F397215

General Info

Members Datasets Scaffolds Average Seq Length
303 208 576 191

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0206911|Ga0495631_0206911_39_731
Length 230
Sequence MEVQCYWQRLSRRLSGTCQRLWFKRLIIKARKRTEDVFMSISLSKGQRIDLTKTNPGLTKVIVGLGWDTNKYAGSQDFDLDACAFLANKSSQVVNDEEFVFYNNLKSPNGAVEHTGDNRTGAGDGDDEQIAVDFSLLPDHVEKIGISVTIHDADARGQNFGQVSNAFVRLIDAETNEEVLRYDLGEDFSIETAVVVCELYKHGNDWKFNAIGSGFSGGLADLCRNYGLSV

Samples

Sample ID Description Type Environment
1 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
8 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
9 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
10 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
11 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
12 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
13 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
14 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
15 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
16 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
17 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
18 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
19 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
20 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
21 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
22 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
27 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
28 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
29 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
30 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
31 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
32 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
33 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
34 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
35 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
36 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
37 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
38 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
39 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
40 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
41 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
42 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
43 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
44 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
45 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
46 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
47 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
48 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
49 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
50 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
51 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
52 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
53 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
54 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
55 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
56 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
57 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
58 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
59 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
60 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
61 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
62 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
63 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
64 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
65 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
66 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
67 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
68 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
69 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
70 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
71 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
72 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
73 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
74 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
88 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
91 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
93 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
94 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
95 2554235283 Bacillus safensis VK Isolate Rhizosphere
96 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
97 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
98 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
99 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
100 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
101 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
102 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
103 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
104 2643221729 Bacillus sp. Root11 Isolate Unclassified
105 2643221730 Bacillus sp. Root131 Isolate Unclassified
106 2643221731 Bacillus sp. Root147 Isolate Unclassified
107 2643221732 Bacillus sp. Root239 Isolate Unclassified
108 2643221735 Bacillus sp. Root920 Isolate Unclassified
109 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
110 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
111 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
112 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
113 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
114 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
115 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
116 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
117 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
118 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
119 2738541295 Bacillus sp. OK085 Isolate Unclassified
120 2738541358 Bacillus sp. OV752 Isolate Unclassified
121 2738543006 Bacillus sp. OK077 Isolate Unclassified
122 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
123 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
124 2802429420 Priestia filamentosa HL2HP6 Isolate Unclassified
125 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
126 2811994870 Bacillus sp. JB4 Isolate Unclassified
127 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
128 2818991441 Niallia circulans 3243 Isolate Rhizosphere
129 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
130 2818991459 Paenibacillus sp. 597 Isolate Unclassified
131 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
132 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
133 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
134 2842882022 Bacillus sp. R-71893 Isolate Unclassified
135 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
136 2857586860 Bacillus sp. R-71935 Isolate Unclassified
137 2860837431 Bacillus sp. WR11 Isolate Unclassified
138 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
139 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
140 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
141 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
142 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
143 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
144 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
145 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
146 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
147 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
148 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
149 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
150 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
151 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
152 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
153 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
154 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
155 2919720352 Priestia megaterium 4340 Isolate Unclassified
156 2919726948 Bacillus pumilus 4489 Isolate Unclassified
157 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
158 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
159 2929004312 Priestia megaterium 1104 Isolate Unclassified
160 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
161 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
162 2938917290 Bacillus sp. CR71 Isolate Unclassified
163 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
164 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
165 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
166 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
167 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
168 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
169 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
170 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
171 2965761152 Bacillus sp. COPE52 Isolate Unclassified
172 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
173 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
174 2969141011 Bacillus velezensis MH25 Isolate Unclassified
175 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
176 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
177 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
178 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
179 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
180 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
181 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
182 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
183 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
184 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
185 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
186 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
187 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
188 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
189 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
190 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
191 8001522603 Methylomicrobium sp. RS1 Isolate Unclassified
192 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
193 8022653035 Bacillus sp. Rc4 Isolate Unclassified
194 8022792930 Bacillus sp. Xin Isolate Rhizosphere
195 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
196 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
197 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
198 8023438354 Bacillus sp. BH2 Isolate Unclassified
199 8023444577 Bacillus sp. BH32 Isolate Unclassified
200 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
201 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
202 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
203 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
204 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
205 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
206 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
207 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
208 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 47.19
Metatranscriptomes 9.24
Isolates 43.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 11.88
Nodule 0.33
Rhizoplane 6.6
Rhizosphere 50.17
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495631_0206911 3300046518 Bacteria 839
2 JGI25162J39368_1007420 3300002737 Bacteria 1714
3 JGI25151J46595_10000035 3300003187 Bacteria 191977
4 JGI25151J46595_10011862 3300003187 Bacteria 3990
5 JGI25151J46595_10029045 3300003187 Bacteria 2195
6 JGI25151J46595_10034132 3300003187 Bacteria 1949
7 JGI25151J46595_10034587 3300003187 Bacteria 1930
8 JGI25151J46595_10039074 3300003187 Bacteria 1757
9 rootH1_10081547 3300003316 Bacteria 2090
10 rootL2_10132212 3300003322 Bacteria 6711
11 Ga0006562J51391_1000566 3300003578 Bacteria 22900
12 Ga0006562J51391_1003402 3300003578 Bacteria 2023
13 Ga0006562J51391_1005104 3300003578 Bacteria 5420
14 Ga0006562J51391_1008515 3300003578 Bacteria 2465
15 Ga0055532_1000052 3300003758 Bacteria 164911
16 Ga0055532_1005441 3300003758 Bacteria 1790
17 Ga0055528_1027641 3300003790 Bacteria 1589
18 Ga0105251_10042167 3300009011 Bacteria 2217
19 Ga0105251_10069298 3300009011 Bacteria 1645
20 Ga0105244_10000191 3300009036 Bacteria 62565
21 Ga0105244_10000413 3300009036 Bacteria 39748
22 Ga0105244_10012495 3300009036 Bacteria 5013
23 Ga0105244_10053749 3300009036 Bacteria 2045
24 Ga0105244_10108018 3300009036 Bacteria 1356
25 Ga0105244_10169036 3300009036 Bacteria 1041
26 Ga0105250_10022970 3300009092 Bacteria 2513
27 Ga0105250_10055439 3300009092 Bacteria 1591
28 Ga0105250_10083065 3300009092 Bacteria 1299
29 Ga0105250_10158223 3300009092 Bacteria 945
30 Ga0105250_10249975 3300009092 Bacteria 757
31 Ga0105246_10000695 3300011119 Bacteria 18965
32 Ga0105246_10526408 3300011119 Bacteria 1009
33 Ga0157373_10003316 3300013100 Bacteria 12165
34 Ga0157371_10001285 3300013102 Bacteria 26461
35 Ga0157374_10429129 3300013296 Bacteria 1321
36 Ga0163161_10307545 3300017792 Bacteria 1250
37 Ga0209147_100028 3300025229 Bacteria 383994
38 Ga0209147_100293 3300025229 Bacteria 42268
39 Ga0209147_101531 3300025229 Bacteria 8037
40 Ga0209147_103188 3300025229 Bacteria 3359
41 Ga0209437_100353 3300025233 Bacteria 52467
42 Ga0209673_1006412 3300025273 Bacteria 5684
43 Ga0209130_1001863 3300025284 Bacteria 12088
44 Ga0209130_1007538 3300025284 Bacteria 3341
45 Ga0209130_1010629 3300025284 Bacteria 2520
46 Ga0209025_1000031 3300025294 Bacteria 422015
47 Ga0209025_1000677 3300025294 Bacteria 58481
48 Ga0209025_1003306 3300025294 Bacteria 15507
49 Ga0209025_1004708 3300025294 Bacteria 11649
50 Ga0209025_1005397 3300025294 Bacteria 10455
51 Ga0209025_1011506 3300025294 Bacteria 5815
52 Ga0209025_1036032 3300025294 Bacteria 2223
53 Ga0209025_1040484 3300025294 Bacteria 2014
54 Ga0209025_1043611 3300025294 Bacteria 1887
55 Ga0209025_1089199 3300025294 Bacteria 1014
56 Ga0209025_1099685 3300025294 Bacteria 923
57 Ga0207696_1001587 3300025711 Bacteria 12021
58 Ga0207655_1000161 3300025728 Bacteria 123202
59 Ga0207655_1003752 3300025728 Bacteria 11139
60 Ga0207655_1006683 3300025728 Bacteria 7601
61 Ga0207655_1023004 3300025728 Bacteria 3104
62 Ga0207655_1036037 3300025728 Bacteria 2200
63 Ga0207655_1068640 3300025728 Bacteria 1329
64 Ga0207713_1007328 3300025735 Bacteria 6535
65 Ga0207713_1040833 3300025735 Bacteria 1943
66 Ga0207713_1065427 3300025735 Bacteria 1365
67 Ga0207686_10269894 3300025934 Bacteria 1251
68 Ga0237817_10009 3300030083 Bacteria 78658
69 Ga0237817_10318 3300030083 Bacteria 9674
70 Ga0237817_11481 3300030083 Bacteria 1172
71 Ga0268256_1010886 3300030500 Bacteria 2920
72 Ga0265327_10002938 3300031251 Bacteria 17045
73 Ga0307408_100086154 3300031548 Bacteria 2361
74 Ga0307408_100242889 3300031548 Bacteria 1481
75 Ga0307409_100324302 3300031995 Bacteria 1443
76 Ga0307416_101583042 3300032002 Bacteria 761
77 Ga0395899_0460756 3300037312 Bacteria 831
78 Ga0395900_0012847 3300037418 Bacteria 8556
79 Ga0395898_0049837 3300037466 Bacteria 4102
80 Ga0395898_0692703 3300037466 Bacteria 961
81 Ga0395901_0157464 3300038443 Bacteria 2385
82 Ga0237819_00150 3300038705 Bacteria 25638
83 Ga0237819_00433 3300038705 Bacteria 14359
84 Ga0400483_027657 3300039062 Bacteria 25298
85 Ga0400483_276508 3300039062 Bacteria 24314
86 Ga0439438_000005 3300041405 Bacteria 408610
87 Ga0439447_025731 3300041407 Bacteria 1514
88 Ga0451795_0808777 3300041456 Bacteria 705
89 Ga0439432_006025 3300042006 Bacteria 4351
90 Ga0466967_0001634 3300045976 Bacteria 13230
91 Ga0495603_0202713 3300046455 Bacteria 1146
92 Ga0495650_0000001 3300046471 Bacteria 1085492
93 Ga0495584_0071869 3300046491 Bacteria 1739
94 Ga0495585_0236772 3300046492 Bacteria 915
95 Ga0495622_0073868 3300046557 Bacteria 1573
96 Ga0495661_0206998 3300046665 Bacteria 1024
97 Ga0495670_0000003 3300046691 Bacteria 326779
98 Ga0495589_0134142 3300046794 Bacteria 1188
99 Ga0495676_0472042 3300047321 Bacteria 826
100 Ga0495673_0000121 3300047469 Bacteria 144619
101 Ga0495626_0076422 3300048091 Bacteria 1495
102 Ga0496100_0599997 3300048903 Bacteria 855
103 Ga0496101_0013377 3300048904 Bacteria 5494
104 Ga0496101_0446629 3300048904 Bacteria 1020
105 Ga0496101_0477520 3300048904 Bacteria 984
106 Ga0496101_0987113 3300048904 Bacteria 662
107 Ga0496102_0006086 3300048905 Bacteria 10290
108 Ga0496102_0203889 3300048905 Bacteria 1864
109 Ga0496103_0003104 3300048906 Bacteria 10211
110 Ga0496103_0663002 3300048906 Bacteria 662
111 Ga0496105_0001055 3300048908 Bacteria 19127
112 Ga0496106_0010424 3300048909 Bacteria 6863
113 Ga0496107_0000225 3300048910 Bacteria 29943
114 Ga0496108_0003493 3300048911 Bacteria 12595
115 Ga0496109_0000702 3300048912 Bacteria 27873
116 Ga0496111_0003764 3300048914 Bacteria 9445
117 Ga0496112_0009630 3300048915 Bacteria 8715
118 Ga0496112_0163207 3300048915 Bacteria 2194
119 Ga0496113_0015731 3300048916 Bacteria 5209
120 Ga0496116_0001660 3300048919 Bacteria 24484
121 Ga0496116_0052930 3300048919 Bacteria 2685
122 Ga0496116_0076541 3300048919 Bacteria 2095
123 Ga0496117_0018029 3300048920 Bacteria 5872
124 Ga0496119_0008141 3300048922 Bacteria 9279
125 Ga0496119_0217023 3300048922 Bacteria 981
126 Ga0496121_0041511 3300048924 Bacteria 4019
127 Ga0496121_0165414 3300048924 Bacteria 1613
128 Ga0496122_0018111 3300048925 Bacteria 6525
129 Ga0496122_0403824 3300048925 Bacteria 693
130 Ga0496124_0004169 3300048927 Bacteria 17043
131 Ga0496124_0075421 3300048927 Bacteria 2786
132 Ga0496125_0055537 3300048928 Bacteria 3225
133 Ga0496126_0000570 3300048929 Bacteria 70614
134 Ga0501306_001100 3300049127 Bacteria 2418
135 Ga0501309_033346 3300049129 Bacteria 767
136 Ga0501305_007637 3300049161 Bacteria 1378
137 Ga0501305_067974 3300049161 Bacteria 623
138 Ga0501311_023411 3300049527 Bacteria 854
139 Ga0501312_001354 3300049528 Bacteria 2379
140 Ga0501312_001519 3300049528 Bacteria 2301
141 Ga0501312_048177 3300049528 Bacteria 713
142 Ga0501313_005490 3300049529 Bacteria 1342
143 Ga0501314_015639 3300049530 Bacteria 751
144 Ga0501316_002959 3300049532 Bacteria 1617
145 Ga0501318_004626 3300049534 Bacteria 1327
146 Ga0501330_012204 3300049546 Bacteria 627
147 Ga0501332_06320 3300049548 Bacteria 740
148 Ga0501336_001641 3300049552 Bacteria 1364
149 Ga0501338_10437 3300049554 Bacteria 626
150 nmdc:mga06z11_348477_c1 3300050494 Bacteria 886
151 Ga0587070_002513 3300059491 Bacteria 2087
152 Ga0587083_0028922 3300059505 Bacteria 1088
153 Ga0587067_000972 3300059640 Bacteria 2893
154 Ga0587067_008295 3300059640 Bacteria 1515
155 Ga0587067_045771 3300059640 Bacteria 867
156 Ga0587072_047350 3300059643 Bacteria 852
157 2511698171 2511231119 Bacteria 4019861
158 2545558894 2545555800 Bacteria 4222588
159 2550900702 2548877040 Bacteria 7507281
160 2555469336 2554235283 Bacteria 3683090
161 2571533329 2571042143 Bacteria 6986194
162 2578933346 2576861599 Bacteria 4217202
163 2580933696 2579778775 Bacteria 5360914
164 2587742254 2585428059 Bacteria 8696589
165 2587742255 2585428059 Bacteria 8696589
166 2601641094 2600255286 Bacteria 5390125
167 2621273536 2619619294 Bacteria 5575484
168 2631986168 2630968484 Bacteria 3876276
169 2644428231 2643221676 Bacteria 8119172
170 2644428232 2643221676 Bacteria 8119172
171 2644702970 2643221729 Bacteria 6621700
172 2644711405 2643221730 Bacteria 6523787
173 2644717588 2643221731 Bacteria 5623886
174 2644727072 2643221732 Bacteria 5756404
175 2644738171 2643221735 Bacteria 3676263
176 2651529699 2648501850 Bacteria 3975476
177 2674420965 2671180844 Bacteria 4164150
178 2686995509 2684623153 Bacteria 3878815
179 2687496756 2687453109 Bacteria 3860091
180 2695630083 2695420354 Bacteria 3922431
181 2698324793 2695420987 Bacteria 6152737
182 2705992310 2703719227 Bacteria 5631989
183 2717918012 2716884898 Bacteria 3928789
184 2721503745 2718218445 Bacteria 5113413
185 2728533096 2728368933 Bacteria 7044283
186 2738814165 2738541295 Bacteria 5730091
187 2739158844 2738541358 Bacteria 5932299
188 2739211444 2738543006 Bacteria 5904091
189 2753809198 2751185905 Bacteria 6142767
190 2777761826 2775507177 Bacteria 4384303
191 2805348122 2802429420 Bacteria 845479
192 2809055432 2808606399 Bacteria 4021018
193 2812314652 2811994870 Bacteria 3776934
194 2817478435 2816332295 Bacteria 4352468
195 2819569489 2818991441 Bacteria 5062707
196 2819584138 2818991443 Bacteria 6598732
197 2819674761 2818991459 Bacteria 8736032
198 2819674762 2818991459 Bacteria 8736032
199 2819706666 2818991465 Bacteria 5388835
200 2819725700 2818991468 Bacteria 3723169
201 2823526623 2823526263 Bacteria 3765752
202 2842882946 2842882022 Bacteria 6158489
203 2857454505 2857453340 Bacteria 8090534
204 2857458123 2857453340 Bacteria 8090534
205 2857459669 2857453340 Bacteria 8090534
206 2857588757 2857586860 Bacteria 4354574
207 2860837770 2860837431 Bacteria 4202080
208 2877768960 2877768649 Bacteria 3957164
209 2880169902 2880169592 Bacteria 3900066
210 2881641530 2881636855 Bacteria 5205297
211 2889043545 2889042446 Bacteria 7618936
212 2897109934 2897109615 Bacteria 4009619
213 2904116012 2904113452 Bacteria 7796941
214 2904495262 2904490793 Bacteria 7046938
215 2904526386 2904524088 Bacteria 5887454
216 2904562418 2904560550 Bacteria 4029838
217 2904759481 2904755435 Bacteria 7986759
218 2904759482 2904755435 Bacteria 7986759
219 2908668696 2908665501 Bacteria 3678115
220 2919096580 2919093281 Bacteria 3660974
221 2919145029 2919143609 Bacteria 6219228
222 2919163542 2919160200 Bacteria 6929020
223 2919414850 2919414237 Bacteria 5429133
224 2919428702 2919425241 Bacteria 8055701
225 2919428703 2919425241 Bacteria 8055701
226 2919520207 2919517244 Bacteria 5858162
227 2919721340 2919720352 Bacteria 5986006
228 2919729938 2919726948 Bacteria 3696050
229 2919729939 2919726948 Bacteria 3696050
230 2928094911 2928093941 Bacteria 5965005
231 2928512939 2928510474 Bacteria 4815308
232 2929008488 2929004312 Bacteria 5678476
233 2931387006 2931384279 Bacteria 7299545
234 2938653739 2938649242 Bacteria 7118381
235 2938917784 2938917290 Bacteria 5914775
236 2939682301 2939679117 Bacteria 6921672
237 2945994395 2945991243 Bacteria 7008369
238 2946057193 2946053406 Bacteria 6978655
239 2947427101 2947426588 Bacteria 5357194
240 2954775879 2954773129 Bacteria 3741715
241 2960320820 2960319331 Bacteria 5502575
242 2960376583 2960375949 Bacteria 5361395
243 2962291077 2962290636 Bacteria 4072939
244 2965761650 2965761152 Bacteria 5806513
245 2968562300 2968558590 Bacteria 6956864
246 2969137191 2969136845 Bacteria 3923176
247 2969141332 2969141011 Bacteria 4118468
248 2969770229 2969765954 Bacteria 4216713
249 2969773915 2969770375 Bacteria 4271280
250 2971409914 2971403814 Bacteria 7370929
251 2971412787 2971410472 Bacteria 8311090
252 2971415897 2971410472 Bacteria 8311090
253 2971893703 2971893375 Bacteria 3929648
254 2979084095 2979083700 Bacteria 5894929
255 2980492937 2980492589 Bacteria 4072961
256 2984531445 2984527788 Bacteria 5288478
257 2984532700 2984532647 Bacteria 5288506
258 2988230692 2988225383 Bacteria 7221625
259 2996637086 2996632988 Bacteria 6921523
260 3001898111 3001892409 Bacteria 6328293
261 3006858759 3006858327 Bacteria 4317835
262 3006881854 3006879489 Bacteria 4064221
263 3006974973 3006973921 Bacteria 4423788
264 3006979629 3006978542 Bacteria 5328100
265 3006979630 3006978542 Bacteria 5328100
266 8001523749 8001522603 Bacteria 4726425
267 8022634419 8022630665 Bacteria 3886130
268 8022655296 8022653035 Bacteria 4035078
269 8022795889 8022792930 Bacteria 5693794
270 8022894985 8022893055 Bacteria 5300455
271 8022919619 8022914991 Bacteria 5584517
272 8022953810 8022948649 Bacteria 5366783
273 8023438430 8023438354 Bacteria 5779374
274 8023450241 8023444577 Bacteria 5661597
275 8051956026 8051952484 Bacteria 3926774
276 8052177630 8052174270 Bacteria 3881265
277 8054283793 8054280661 Bacteria 4232245
278 8054465671 8054465665 Bacteria 7323556
279 8054465672 8054465665 Bacteria 7323556
280 8054796726 8054795415 Bacteria 9785225
281 8056534902 8056533031 Bacteria 8964429
282 8056537206 8056533031 Bacteria 8964429
283 8056540449 8056533031 Bacteria 8964429
284 8057583159 8057582654 Bacteria 5218944
285 8057583160 8057582654 Bacteria 5218944
286 8057634689 8057632132 Bacteria 4726859
287 8057978318 8057977335 Bacteria 5694872
288 8057978320 8057977335 Bacteria 5694872
289 Ga0495631_0206911
290 JGI25162J39368_1007420
291 JGI25151J46595_10000035
292 JGI25151J46595_10011862
293 JGI25151J46595_10029045
294 JGI25151J46595_10034132
295 JGI25151J46595_10034587
296 JGI25151J46595_10039074
297 rootH1_10081547
298 rootL2_10132212
299 Ga0006562J51391_1000566
300 Ga0006562J51391_1003402
301 Ga0006562J51391_1005104
302 Ga0006562J51391_1008515
303 Ga0055532_1000052
304 Ga0055532_1005441
305 Ga0055528_1027641
306 Ga0105251_10042167
307 Ga0105251_10069298
308 Ga0105244_10000191
309 Ga0105244_10000413
310 Ga0105244_10012495
311 Ga0105244_10053749
312 Ga0105244_10108018
313 Ga0105244_10169036
314 Ga0105250_10022970
315 Ga0105250_10055439
316 Ga0105250_10083065
317 Ga0105250_10158223
318 Ga0105250_10249975
319 Ga0105246_10000695
320 Ga0105246_10526408
321 Ga0157373_10003316
322 Ga0157371_10001285
323 Ga0157374_10429129
324 Ga0163161_10307545
325 Ga0209147_100028
326 Ga0209147_100293
327 Ga0209147_101531
328 Ga0209147_103188
329 Ga0209437_100353
330 Ga0209673_1006412
331 Ga0209130_1001863
332 Ga0209130_1007538
333 Ga0209130_1010629
334 Ga0209025_1000031
335 Ga0209025_1000677
336 Ga0209025_1003306
337 Ga0209025_1004708
338 Ga0209025_1005397
339 Ga0209025_1011506
340 Ga0209025_1036032
341 Ga0209025_1040484
342 Ga0209025_1043611
343 Ga0209025_1089199
344 Ga0209025_1099685
345 Ga0207696_1001587
346 Ga0207655_1000161
347 Ga0207655_1003752
348 Ga0207655_1006683
349 Ga0207655_1023004
350 Ga0207655_1036037
351 Ga0207655_1068640
352 Ga0207713_1007328
353 Ga0207713_1040833
354 Ga0207713_1065427
355 Ga0207686_10269894
356 Ga0237817_10009
357 Ga0237817_10318
358 Ga0237817_11481
359 Ga0268256_1010886
360 Ga0265327_10002938
361 Ga0307408_100086154
362 Ga0307408_100242889
363 Ga0307409_100324302
364 Ga0307416_101583042
365 Ga0395899_0460756
366 Ga0395900_0012847
367 Ga0395898_0049837
368 Ga0395898_0692703
369 Ga0395901_0157464
370 Ga0237819_00150
371 Ga0237819_00433
372 Ga0400483_027657
373 Ga0400483_276508
374 Ga0439438_000005
375 Ga0439447_025731
376 Ga0451795_0808777
377 Ga0439432_006025
378 Ga0466967_0001634
379 Ga0495603_0202713
380 Ga0495650_0000001
381 Ga0495584_0071869
382 Ga0495585_0236772
383 Ga0495622_0073868
384 Ga0495661_0206998
385 Ga0495670_0000003
386 Ga0495589_0134142
387 Ga0495676_0472042
388 Ga0495673_0000121
389 Ga0495626_0076422
390 Ga0496100_0599997
391 Ga0496101_0013377
392 Ga0496101_0446629
393 Ga0496101_0477520
394 Ga0496101_0987113
395 Ga0496102_0006086
396 Ga0496102_0203889
397 Ga0496103_0003104
398 Ga0496103_0663002
399 Ga0496105_0001055
400 Ga0496106_0010424
401 Ga0496107_0000225
402 Ga0496108_0003493
403 Ga0496109_0000702
404 Ga0496111_0003764
405 Ga0496112_0009630
406 Ga0496112_0163207
407 Ga0496113_0015731
408 Ga0496116_0001660
409 Ga0496116_0052930
410 Ga0496116_0076541
411 Ga0496117_0018029
412 Ga0496119_0008141
413 Ga0496119_0217023
414 Ga0496121_0041511
415 Ga0496121_0165414
416 Ga0496122_0018111
417 Ga0496122_0403824
418 Ga0496124_0004169
419 Ga0496124_0075421
420 Ga0496125_0055537
421 Ga0496126_0000570
422 Ga0501306_001100
423 Ga0501309_033346
424 Ga0501305_007637
425 Ga0501305_067974
426 Ga0501311_023411
427 Ga0501312_001354
428 Ga0501312_001519
429 Ga0501312_048177
430 Ga0501313_005490
431 Ga0501314_015639
432 Ga0501316_002959
433 Ga0501318_004626
434 Ga0501330_012204
435 Ga0501332_06320
436 Ga0501336_001641
437 Ga0501338_10437
438 nmdc:mga06z11_348477_c1
439 Ga0587070_002513
440 Ga0587083_0028922
441 Ga0587067_000972
442 Ga0587067_008295
443 Ga0587067_045771
444 Ga0587072_047350
445 2511698171
446 2545558894
447 2550900702
448 2555469336
449 2571533329
450 2578933346
451 2580933696
452 2587742254
453 2587742255
454 2601641094
455 2621273536
456 2631986168
457 2644428231
458 2644428232
459 2644702970
460 2644711405
461 2644717588
462 2644727072
463 2644738171
464 2651529699
465 2674420965
466 2686995509
467 2687496756
468 2695630083
469 2698324793
470 2705992310
471 2717918012
472 2721503745
473 2728533096
474 2738814165
475 2739158844
476 2739211444
477 2753809198
478 2777761826
479 2805348122
480 2809055432
481 2812314652
482 2817478435
483 2819569489
484 2819584138
485 2819674761
486 2819674762
487 2819706666
488 2819725700
489 2823526623
490 2842882946
491 2857454505
492 2857458123
493 2857459669
494 2857588757
495 2860837770
496 2877768960
497 2880169902
498 2881641530
499 2889043545
500 2897109934
501 2904116012
502 2904495262
503 2904526386
504 2904562418
505 2904759481
506 2904759482
507 2908668696
508 2919096580
509 2919145029
510 2919163542
511 2919414850
512 2919428702
513 2919428703
514 2919520207
515 2919721340
516 2919729938
517 2919729939
518 2928094911
519 2928512939
520 2929008488
521 2931387006
522 2938653739
523 2938917784
524 2939682301
525 2945994395
526 2946057193
527 2947427101
528 2954775879
529 2960320820
530 2960376583
531 2962291077
532 2965761650
533 2968562300
534 2969137191
535 2969141332
536 2969770229
537 2969773915
538 2971409914
539 2971412787
540 2971415897
541 2971893703
542 2979084095
543 2980492937
544 2984531445
545 2984532700
546 2988230692
547 2996637086
548 3001898111
549 3006858759
550 3006881854
551 3006974973
552 3006979629
553 3006979630
554 8001523749
555 8022634419
556 8022655296
557 8022795889
558 8022894985
559 8022919619
560 8022953810
561 8023438430
562 8023450241
563 8051956026
564 8052177630
565 8054283793
566 8054465671
567 8054465672
568 8054796726
569 8056534902
570 8056537206
571 8056540449
572 8057583159
573 8057583160
574 8057634689
575 8057978318
576 8057978320

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02342

TerD

TerD domain

39

226

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.8665 17 181
2kxv-assembly1.cif.gz_A nmr structure and calcium-binding properties of the tellurite resistance protein terd from klebsiella pneumoniae 0.8178 19 182
3ibz-assembly1.cif.gz_A crystal structure of putative tellurium resistant like protein (terd) from streptomyces coelicolor a3(2) 0.8082 17 181
2qng-assembly1.cif.gz_A crystal structure of unknown function protein sav2460 0.8008 19 174
2qz7-assembly2.cif.gz_B the crystal structure of a homologue of telluride resistance protein (terd), sco6318 from streptomyces coelicolor a3(2) 0.7805 19 174
ID Description Score Start End Superfamily
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.9236 20 174 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8592 19 175 2.60.60.30
af_P19198_159_328_2.60.60.30 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8406 20 174 2.60.60.30
3ibzA01 Mainly Beta;Sandwich;Lipoxygenase-1;sav2460 like domains 0.8076 19 175 2.60.60.30
5jhzA04 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 2;Peroxidase, domain 2 0.774 118 134 1.10.420.10
ID Description Score Start End GO Terms
AF-A0A4Y8PWN5-F1-model_v4 Chemical-damaging agent resistance protein C 0.9832 1 182
AF-C8W642-F1-model_v4 Stress protein 0.9823 2 182
AF-A0A2T0AZH0-F1-model_v4 General stress protein 16U 0.98 1 181
AF-U5MM47-F1-model_v4 General stress protein 16U 0.9797 1 182
AF-M4KN35-F1-model_v4 deleted 0.9791 1 181

Map