174 Ga0395898_1403801 3300037466 Bacteria 626
175 Ga0436365_0682972 3300039437 Bacteria 8452
176 Ga0436360_0704230 3300039438 Bacteria 953
177 Ga0436360_0708825 3300039438 Bacteria 820
178 Ga0436361_0001602 3300039447 Bacteria 633
179 Ga0436363_0122032 3300039450 Bacteria 1035
180 Ga0436363_0132120 3300039450 Bacteria 1033
181 Ga0466957_0144827 3300044842 Bacteria 1533
182 Ga0466959_0667333 3300045049 Bacteria 697
183 Ga0466958_0172205 3300045836 Bacteria 1371
184 Ga0495629_0041844 3300046459 Bacteria 3221
185 Ga0495629_0071983 3300046459 Bacteria 2413
186 Ga0495641_0066256 3300046461 Bacteria 1625
187 Ga0495651_0047797 3300046462 Bacteria 3306
188 Ga0495582_0017850 3300046473 Bacteria 3878
189 Ga0495639_0059851 3300046475 Bacteria 1744
190 Ga0495664_0296148 3300046477 Bacteria 977
191 Ga0495584_0196281 3300046491 Bacteria 1026
192 Ga0495585_0341944 3300046492 Bacteria 728
193 Ga0495594_0640784 3300046499 Bacteria 602
194 Ga0495631_0103505 3300046518 Bacteria 1225
195 Ga0495652_0112811 3300046529 Bacteria 2183
196 Ga0495652_0448019 3300046529 Bacteria 904
197 Ga0495640_0212713 3300046533 Bacteria 1222
198 Ga0495598_0002824 3300046537 Bacteria 3619
199 Ga0495598_0057202 3300046537 Bacteria 1193
200 Ga0495656_0095259 3300046615 Bacteria 1368
201 Ga0495611_0156014 3300046648 Bacteria 1066
202 Ga0495661_0131043 3300046665 Bacteria 1374
203 Ga0495599_0084788 3300046678 Bacteria 1979
204 Ga0495599_0565339 3300046678 Bacteria 665
205 Ga0495658_0127967 3300046683 Bacteria 1543
206 Ga0495658_0587224 3300046683 Bacteria 714
207 Ga0495613_0098928 3300046689 Bacteria 2108
208 Ga0495624_0064848 3300046690 Bacteria 2282
209 Ga0495670_0076032 3300046691 Bacteria 1706
210 Ga0495670_0095881 3300046691 Bacteria 1522
211 Ga0495589_0036434 3300046794 Bacteria 2466
212 Ga0495660_0343919 3300046810 Bacteria 665
213 Ga0495604_0234964 3300047317 Bacteria 1256
214 Ga0495674_1022755 3300047319 Bacteria 632
215 Ga0495676_0100812 3300047321 Bacteria 2137
216 Ga0495680_0262244 3300047322 Bacteria 1222
217 Ga0495675_0145507 3300047444 Bacteria 1467
218 Ga0495684_0144714 3300047471 Bacteria 1781
219 Ga0495602_0470482 3300048088 Bacteria 884
220 Ga0495615_0139149 3300048090 Bacteria 715
221 Ga0495626_0109121 3300048091 Bacteria 1200
222 Ga0496100_0089459 3300048903 Bacteria 2097
223 Ga0496100_0225120 3300048903 Bacteria 1378
224 Ga0496100_1011318 3300048903 Bacteria 654
225 Ga0496101_0253617 3300048904 Bacteria 1371
226 Ga0496101_0543574 3300048904 Bacteria 918
227 Ga0496102_0155968 3300048905 Bacteria 2146
228 Ga0496102_0388757 3300048905 Bacteria 1312
229 Ga0496102_0728799 3300048905 Bacteria 914
230 Ga0496103_0012827 3300048906 Bacteria 4970
231 Ga0496103_0018692 3300048906 Bacteria 4158
232 Ga0496104_0000434 3300048907 Bacteria 36228
233 Ga0496104_0001436 3300048907 Bacteria 20595
234 Ga0496104_0032502 3300048907 Bacteria 4856
235 Ga0496104_0240567 3300048907 Bacteria 1722
236 Ga0496105_0009775 3300048908 Bacteria 7512
237 Ga0496105_0012650 3300048908 Bacteria 6685
238 Ga0496105_0068466 3300048908 Bacteria 2933
239 Ga0496105_0394708 3300048908 Bacteria 1099
240 Ga0496106_0002479 3300048909 Bacteria 13755
241 Ga0496106_0082704 3300048909 Bacteria 2468
242 Ga0496107_0002030 3300048910 Bacteria 12929
243 Ga0496108_0001203 3300048911 Bacteria 20288
244 Ga0496108_0026286 3300048911 Bacteria 4800
245 Ga0496108_1231711 3300048911 Bacteria 632
246 Ga0496109_0004657 3300048912 Bacteria 11452
247 Ga0496109_0010855 3300048912 Bacteria 7796
248 Ga0496109_0518945 3300048912 Bacteria 1124
249 Ga0496110_0023519 3300048913 Bacteria 5242
250 Ga0496110_0416541 3300048913 Bacteria 1225
251 Ga0496110_0581342 3300048913 Bacteria 1017
252 Ga0496110_0740956 3300048913 Bacteria 885
253 Ga0496111_0005844 3300048914 Bacteria 7933
254 Ga0496111_0020110 3300048914 Bacteria 4643
255 Ga0496112_0006422 3300048915 Bacteria 10319
256 Ga0496112_0162994 3300048915 Bacteria 2196
257 Ga0496112_0186473 3300048915 Bacteria 2037
258 Ga0496113_0000215 3300048916 Bacteria 27020
259 Ga0496113_0097767 3300048916 Bacteria 2271
260 Ga0496113_0117345 3300048916 Bacteria 2078
261 Ga0496113_0905692 3300048916 Bacteria 697
262 Ga0496114_0081906 3300048917 Bacteria 2727
263 Ga0496114_1041976 3300048917 Bacteria 702
264 Ga0496115_0051685 3300048918 Bacteria 3295
265 Ga0496115_0087190 3300048918 Bacteria 2547
266 Ga0496115_0258281 3300048918 Bacteria 1433
267 Ga0501036_0762794 3300049572 Bacteria 798
268 Ga0501067_0438183 3300049583 Bacteria 729
269 Ga0501072_0010338 3300049588 Bacteria 7110
270 Ga0501072_0092360 3300049588 Bacteria 2404
271 Ga0501075_0072870 3300049591 Bacteria 2597
272 Ga0501076_0065933 3300049592 Bacteria 2889
273 Ga0501083_0161767 3300049744 Bacteria 1464
274 nmdc:mga00v17_225618_c1 3300050491 Bacteria 1213
275 nmdc:mga0yw44_70019_c1 3300050492 Bacteria 2174
276 nmdc:mga0k408_633567_c1 3300050493 Bacteria 629
277 nmdc:mga06z11_144211_c1 3300050494 Bacteria 1348
278 nmdc:mga06z11_288944_c1 3300050494 Bacteria 972
279 nmdc:mga05p37_1326173_c1 3300050507 Bacteria 731
280 nmdc:mga05p37_472626_c1 3300050507 Bacteria 1446
281 nmdc:mga05p37_965_c1 3300050507 Bacteria 32561
282 nmdc:mga09592_649391_c1 3300050508 Bacteria 901
283 nmdc:mga09592_77317_c1 3300050508 Bacteria 2831
284 nmdc:mga0qj67_1190587_c1 3300050509 Bacteria 593
285 nmdc:mga0qj67_153_c1 3300050509 Bacteria 46326
286 nmdc:mga0qj67_325912_c1 3300050509 Bacteria 1243
287 nmdc:mga06r32_1047391_c1 3300050510 Bacteria 767
288 nmdc:mga06r32_590347_c1 3300050510 Bacteria 1082
289 nmdc:mga06r32_648817_c1 3300050510 Bacteria 1024
290 nmdc:mga06r32_970266_c1 3300050510 Bacteria 804
291 nmdc:mga08y16_255043_c1 3300050511 Bacteria 1812
292 nmdc:mga0n895_345469_c1 3300050512 Bacteria 1507
293 nmdc:mga0n895_65534_c1 3300050512 Bacteria 3595
294 Ga0495601_0023867 3300053077 Bacteria 3761
295 Ga0495655_0010294 3300053083 Bacteria 1842
296 Ga0495595_0289564 3300053084 Bacteria 823
297 Ga0495619_0052756 3300053085 Bacteria 2689
298 Ga0495619_0138947 3300053085 Bacteria 1672
299 Ga0495619_0474774 3300053085 Bacteria 861
300 Ga0501084_0797580 3300054114 Bacteria 795
301 Ga0587107_051911 3300059652 Bacteria 698
302 Ga0530510_0010972 3300061734 Bacteria 6355

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049583 Ga0501067_0438183 Ga0501067_0438183_175_684 153
2 3300005331 Ga0070670_100015821 Ga0070670_1000158217 157
3 3300005564 Ga0070664_101108248 Ga0070664_1011082481 157
4 3300006844 Ga0075428_100232448 Ga0075428_1002324482 157
5 3300006871 Ga0075434_100021671 Ga0075434_1000216712 157
6 3300006880 Ga0075429_100766783 Ga0075429_1007667832 157
7 3300011119 Ga0105246_10038629 Ga0105246_100386293 157
8 3300014325 Ga0163163_10005938 Ga0163163_100059382 157
9 3300020069 Ga0197907_10213847 Ga0197907_102138471 157
10 3300020078 Ga0206352_10467591 Ga0206352_104675911 157
11 3300020080 Ga0206350_10548868 Ga0206350_105488681 157
12 3300022467 Ga0224712_10476911 Ga0224712_104769111 157
13 3300025925 Ga0207650_10000743 Ga0207650_100007438 157
14 3300025945 Ga0207679_10570652 Ga0207679_105706522 157
15 3300035170 Ga0373943_0437968 Ga0373943_0437968_139_645 157
16 3300048904 Ga0496101_0253617 Ga0496101_0253617_233_739 157
17 3300048906 Ga0496103_0012827 Ga0496103_0012827_47_553 157
18 3300048907 Ga0496104_0032502 Ga0496104_0032502_142_648 157
19 3300048908 Ga0496105_0009775 Ga0496105_0009775_4015_4521 157
20 3300048909 Ga0496106_0082704 Ga0496106_0082704_485_991 157
21 3300048911 Ga0496108_0001203 Ga0496108_0001203_8911_9417 157
22 3300048912 Ga0496109_0004657 Ga0496109_0004657_930_1436 157
23 3300048913 Ga0496110_0023519 Ga0496110_0023519_4421_4927 157
24 3300048914 Ga0496111_0005844 Ga0496111_0005844_1535_2041 157
25 3300048915 Ga0496112_0006422 Ga0496112_0006422_6835_7341 157
26 3300048916 Ga0496113_0000215 Ga0496113_0000215_16431_16937 157
27 3300050508 nmdc:mga09592_649391_c1 nmdc:mga09592_649391_c1_143_649 157
28 3300050512 nmdc:mga0n895_65534_c1 nmdc:mga0n895_65534_c1_918_1424 157
29 3300053085 Ga0495619_0474774 Ga0495619_0474774_181_687 157
30 iso_pu_bacteria 2513237087 2513590552 158
31 3300003215 JGI25153J46596_10007746 JGI25153J46596_100077462 161
32 3300003308 Ga0006777J48905_1083851 Ga0006777J48905_10838511 161
33 3300003579 Ga0007429J51699_1021955 Ga0007429J51699_10219551 161
34 3300003579 Ga0007429J51699_1050522 Ga0007429J51699_10505221 161
35 3300003579 Ga0007429J51699_1074524 Ga0007429J51699_10745241 161
36 3300003579 Ga0007429J51699_1123885 Ga0007429J51699_11238851 161
37 3300003693 Ga0032354_1018101 Ga0032354_10181011 161
38 3300003735 Ga0006780_1036199 Ga0006780_10361991 161
39 3300005330 Ga0070690_100051757 Ga0070690_1000517573 161
40 3300005338 Ga0068868_100135639 Ga0068868_1001356392 161
41 3300005340 Ga0070689_100736971 Ga0070689_1007369711 161
42 3300005340 Ga0070689_101046081 Ga0070689_1010460811 161
43 3300005367 Ga0070667_100060898 Ga0070667_1000608982 161
44 3300005367 Ga0070667_101459900 Ga0070667_1014599001 161
45 3300005434 Ga0070709_10532331 Ga0070709_105323312 161
46 3300005435 Ga0070714_101293683 Ga0070714_1012936831 161
47 3300005436 Ga0070713_100050287 Ga0070713_1000502872 161
48 3300005440 Ga0070705_101127483 Ga0070705_1011274831 161
49 3300005458 Ga0070681_10383750 Ga0070681_103837502 161
50 3300005458 Ga0070681_10749667 Ga0070681_107496671 161
51 3300005471 Ga0070698_101096596 Ga0070698_1010965961 161
52 3300005530 Ga0070679_100039816 Ga0070679_1000398167 161
53 3300005548 Ga0070665_100591266 Ga0070665_1005912662 161
54 3300005564 Ga0070664_100322385 Ga0070664_1003223852 161
55 3300005614 Ga0068856_100777180 Ga0068856_1007771802 161
56 3300005617 Ga0068859_101758433 Ga0068859_1017584331 161
57 3300005618 Ga0068864_100296345 Ga0068864_1002963452 161
58 3300005843 Ga0068860_100582562 Ga0068860_1005825622 161
59 3300005981 Ga0081538_10061755 Ga0081538_100617552 161
60 3300005985 Ga0081539_10042081 Ga0081539_100420813 161
61 3300006028 Ga0070717_10022298 Ga0070717_100222988 161
62 3300006028 Ga0070717_10110211 Ga0070717_101102113 161
63 3300006038 Ga0075365_10003837 Ga0075365_100038372 161
64 3300006173 Ga0070716_100353036 Ga0070716_1003530361 161
65 3300006844 Ga0075428_100025201 Ga0075428_1000252012 161
66 3300006844 Ga0075428_102008882 Ga0075428_1020088821 161
67 3300006847 Ga0075431_100982799 Ga0075431_1009827992 161
68 3300006880 Ga0075429_101021715 Ga0075429_1010217151 161
69 3300006914 Ga0075436_100401146 Ga0075436_1004011462 161
70 3300006931 Ga0097620_101758562 Ga0097620_1017585621 161
71 3300007076 Ga0075435_100694965 Ga0075435_1006949652 161
72 3300009093 Ga0105240_10455083 Ga0105240_104550832 161
73 3300009148 Ga0105243_10160510 Ga0105243_101605102 161
74 3300009176 Ga0105242_10116810 Ga0105242_101168103 161
75 3300009177 Ga0105248_10085668 Ga0105248_100856682 161
76 3300009551 Ga0105238_10031659 Ga0105238_100316596 161
77 3300013104 Ga0157370_10558654 Ga0157370_105586542 161
78 3300013296 Ga0157374_10499739 Ga0157374_104997391 161
79 3300013307 Ga0157372_11369860 Ga0157372_113698601 161
80 3300014326 Ga0157380_10917286 Ga0157380_109172861 161
81 3300020069 Ga0197907_11106567 Ga0197907_111065671 161
82 3300020070 Ga0206356_11417417 Ga0206356_114174172 161
83 3300020076 Ga0206355_1246740 Ga0206355_12467401 161
84 3300020077 Ga0206351_10296349 Ga0206351_102963491 161
85 3300020077 Ga0206351_10652214 Ga0206351_106522141 161
86 3300020078 Ga0206352_10076733 Ga0206352_100767331 161
87 3300020078 Ga0206352_10169809 Ga0206352_101698091 161
88 3300020080 Ga0206350_10452236 Ga0206350_104522361 161
89 3300020080 Ga0206350_10543441 Ga0206350_105434412 161
90 3300020081 Ga0206354_10443892 Ga0206354_104438921 161
91 3300020081 Ga0206354_11225901 Ga0206354_112259011 161
92 3300021361 Ga0213872_10073245 Ga0213872_100732452 161
93 3300021377 Ga0213874_10105728 Ga0213874_101057281 161
94 3300022467 Ga0224712_10093517 Ga0224712_100935171 161
95 3300022467 Ga0224712_10450136 Ga0224712_104501361 161
96 3300022467 Ga0224712_10489939 Ga0224712_104899391 161
97 3300025297 Ga0209758_1000619 Ga0209758_100061955 161
98 3300025297 Ga0209758_1016709 Ga0209758_10167094 161
99 3300025302 Ga0207426_1102496 Ga0207426_11024961 161
100 3300025903 Ga0207680_10325017 Ga0207680_103250172 161
101 3300025910 Ga0207684_10308000 Ga0207684_103080003 161
102 3300025910 Ga0207684_10370562 Ga0207684_103705622 161
103 3300025912 Ga0207707_10247153 Ga0207707_102471532 161
104 3300025912 Ga0207707_11311830 Ga0207707_113118301 161
105 3300025916 Ga0207663_10014437 Ga0207663_100144372 161
106 3300025916 Ga0207663_10505604 Ga0207663_105056042 161
107 3300025917 Ga0207660_10211240 Ga0207660_102112404 161
108 3300025921 Ga0207652_10028688 Ga0207652_100286884 161
109 3300025921 Ga0207652_10778038 Ga0207652_107780381 161
110 3300025927 Ga0207687_10010301 Ga0207687_100103014 161
111 3300025928 Ga0207700_11175309 Ga0207700_111753092 161
112 3300025934 Ga0207686_10057439 Ga0207686_100574393 161
113 3300025939 Ga0207665_11151072 Ga0207665_111510721 161
114 3300025941 Ga0207711_10045664 Ga0207711_100456645 161
115 3300025942 Ga0207689_10460406 Ga0207689_104604061 161
116 3300025945 Ga0207679_10385977 Ga0207679_103859772 161
117 3300025986 Ga0207658_11070725 Ga0207658_110707251 161
118 3300026095 Ga0207676_10419106 Ga0207676_104191061 161
119 3300028379 Ga0268266_10439837 Ga0268266_104398372 161
120 3300028381 Ga0268264_10251080 Ga0268264_102510803 161
121 3300031235 Ga0265330_10129924 Ga0265330_101299242 161
122 3300031241 Ga0265325_10015602 Ga0265325_100156023 161
123 3300031247 Ga0265340_10209874 Ga0265340_102098741 161
124 3300031344 Ga0265316_10035898 Ga0265316_100358983 161
125 3300035172 Ga0373955_0170252 Ga0373955_0170252_30_533 161
126 3300035692 Ga0373935_0503682 Ga0373935_0503682_265_768 161
127 3300035692 Ga0373935_0681837 Ga0373935_0681837_126_629 161
128 3300035724 Ga0373933_0067855 Ga0373933_0067855_1468_1971 161
129 3300035724 Ga0373933_0320915 Ga0373933_0320915_390_893 161
130 3300036401 Ga0373937_0336914 Ga0373937_0336914_311_814 161
131 3300037068 Ga0373925_1141558 Ga0373925_1141558_19_522 161
132 3300037466 Ga0395898_1403801 Ga0395898_1403801_27_530 161
133 3300039438 Ga0436360_0704230 Ga0436360_0704230_415_918 161
134 3300039438 Ga0436360_0708825 Ga0436360_0708825_85_588 161
135 3300039447 Ga0436361_0001602 Ga0436361_0001602_10_513 161
136 3300039450 Ga0436363_0122032 Ga0436363_0122032_200_703 161
137 3300039450 Ga0436363_0132120 Ga0436363_0132120_400_903 161
138 3300044842 Ga0466957_0144827 Ga0466957_0144827_524_1027 161
139 3300045049 Ga0466959_0667333 Ga0466959_0667333_153_656 161
140 3300045836 Ga0466958_0172205 Ga0466958_0172205_586_1089 161
141 3300046459 Ga0495629_0071983 Ga0495629_0071983_1625_2128 161
142 3300046462 Ga0495651_0047797 Ga0495651_0047797_331_834 161
143 3300046477 Ga0495664_0296148 Ga0495664_0296148_73_576 161
144 3300046529 Ga0495652_0112811 Ga0495652_0112811_1166_1669 161
145 3300046529 Ga0495652_0448019 Ga0495652_0448019_38_541 161
146 3300046678 Ga0495599_0084788 Ga0495599_0084788_165_668 161
147 3300046678 Ga0495599_0565339 Ga0495599_0565339_151_654 161
148 3300046683 Ga0495658_0587224 Ga0495658_0587224_159_662 161
149 3300047317 Ga0495604_0234964 Ga0495604_0234964_619_1122 161
150 3300047319 Ga0495674_1022755 Ga0495674_1022755_28_531 161
151 3300047322 Ga0495680_0262244 Ga0495680_0262244_589_1092 161
152 3300047444 Ga0495675_0145507 Ga0495675_0145507_667_1170 161
153 3300047471 Ga0495684_0144714 Ga0495684_0144714_812_1315 161
154 3300048088 Ga0495602_0470482 Ga0495602_0470482_364_867 161
155 3300048090 Ga0495615_0139149 Ga0495615_0139149_143_646 161
156 3300048903 Ga0496100_0225120 Ga0496100_0225120_694_1197 161
157 3300048905 Ga0496102_0155968 Ga0496102_0155968_1001_1504 161
158 3300048905 Ga0496102_0728799 Ga0496102_0728799_331_834 161
159 3300048907 Ga0496104_0000434 Ga0496104_0000434_20581_21084 161
160 3300048907 Ga0496104_0001436 Ga0496104_0001436_5931_6434 161
161 3300048907 Ga0496104_0240567 Ga0496104_0240567_507_1010 161
162 3300048908 Ga0496105_0012650 Ga0496105_0012650_729_1232 161
163 3300048908 Ga0496105_0068466 Ga0496105_0068466_2338_2841 161
164 3300048908 Ga0496105_0394708 Ga0496105_0394708_554_1057 161
165 3300048911 Ga0496108_1231711 Ga0496108_1231711_33_536 161
166 3300048913 Ga0496110_0416541 Ga0496110_0416541_403_906 161
167 3300048913 Ga0496110_0581342 Ga0496110_0581342_224_727 161
168 3300048913 Ga0496110_0740956 Ga0496110_0740956_103_615 161
169 3300048915 Ga0496112_0162994 Ga0496112_0162994_786_1289 161
170 3300048916 Ga0496113_0117345 Ga0496113_0117345_1399_1902 161
171 3300048916 Ga0496113_0905692 Ga0496113_0905692_88_591 161
172 3300048918 Ga0496115_0051685 Ga0496115_0051685_160_663 161
173 3300048918 Ga0496115_0087190 Ga0496115_0087190_1221_1724 161
174 3300048918 Ga0496115_0258281 Ga0496115_0258281_188_691 161
175 3300049588 Ga0501072_0010338 Ga0501072_0010338_1643_2146 161
176 3300049744 Ga0501083_0161767 Ga0501083_0161767_805_1308 161
177 3300050491 nmdc:mga00v17_225618_c1 nmdc:mga00v17_225618_c1_49_552 161
178 3300050492 nmdc:mga0yw44_70019_c1 nmdc:mga0yw44_70019_c1_820_1323 161
179 3300050494 nmdc:mga06z11_288944_c1 nmdc:mga06z11_288944_c1_331_834 161
180 3300050509 nmdc:mga0qj67_325912_c1 nmdc:mga0qj67_325912_c1_404_907 161
181 3300050510 nmdc:mga06r32_1047391_c1 nmdc:mga06r32_1047391_c1_124_627 161
182 3300050510 nmdc:mga06r32_970266_c1 nmdc:mga06r32_970266_c1_41_544 161
183 3300053077 Ga0495601_0023867 Ga0495601_0023867_482_985 161
184 3300053084 Ga0495595_0289564 Ga0495595_0289564_207_710 161
185 3300053085 Ga0495619_0052756 Ga0495619_0052756_246_749 161
186 3300053085 Ga0495619_0138947 Ga0495619_0138947_1009_1512 161
187 3300003308 Ga0006777J48905_1051874 Ga0006777J48905_10518741 162
188 3300003559 Ga0007427J51700_118976 Ga0007427J51700_1189761 162
189 3300003568 Ga0006781J51513_1007265 Ga0006781J51513_10072651 162
190 3300003579 Ga0007429J51699_1007098 Ga0007429J51699_10070981 162
191 3300003579 Ga0007429J51699_1037095 Ga0007429J51699_10370951 162
192 3300003693 Ga0032354_1037823 Ga0032354_10378231 162
193 3300003693 Ga0032354_1114330 Ga0032354_11143301 162
194 3300003735 Ga0006780_1015204 Ga0006780_10152041 162
195 3300004801 Ga0058860_11921752 Ga0058860_119217522 162
196 3300005338 Ga0068868_100220094 Ga0068868_1002200942 162
197 3300005458 Ga0070681_11016435 Ga0070681_110164352 162
198 3300005614 Ga0068856_100056664 Ga0068856_1000566644 162
199 3300005841 Ga0068863_100386388 Ga0068863_1003863882 162
200 3300005842 Ga0068858_100845081 Ga0068858_1008450812 162
201 3300006038 Ga0075365_10010356 Ga0075365_100103566 162
202 3300006048 Ga0075363_100391171 Ga0075363_1003911712 162
203 3300006844 Ga0075428_100157647 Ga0075428_1001576472 162
204 3300006844 Ga0075428_100283548 Ga0075428_1002835483 162
205 3300006844 Ga0075428_100717944 Ga0075428_1007179441 162
206 3300006844 Ga0075428_100775730 Ga0075428_1007757303 162
207 3300006846 Ga0075430_100000071 Ga0075430_10000007138 162
208 3300006846 Ga0075430_100459628 Ga0075430_1004596283 162
209 3300006846 Ga0075430_100968320 Ga0075430_1009683201 162
210 3300006847 Ga0075431_100086773 Ga0075431_1000867733 162
211 3300006847 Ga0075431_100311856 Ga0075431_1003118563 162
212 3300006880 Ga0075429_100075959 Ga0075429_1000759593 162
213 3300006881 Ga0068865_100322853 Ga0068865_1003228532 162
214 3300007076 Ga0075435_100247976 Ga0075435_1002479762 162
215 3300009094 Ga0111539_10051000 Ga0111539_100510001 162
216 3300009147 Ga0114129_10009443 Ga0114129_1000944312 162
217 3300009147 Ga0114129_10064619 Ga0114129_100646195 162
218 3300009174 Ga0105241_12023300 Ga0105241_120233001 162
219 3300009176 Ga0105242_12552172 Ga0105242_125521721 162
220 3300011119 Ga0105246_11460630 Ga0105246_114606301 162
221 3300013296 Ga0157374_10133126 Ga0157374_101331264 162
222 3300020070 Ga0206356_10495149 Ga0206356_104951491 162
223 3300020070 Ga0206356_11438375 Ga0206356_114383751 162
224 3300020075 Ga0206349_1251754 Ga0206349_12517541 162
225 3300020077 Ga0206351_10385539 Ga0206351_103855391 162
226 3300020078 Ga0206352_10384936 Ga0206352_103849361 162
227 3300020080 Ga0206350_10768345 Ga0206350_107683452 162
228 3300020081 Ga0206354_10322786 Ga0206354_103227861 162
229 3300020082 Ga0206353_10460892 Ga0206353_104608921 162
230 3300020082 Ga0206353_10632836 Ga0206353_106328361 162
231 3300020610 Ga0154015_1313385 Ga0154015_13133852 162
232 3300020610 Ga0154015_1611676 Ga0154015_16116761 162
233 3300026041 Ga0207639_11617140 Ga0207639_116171401 162
234 3300026078 Ga0207702_10519413 Ga0207702_105194131 162
235 3300035114 Ga0373939_0332116 Ga0373939_0332116_94_600 162
236 3300035116 Ga0373945_0023312 Ga0373945_0023312_359_865 162
237 3300035170 Ga0373943_0141312 Ga0373943_0141312_327_833 162
238 3300035692 Ga0373935_0446030 Ga0373935_0446030_147_653 162
239 3300035695 Ga0373927_0018836 Ga0373927_0018836_2955_3461 162
240 3300035725 Ga0373947_0381045 Ga0373947_0381045_33_539 162
241 3300039437 Ga0436365_0682972 Ga0436365_0682972_5137_5646 162
242 3300046459 Ga0495629_0041844 Ga0495629_0041844_1715_2221 162
243 3300046461 Ga0495641_0066256 Ga0495641_0066256_403_909 162
244 3300046473 Ga0495582_0017850 Ga0495582_0017850_130_636 162
245 3300046475 Ga0495639_0059851 Ga0495639_0059851_1177_1683 162
246 3300046491 Ga0495584_0196281 Ga0495584_0196281_192_698 162
247 3300046492 Ga0495585_0341944 Ga0495585_0341944_173_679 162
248 3300046499 Ga0495594_0640784 Ga0495594_0640784_65_571 162
249 3300046518 Ga0495631_0103505 Ga0495631_0103505_177_683 162
250 3300046533 Ga0495640_0212713 Ga0495640_0212713_518_1024 162
251 3300046537 Ga0495598_0002824 Ga0495598_0002824_806_1420 162
252 3300046537 Ga0495598_0057202 Ga0495598_0057202_320_826 162
253 3300046615 Ga0495656_0095259 Ga0495656_0095259_390_896 162
254 3300046648 Ga0495611_0156014 Ga0495611_0156014_290_904 162
255 3300046665 Ga0495661_0131043 Ga0495661_0131043_807_1313 162
256 3300046683 Ga0495658_0127967 Ga0495658_0127967_704_1210 162
257 3300046689 Ga0495613_0098928 Ga0495613_0098928_66_572 162
258 3300046690 Ga0495624_0064848 Ga0495624_0064848_510_1016 162
259 3300046691 Ga0495670_0076032 Ga0495670_0076032_533_1039 162
260 3300046691 Ga0495670_0095881 Ga0495670_0095881_385_891 162
261 3300046794 Ga0495589_0036434 Ga0495589_0036434_1749_2255 162
262 3300046810 Ga0495660_0343919 Ga0495660_0343919_10_516 162
263 3300047321 Ga0495676_0100812 Ga0495676_0100812_1208_1714 162
264 3300048091 Ga0495626_0109121 Ga0495626_0109121_176_682 162
265 3300048903 Ga0496100_0089459 Ga0496100_0089459_998_1504 162
266 3300048903 Ga0496100_1011318 Ga0496100_1011318_118_624 162
267 3300048904 Ga0496101_0543574 Ga0496101_0543574_110_616 162
268 3300048905 Ga0496102_0388757 Ga0496102_0388757_150_656 162
269 3300048906 Ga0496103_0018692 Ga0496103_0018692_2749_3255 162
270 3300048909 Ga0496106_0002479 Ga0496106_0002479_2722_3228 162
271 3300048910 Ga0496107_0002030 Ga0496107_0002030_12144_12650 162
272 3300048911 Ga0496108_0026286 Ga0496108_0026286_532_1038 162
273 3300048912 Ga0496109_0010855 Ga0496109_0010855_3510_4016 162
274 3300048912 Ga0496109_0518945 Ga0496109_0518945_175_681 162
275 3300048914 Ga0496111_0020110 Ga0496111_0020110_134_640 162
276 3300048915 Ga0496112_0186473 Ga0496112_0186473_1225_1731 162
277 3300048916 Ga0496113_0097767 Ga0496113_0097767_443_949 162
278 3300048917 Ga0496114_0081906 Ga0496114_0081906_2185_2691 162
279 3300048917 Ga0496114_1041976 Ga0496114_1041976_17_523 162
280 3300049572 Ga0501036_0762794 Ga0501036_0762794_47_553 162
281 3300049588 Ga0501072_0092360 Ga0501072_0092360_1569_2075 162
282 3300049591 Ga0501075_0072870 Ga0501075_0072870_790_1296 162
283 3300049592 Ga0501076_0065933 Ga0501076_0065933_1170_1676 162
284 3300050493 nmdc:mga0k408_633567_c1 nmdc:mga0k408_633567_c1_80_586 162
285 3300050494 nmdc:mga06z11_144211_c1 nmdc:mga06z11_144211_c1_420_926 162
286 3300050507 nmdc:mga05p37_1326173_c1 nmdc:mga05p37_1326173_c1_81_587 162
287 3300050507 nmdc:mga05p37_472626_c1 nmdc:mga05p37_472626_c1_254_760 162
288 3300050507 nmdc:mga05p37_965_c1 nmdc:mga05p37_965_c1_30114_30620 162
289 3300050508 nmdc:mga09592_77317_c1 nmdc:mga09592_77317_c1_856_1362 162
290 3300050509 nmdc:mga0qj67_1190587_c1 nmdc:mga0qj67_1190587_c1_47_553 162
291 3300050509 nmdc:mga0qj67_153_c1 nmdc:mga0qj67_153_c1_27966_28472 162
292 3300050510 nmdc:mga06r32_590347_c1 nmdc:mga06r32_590347_c1_494_1000 162
293 3300050510 nmdc:mga06r32_648817_c1 nmdc:mga06r32_648817_c1_59_565 162
294 3300050511 nmdc:mga08y16_255043_c1 nmdc:mga08y16_255043_c1_633_1139 162
295 3300050512 nmdc:mga0n895_345469_c1 nmdc:mga0n895_345469_c1_963_1469 162
296 3300053083 Ga0495655_0010294 Ga0495655_0010294_861_1475 162
297 3300054114 Ga0501084_0797580 Ga0501084_0797580_43_549 162
298 3300059652 Ga0587107_051911 Ga0587107_051911_112_618 162
299 3300061734 Ga0530510_0010972 Ga0530510_0010972_2604_3110 162
300 3300003162 Ga0006778J45830_1030199 Ga0006778J45830_10301991 163
301 3300003308 Ga0006777J48905_1013333 Ga0006777J48905_10133331 163
302 3300003579 Ga0007429J51699_1028379 Ga0007429J51699_10283791 163
303 3300003735 Ga0006780_1007617 Ga0006780_10076171 163

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05974

DUF892

Domain of unknown function (DUF892)

46

203

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5l8g-assembly1.cif.gz_E crystal structure of rhodospirillum rubrum rru_a0973 mutant h65a 0.8655 4 70
6suw-assembly1.cif.gz_C crystal structure of rhodospirillum rubrum rru_a0973 e31a variant 0.8556 5 70
2gs4-assembly1.cif.gz_A the crystal structure of the e.coli stress protein ycif. 0.8393 9 157
4eru-assembly1.cif.gz_B crystal structure of putative cytoplasmic protein, ycif bacterial stress response protein from salmonella enterica 0.8379 6 154
2gyq-assembly1.cif.gz_B ycfi, a putative structural protein from rhodopseudomonas palustris. 0.8227 3 149
ID Description Score Start End Superfamily
2gyqA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8329 1 149 1.20.1260.10
5da5A00 Special;Helix non-globular;Helix Hairpins; 0.8268 1 70 6.10.140.1960
2gyqB00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8229 3 149 1.20.1260.10
5da5M00 Special;Helix non-globular;Helix Hairpins; 0.819 1 70 6.10.140.1960
5da5c00 Special;Helix non-globular;Helix Hairpins; 0.8129 1 70 6.10.140.1960
ID Description Score Start End GO Terms
AF-J3JE18-F1-model_v4 Uncharacterized protein 0.8717 6 153
AF-A0A4U9KPX6-F1-model_v4 deleted 0.8693 11 162
AF-A0A5E7YSV3-F1-model_v4 Uncharacterized protein 0.8673 3 157
AF-A0A2V8FN54-F1-model_v4 Ferritin-like domain-containing protein 0.8667 2 156
AF-A0A7Y5CYC9-F1-model_v4 Ferritin-like domain-containing protein 0.8661 6 161

Feature Viewer

pLDDT pTM Quality
88.97 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map