F397208

General Info

Members Datasets Scaffolds Average Seq Length
303 202 606 293

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0073518|Ga0495585_0073518_801_1790
Length 329
Sequence LNSGGPPPDIPSFPGPEITPETQSPIMKRIALLIATNLAVVLLLSVVIQIFGLDNYLAQRGLNYGSLLIFSVVFGFGGAFFSLAISKWMAKKAMGVRLITQPASESERWLVATVRSHAEKAGVAMPEVGVFDSPEPNAFATGARKNASLVAVSTGLLRSMSRDQVEAVLGHEIAHVANGDMVTLTLIQGVLNTFVFFLARVIGNIVDGFLRGNSSDERRGPGLGYFVIVMVSEIALGLIASIIVAWFSRRREFRADAGGAYLAGAGAMIGALQALKAAHSPSRMPAQLQAFGINGGLAQGLRKLYMSHPPLDERIAALEQRTDALGRAS

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
114 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
116 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
120 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
123 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
124 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
125 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
127 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
140 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
162 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
163 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
164 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
165 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
166 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
186 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
187 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
188 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
189 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
190 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
191 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
192 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
193 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
194 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
195 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
198 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
199 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.99
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.93
Nodule 0
Rhizoplane 3.3
Rhizosphere 80.2
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0073518 3300046492 Bacteria 1861
2 rootL2_10107344 3300003322 Bacteria 7322
3 rootH1_10018404 3300003323 Bacteria 2816
4 rootH1_10059172 3300003323 Bacteria 1373
5 Ga0070670_100427525 3300005331 Bacteria 1171
6 Ga0068869_100168781 3300005334 Bacteria 1708
7 Ga0070666_10011749 3300005335 Bacteria 5506
8 Ga0070666_10043102 3300005335 Bacteria 3021
9 Ga0070682_100054742 3300005337 Bacteria 2504
10 Ga0068868_100339321 3300005338 Bacteria 1284
11 Ga0070689_100005984 3300005340 Bacteria 8372
12 Ga0070661_100076079 3300005344 Bacteria 2474
13 Ga0070669_100007667 3300005353 Bacteria 7715
14 Ga0070675_100013729 3300005354 Bacteria 6375
15 Ga0070675_100082310 3300005354 Bacteria 2685
16 Ga0070671_100000196 3300005355 Bacteria 40503
17 Ga0070674_100022426 3300005356 Bacteria 4072
18 Ga0070674_100049485 3300005356 Bacteria 2889
19 Ga0070674_100274488 3300005356 Bacteria 1334
20 Ga0070673_100012852 3300005364 Bacteria 5764
21 Ga0070673_100068722 3300005364 Bacteria 2837
22 Ga0070688_100023902 3300005365 Bacteria 3600
23 Ga0070688_100107711 3300005365 Bacteria 1848
24 Ga0070667_100000043 3300005367 Bacteria 167034
25 Ga0070667_100012560 3300005367 Bacteria 7004
26 Ga0070714_100296988 3300005435 Bacteria 1505
27 Ga0070701_10020237 3300005438 Bacteria 3157
28 Ga0070711_100018981 3300005439 Bacteria 4401
29 Ga0070705_100013817 3300005440 Bacteria 4137
30 Ga0070663_100258083 3300005455 Bacteria 1382
31 Ga0070678_100010470 3300005456 Bacteria 5669
32 Ga0070678_100019134 3300005456 Bacteria 4455
33 Ga0070662_100147268 3300005457 Bacteria 1830
34 Ga0070662_100382397 3300005457 Bacteria 1159
35 Ga0068867_100068946 3300005459 Bacteria 2640
36 Ga0070685_10042500 3300005466 Bacteria 2594
37 Ga0070679_100091164 3300005530 Bacteria 3036
38 Ga0070672_100027654 3300005543 Bacteria 4233
39 Ga0070672_100123446 3300005543 Bacteria 2122
40 Ga0070686_100010613 3300005544 Bacteria 5202
41 Ga0070696_100002354 3300005546 Bacteria 12484
42 Ga0070696_100036928 3300005546 Bacteria 3371
43 Ga0070665_100008970 3300005548 Bacteria 10133
44 Ga0070665_100015592 3300005548 Bacteria 7635
45 Ga0068855_100005663 3300005563 Bacteria 15250
46 Ga0068855_100474190 3300005563 Bacteria 1363
47 Ga0068857_100248328 3300005577 Bacteria 1631
48 Ga0068857_100588199 3300005577 Bacteria 1051
49 Ga0070702_100155797 3300005615 Bacteria 1471
50 Ga0068859_100002402 3300005617 Bacteria 19068
51 Ga0068859_100016030 3300005617 Bacteria 7531
52 Ga0068859_100021927 3300005617 Bacteria 6404
53 Ga0068859_100247641 3300005617 Bacteria 1872
54 Ga0068861_100019794 3300005719 Bacteria 4810
55 Ga0068861_100332679 3300005719 Bacteria 1326
56 Ga0068870_10001753 3300005840 Bacteria 8895
57 Ga0068870_10061344 3300005840 Bacteria 2021
58 Ga0068863_100000954 3300005841 Bacteria 28992
59 Ga0068863_100058879 3300005841 Bacteria 3635
60 Ga0068863_100208299 3300005841 Bacteria 1882
61 Ga0068858_100000113 3300005842 Bacteria 84912
62 Ga0068858_100508122 3300005842 Bacteria 1165
63 Ga0068860_100000405 3300005843 Bacteria 56140
64 Ga0068860_100018791 3300005843 Bacteria 6714
65 Ga0068860_100099618 3300005843 Bacteria 2771
66 Ga0068862_100006240 3300005844 Bacteria 9925
67 Ga0068862_100006555 3300005844 Bacteria 9657
68 Ga0068862_100049967 3300005844 Bacteria 3573
69 Ga0068862_100137981 3300005844 Bacteria 2163
70 Ga0068862_100161032 3300005844 Bacteria 2003
71 Ga0081539_10000016 3300005985 Bacteria 381648
72 Ga0070715_10076800 3300006163 Bacteria 1506
73 Ga0075428_100265662 3300006844 Bacteria 1847
74 Ga0068865_100036236 3300006881 Bacteria 3324
75 Ga0068865_100105654 3300006881 Bacteria 2069
76 Ga0068865_100165331 3300006881 Bacteria 1691
77 Ga0097620_100002402 3300006931 Bacteria 19068
78 Ga0097620_100016031 3300006931 Bacteria 7531
79 Ga0097620_100021927 3300006931 Bacteria 6404
80 Ga0097620_100247616 3300006931 Bacteria 1872
81 Ga0099794_10024013 3300007265 Bacteria 2794
82 Ga0105240_10011462 3300009093 Bacteria 12346
83 Ga0105240_10027493 3300009093 Bacteria 7446
84 Ga0105240_10038293 3300009093 Bacteria 6151
85 Ga0105240_10301611 3300009093 Bacteria 1832
86 Ga0111539_10070853 3300009094 Bacteria 4114
87 Ga0105247_10000445 3300009101 Bacteria 34975
88 Ga0105243_10054649 3300009148 Bacteria 3171
89 Ga0105241_10362193 3300009174 Bacteria 1262
90 Ga0105242_10167311 3300009176 Bacteria 1930
91 Ga0105248_10039397 3300009177 Bacteria 5292
92 Ga0105248_10222367 3300009177 Bacteria 2126
93 Ga0105237_10295117 3300009545 Bacteria 1624
94 Ga0105238_10105007 3300009551 Bacteria 2806
95 Ga0105249_10026169 3300009553 Bacteria 5254
96 Ga0105249_10329781 3300009553 Bacteria 1539
97 Ga0099796_10006357 3300010159 Bacteria 3017
98 Ga0105246_10038973 3300011119 Bacteria 3198
99 Ga0157369_10005257 3300013105 Bacteria 15095
100 Ga0157374_10534790 3300013296 Bacteria 1179
101 Ga0157378_10140916 3300013297 Bacteria 2239
102 Ga0163162_10013996 3300013306 Bacteria 7842
103 Ga0163162_10200158 3300013306 Bacteria 2126
104 Ga0157375_10019149 3300013308 Bacteria 6217
105 Ga0157375_10036357 3300013308 Bacteria 4711
106 Ga0157375_10091487 3300013308 Bacteria 3104
107 Ga0163163_10065960 3300014325 Bacteria 3595
108 Ga0163163_10540871 3300014325 Bacteria 1227
109 Ga0157380_10008541 3300014326 Bacteria 7321
110 Ga0157380_10013813 3300014326 Bacteria 5897
111 Ga0157377_10078837 3300014745 Bacteria 1920
112 Ga0157379_10025786 3300014968 Bacteria 5225
113 Ga0157379_10213934 3300014968 Bacteria 1745
114 Ga0157376_10082320 3300014969 Bacteria 2765
115 Ga0157376_10160441 3300014969 Bacteria 2038
116 Ga0207710_10000334 3300025900 Bacteria 35251
117 Ga0207685_10060868 3300025905 Bacteria 1495
118 Ga0207645_10028004 3300025907 Bacteria 3637
119 Ga0207645_10269110 3300025907 Bacteria 1130
120 Ga0207643_10017123 3300025908 Bacteria 3958
121 Ga0207643_10113856 3300025908 Bacteria 1596
122 Ga0207707_10079238 3300025912 Bacteria 2868
123 Ga0207695_10028815 3300025913 Bacteria 6147
124 Ga0207695_10076927 3300025913 Bacteria 3391
125 Ga0207663_10010981 3300025916 Bacteria 4841
126 Ga0207660_10009799 3300025917 Bacteria 6203
127 Ga0207662_10052962 3300025918 Bacteria 2416
128 Ga0207662_10165654 3300025918 Bacteria 1415
129 Ga0207681_10126589 3300025923 Bacteria 1882
130 Ga0207694_10087820 3300025924 Bacteria 2450
131 Ga0207650_10448750 3300025925 Bacteria 1073
132 Ga0207659_10019518 3300025926 Bacteria 4464
133 Ga0207659_10024824 3300025926 Bacteria 4022
134 Ga0207644_10001248 3300025931 Bacteria 16369
135 Ga0207706_10159293 3300025933 Bacteria 1985
136 Ga0207709_10063007 3300025935 Bacteria 2323
137 Ga0207670_10196363 3300025936 Bacteria 1530
138 Ga0207669_10043809 3300025937 Bacteria 2623
139 Ga0207704_10251194 3300025938 Bacteria 1328
140 Ga0207704_10307097 3300025938 Bacteria 1218
141 Ga0207691_10003322 3300025940 Bacteria 15662
142 Ga0207691_10041238 3300025940 Bacteria 4263
143 Ga0207691_10044346 3300025940 Bacteria 4095
144 Ga0207711_10106398 3300025941 Bacteria 2489
145 Ga0207711_10181380 3300025941 Bacteria 1915
146 Ga0207689_10198994 3300025942 Bacteria 1654
147 Ga0207689_10207788 3300025942 Bacteria 1617
148 Ga0207667_10019954 3300025949 Bacteria 7468
149 Ga0207667_10526873 3300025949 Bacteria 1197
150 Ga0207651_10014439 3300025960 Bacteria 4561
151 Ga0207651_10045352 3300025960 Bacteria 2948
152 Ga0207712_10019409 3300025961 Bacteria 4438
153 Ga0207712_10085322 3300025961 Bacteria 2310
154 Ga0207712_10151556 3300025961 Bacteria 1791
155 Ga0207658_10000330 3300025986 Bacteria 47583
156 Ga0207658_10038542 3300025986 Bacteria 3444
157 Ga0207677_10578989 3300026023 Bacteria 982
158 Ga0207703_10006995 3300026035 Bacteria 8976
159 Ga0207703_10303410 3300026035 Bacteria 1457
160 Ga0207678_10011754 3300026067 Bacteria 7684
161 Ga0207708_10297729 3300026075 Bacteria 1311
162 Ga0207702_10361078 3300026078 Bacteria 1392
163 Ga0207641_10000201 3300026088 Bacteria 80061
164 Ga0207641_10024142 3300026088 Bacteria 5011
165 Ga0207641_10134248 3300026088 Bacteria 2226
166 Ga0207648_10055063 3300026089 Bacteria 3473
167 Ga0207648_10071274 3300026089 Bacteria 3028
168 Ga0207648_10136588 3300026089 Bacteria 2160
169 Ga0207674_10081511 3300026116 Bacteria 3238
170 Ga0207674_10275472 3300026116 Bacteria 1630
171 Ga0207675_100002896 3300026118 Bacteria 16874
172 Ga0207675_100049554 3300026118 Bacteria 3919
173 Ga0207683_10005552 3300026121 Bacteria 10803
174 Ga0207683_10032619 3300026121 Bacteria 4525
175 Ga0209588_1043640 3300027671 Bacteria 1449
176 Ga0207428_10096821 3300027907 Bacteria 2285
177 Ga0268266_10007418 3300028379 Bacteria 9899
178 Ga0268266_10009671 3300028379 Bacteria 8476
179 Ga0268266_10069449 3300028379 Bacteria 3052
180 Ga0268265_10013271 3300028380 Bacteria 5598
181 Ga0268265_10022369 3300028380 Bacteria 4441
182 Ga0268265_10157895 3300028380 Bacteria 1922
183 Ga0268265_10248156 3300028380 Bacteria 1575
184 Ga0268265_10356442 3300028380 Bacteria 1337
185 Ga0268264_10000183 3300028381 Bacteria 133803
186 Ga0268264_10026006 3300028381 Bacteria 4779
187 Ga0268264_10041573 3300028381 Bacteria 3803
188 Ga0307515_10004982 3300028794 Bacteria 27096
189 Ga0265338_10226990 3300028800 Unclassified 1391
190 Ga0307511_10004923 3300030521 Bacteria 13625
191 Ga0265770_1000122 3300030878 Bacteria 9339
192 Ga0307509_10000025 3300031507 Bacteria 235550
193 Ga0307508_10248484 3300031616 Bacteria 1375
194 Ga0316575_10115589 3300031665 Bacteria 1096
195 Ga0316579_10003743 3300031691 Bacteria 5987
196 Ga0316579_10010046 3300031691 Bacteria 3992
197 Ga0316576_10086410 3300031727 Bacteria 2332
198 Ga0316578_10000631 3300031728 Bacteria 12445
199 Ga0307516_10000373 3300031730 Bacteria 58684
200 Ga0316577_10044742 3300031733 Bacteria 2476
201 Ga0316583_10002488 3300032133 Bacteria 6405
202 Ga0316580_10034906 3300032139 Bacteria 1556
203 Ga0316593_10015631 3300032168 Bacteria 2287
204 Ga0316593_10098263 3300032168 Bacteria 1036
205 Ga0307510_10000002 3300033180 Bacteria 801565
206 Ga0373936_0054838 3300035113 Bacteria 1617
207 Ga0316574_0014329 3300035398 Bacteria 4580
208 Ga0373937_0169348 3300036401 Bacteria 2049
209 Ga0373937_0608335 3300036401 Bacteria 1037
210 Ga0316582_0005451 3300036647 Bacteria 6556
211 Ga0316582_0153024 3300036647 Bacteria 1560
212 Ga0373925_0173366 3300037068 Bacteria 1704
213 Ga0373925_0214351 3300037068 Bacteria 1535
214 Ga0395898_0030103 3300037466 Bacteria 5434
215 Ga0395901_0298132 3300038443 Bacteria 1672
216 Ga0400487_61333 3300039110 Bacteria 1426
217 Ga0436365_1434390 3300039437 Bacteria 1301
218 Ga0451853_1332215 3300041512 Bacteria 1094
219 Ga0451577_0138333 3300042876 Bacteria 2187
220 Ga0466966_0075374 3300044684 Bacteria 2108
221 Ga0495590_0003527 3300046457 Bacteria 6377
222 Ga0495607_0000011 3300046501 Bacteria 201960
223 Ga0495583_0088516 3300046506 Bacteria 1336
224 Ga0495606_0136404 3300046507 Bacteria 1453
225 Ga0495616_0000669 3300046513 Bacteria 25410
226 Ga0495632_0059824 3300046519 Bacteria 1853
227 Ga0495656_0146255 3300046615 Bacteria 1138
228 Ga0495668_0023088 3300046616 Bacteria 3551
229 Ga0495625_0100536 3300046660 Bacteria 1988
230 Ga0495625_0108015 3300046660 Bacteria 1904
231 Ga0495670_0095415 3300046691 Bacteria 1526
232 Ga0495649_0151127 3300046694 Bacteria 1220
233 Ga0495600_0173507 3300046809 Bacteria 1391
234 Ga0495680_0082559 3300047322 Bacteria 2425
235 Ga0495686_0018617 3300047472 Bacteria 4656
236 Ga0496100_0264550 3300048903 Bacteria 1276
237 Ga0496102_0020845 3300048905 Bacteria 5794
238 Ga0496102_0317055 3300048905 Bacteria 1469
239 Ga0496103_0049328 3300048906 Bacteria 2603
240 Ga0496103_0055715 3300048906 Bacteria 2452
241 Ga0496104_0006090 3300048907 Bacteria 10584
242 Ga0496105_0012046 3300048908 Bacteria 6845
243 Ga0496106_0503147 3300048909 Bacteria 973
244 Ga0496114_0054076 3300048917 Bacteria 3347
245 Ga0496115_0105983 3300048918 Bacteria 2307
246 Ga0496116_0023428 3300048919 Bacteria 4598
247 Ga0496117_0000054 3300048920 Bacteria 278013
248 Ga0496118_0000045 3300048921 Bacteria 275165
249 Ga0496118_0052550 3300048921 Bacteria 3106
250 Ga0496119_0003904 3300048922 Bacteria 15164
251 Ga0496119_0016511 3300048922 Bacteria 5613
252 Ga0496119_0036206 3300048922 Bacteria 3224
253 Ga0496120_0000759 3300048923 Bacteria 46738
254 Ga0496121_0009623 3300048924 Bacteria 11069
255 Ga0496121_0035761 3300048924 Bacteria 4442
256 Ga0496121_0067004 3300048924 Bacteria 2911
257 Ga0496125_0012911 3300048928 Bacteria 8246
258 Ga0496125_0057609 3300048928 Bacteria 3145
259 Ga0496126_0068973 3300048929 Bacteria 3155
260 Ga0496126_0149922 3300048929 Bacteria 1999
261 Ga0496126_0202369 3300048929 Bacteria 1676
262 Ga0501039_0040359 3300049575 Bacteria 3603
263 Ga0501041_0041796 3300049577 Bacteria 2785
264 Ga0501042_0210373 3300049578 Bacteria 1403
265 Ga0501068_0000141 3300049584 Bacteria 33019
266 Ga0501070_0088373 3300049586 Bacteria 2565
267 Ga0501072_0488290 3300049588 Bacteria 974
268 Ga0501073_0001035 3300049589 Bacteria 20094
269 Ga0501074_0000994 3300049590 Bacteria 18432
270 Ga0501076_0075763 3300049592 Bacteria 2697
271 Ga0501077_0001084 3300049593 Bacteria 16415
272 Ga0501079_0000033 3300049741 Bacteria 59060
273 Ga0501079_0369300 3300049741 Bacteria 1125
274 Ga0501080_0005880 3300049742 Bacteria 10987
275 Ga0501083_0076748 3300049744 Bacteria 2217
276 nmdc:mga08y16_128675_c1 3300050511 Bacteria 2634
277 Ga0495601_0093781 3300053077 Bacteria 1934
278 Ga0495619_0368129 3300053085 Bacteria 994
279 Ga0500646_0037315 3300053090 Bacteria 1357
280 Ga0500647_0102327 3300053091 Bacteria 1367
281 Ga0500583_0014763 3300053092 Bacteria 3069
282 Ga0500583_0042892 3300053092 Bacteria 2063
283 Ga0500583_0166714 3300053092 Bacteria 1097
284 Ga0500651_0173982 3300053093 Bacteria 1282
285 Ga0500641_0015504 3300053096 Bacteria 2831
286 Ga0500641_0017525 3300053096 Bacteria 2680
287 Ga0500556_0024401 3300053104 Bacteria 1986
288 Ga0500591_102299 3300053115 Bacteria 1222
289 Ga0500614_030709 3300053123 Bacteria 1312
290 Ga0500642_0009361 3300053130 Bacteria 3396
291 Ga0500568_0002054 3300053139 Bacteria 12198
292 Ga0500588_0006816 3300053146 Bacteria 2610
293 Ga0500588_0077199 3300053146 Bacteria 1106
294 Ga0500616_0000018 3300053153 Bacteria 610976
295 Ga0500616_0028693 3300053153 Bacteria 3066
296 Ga0500616_0053773 3300053153 Bacteria 2111
297 Ga0500627_0053559 3300053158 Bacteria 1764
298 Ga0500630_101104 3300053159 Bacteria 1313
299 Ga0500611_008246 3300053727 Bacteria 1603
300 Ga0501084_0003544 3300054114 Bacteria 12673
301 Ga0501084_0606445 3300054114 Bacteria 925
302 Ga0501082_0027728 3300060353 Bacteria 4876
303 2857580530 2857576091 Bacteria 5465855
304 Ga0495585_0073518
305 rootL2_10107344
306 rootH1_10018404
307 rootH1_10059172
308 Ga0070670_100427525
309 Ga0068869_100168781
310 Ga0070666_10011749
311 Ga0070666_10043102
312 Ga0070682_100054742
313 Ga0068868_100339321
314 Ga0070689_100005984
315 Ga0070661_100076079
316 Ga0070669_100007667
317 Ga0070675_100013729
318 Ga0070675_100082310
319 Ga0070671_100000196
320 Ga0070674_100022426
321 Ga0070674_100049485
322 Ga0070674_100274488
323 Ga0070673_100012852
324 Ga0070673_100068722
325 Ga0070688_100023902
326 Ga0070688_100107711
327 Ga0070667_100000043
328 Ga0070667_100012560
329 Ga0070714_100296988
330 Ga0070701_10020237
331 Ga0070711_100018981
332 Ga0070705_100013817
333 Ga0070663_100258083
334 Ga0070678_100010470
335 Ga0070678_100019134
336 Ga0070662_100147268
337 Ga0070662_100382397
338 Ga0068867_100068946
339 Ga0070685_10042500
340 Ga0070679_100091164
341 Ga0070672_100027654
342 Ga0070672_100123446
343 Ga0070686_100010613
344 Ga0070696_100002354
345 Ga0070696_100036928
346 Ga0070665_100008970
347 Ga0070665_100015592
348 Ga0068855_100005663
349 Ga0068855_100474190
350 Ga0068857_100248328
351 Ga0068857_100588199
352 Ga0070702_100155797
353 Ga0068859_100002402
354 Ga0068859_100016030
355 Ga0068859_100021927
356 Ga0068859_100247641
357 Ga0068861_100019794
358 Ga0068861_100332679
359 Ga0068870_10001753
360 Ga0068870_10061344
361 Ga0068863_100000954
362 Ga0068863_100058879
363 Ga0068863_100208299
364 Ga0068858_100000113
365 Ga0068858_100508122
366 Ga0068860_100000405
367 Ga0068860_100018791
368 Ga0068860_100099618
369 Ga0068862_100006240
370 Ga0068862_100006555
371 Ga0068862_100049967
372 Ga0068862_100137981
373 Ga0068862_100161032
374 Ga0081539_10000016
375 Ga0070715_10076800
376 Ga0075428_100265662
377 Ga0068865_100036236
378 Ga0068865_100105654
379 Ga0068865_100165331
380 Ga0097620_100002402
381 Ga0097620_100016031
382 Ga0097620_100021927
383 Ga0097620_100247616
384 Ga0099794_10024013
385 Ga0105240_10011462
386 Ga0105240_10027493
387 Ga0105240_10038293
388 Ga0105240_10301611
389 Ga0111539_10070853
390 Ga0105247_10000445
391 Ga0105243_10054649
392 Ga0105241_10362193
393 Ga0105242_10167311
394 Ga0105248_10039397
395 Ga0105248_10222367
396 Ga0105237_10295117
397 Ga0105238_10105007
398 Ga0105249_10026169
399 Ga0105249_10329781
400 Ga0099796_10006357
401 Ga0105246_10038973
402 Ga0157369_10005257
403 Ga0157374_10534790
404 Ga0157378_10140916
405 Ga0163162_10013996
406 Ga0163162_10200158
407 Ga0157375_10019149
408 Ga0157375_10036357
409 Ga0157375_10091487
410 Ga0163163_10065960
411 Ga0163163_10540871
412 Ga0157380_10008541
413 Ga0157380_10013813
414 Ga0157377_10078837
415 Ga0157379_10025786
416 Ga0157379_10213934
417 Ga0157376_10082320
418 Ga0157376_10160441
419 Ga0207710_10000334
420 Ga0207685_10060868
421 Ga0207645_10028004
422 Ga0207645_10269110
423 Ga0207643_10017123
424 Ga0207643_10113856
425 Ga0207707_10079238
426 Ga0207695_10028815
427 Ga0207695_10076927
428 Ga0207663_10010981
429 Ga0207660_10009799
430 Ga0207662_10052962
431 Ga0207662_10165654
432 Ga0207681_10126589
433 Ga0207694_10087820
434 Ga0207650_10448750
435 Ga0207659_10019518
436 Ga0207659_10024824
437 Ga0207644_10001248
438 Ga0207706_10159293
439 Ga0207709_10063007
440 Ga0207670_10196363
441 Ga0207669_10043809
442 Ga0207704_10251194
443 Ga0207704_10307097
444 Ga0207691_10003322
445 Ga0207691_10041238
446 Ga0207691_10044346
447 Ga0207711_10106398
448 Ga0207711_10181380
449 Ga0207689_10198994
450 Ga0207689_10207788
451 Ga0207667_10019954
452 Ga0207667_10526873
453 Ga0207651_10014439
454 Ga0207651_10045352
455 Ga0207712_10019409
456 Ga0207712_10085322
457 Ga0207712_10151556
458 Ga0207658_10000330
459 Ga0207658_10038542
460 Ga0207677_10578989
461 Ga0207703_10006995
462 Ga0207703_10303410
463 Ga0207678_10011754
464 Ga0207708_10297729
465 Ga0207702_10361078
466 Ga0207641_10000201
467 Ga0207641_10024142
468 Ga0207641_10134248
469 Ga0207648_10055063
470 Ga0207648_10071274
471 Ga0207648_10136588
472 Ga0207674_10081511
473 Ga0207674_10275472
474 Ga0207675_100002896
475 Ga0207675_100049554
476 Ga0207683_10005552
477 Ga0207683_10032619
478 Ga0209588_1043640
479 Ga0207428_10096821
480 Ga0268266_10007418
481 Ga0268266_10009671
482 Ga0268266_10069449
483 Ga0268265_10013271
484 Ga0268265_10022369
485 Ga0268265_10157895
486 Ga0268265_10248156
487 Ga0268265_10356442
488 Ga0268264_10000183
489 Ga0268264_10026006
490 Ga0268264_10041573
491 Ga0307515_10004982
492 Ga0265338_10226990
493 Ga0307511_10004923
494 Ga0265770_1000122
495 Ga0307509_10000025
496 Ga0307508_10248484
497 Ga0316575_10115589
498 Ga0316579_10003743
499 Ga0316579_10010046
500 Ga0316576_10086410
501 Ga0316578_10000631
502 Ga0307516_10000373
503 Ga0316577_10044742
504 Ga0316583_10002488
505 Ga0316580_10034906
506 Ga0316593_10015631
507 Ga0316593_10098263
508 Ga0307510_10000002
509 Ga0373936_0054838
510 Ga0316574_0014329
511 Ga0373937_0169348
512 Ga0373937_0608335
513 Ga0316582_0005451
514 Ga0316582_0153024
515 Ga0373925_0173366
516 Ga0373925_0214351
517 Ga0395898_0030103
518 Ga0395901_0298132
519 Ga0400487_61333
520 Ga0436365_1434390
521 Ga0451853_1332215
522 Ga0451577_0138333
523 Ga0466966_0075374
524 Ga0495590_0003527
525 Ga0495607_0000011
526 Ga0495583_0088516
527 Ga0495606_0136404
528 Ga0495616_0000669
529 Ga0495632_0059824
530 Ga0495656_0146255
531 Ga0495668_0023088
532 Ga0495625_0100536
533 Ga0495625_0108015
534 Ga0495670_0095415
535 Ga0495649_0151127
536 Ga0495600_0173507
537 Ga0495680_0082559
538 Ga0495686_0018617
539 Ga0496100_0264550
540 Ga0496102_0020845
541 Ga0496102_0317055
542 Ga0496103_0049328
543 Ga0496103_0055715
544 Ga0496104_0006090
545 Ga0496105_0012046
546 Ga0496106_0503147
547 Ga0496114_0054076
548 Ga0496115_0105983
549 Ga0496116_0023428
550 Ga0496117_0000054
551 Ga0496118_0000045
552 Ga0496118_0052550
553 Ga0496119_0003904
554 Ga0496119_0016511
555 Ga0496119_0036206
556 Ga0496120_0000759
557 Ga0496121_0009623
558 Ga0496121_0035761
559 Ga0496121_0067004
560 Ga0496125_0012911
561 Ga0496125_0057609
562 Ga0496126_0068973
563 Ga0496126_0149922
564 Ga0496126_0202369
565 Ga0501039_0040359
566 Ga0501041_0041796
567 Ga0501042_0210373
568 Ga0501068_0000141
569 Ga0501070_0088373
570 Ga0501072_0488290
571 Ga0501073_0001035
572 Ga0501074_0000994
573 Ga0501076_0075763
574 Ga0501077_0001084
575 Ga0501079_0000033
576 Ga0501079_0369300
577 Ga0501080_0005880
578 Ga0501083_0076748
579 nmdc:mga08y16_128675_c1
580 Ga0495601_0093781
581 Ga0495619_0368129
582 Ga0500646_0037315
583 Ga0500647_0102327
584 Ga0500583_0014763
585 Ga0500583_0042892
586 Ga0500583_0166714
587 Ga0500651_0173982
588 Ga0500641_0015504
589 Ga0500641_0017525
590 Ga0500556_0024401
591 Ga0500591_102299
592 Ga0500614_030709
593 Ga0500642_0009361
594 Ga0500568_0002054
595 Ga0500588_0006816
596 Ga0500588_0077199
597 Ga0500616_0000018
598 Ga0500616_0028693
599 Ga0500616_0053773
600 Ga0500627_0053559
601 Ga0500630_101104
602 Ga0500611_008246
603 Ga0501084_0003544
604 Ga0501084_0606445
605 Ga0501082_0027728
606 2857580530

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01435

Peptidase_M48

Peptidase family M48

104

322

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.9444 63 152
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8677 64 153
3cqb-assembly1.cif.gz_B crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.8357 63 152
3cqb-assembly1.cif.gz_A crystal structure of heat shock protein htpx domain from vibrio parahaemolyticus rimd 2210633 0.7523 64 153
2ypt-assembly2.cif.gz_A crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 mutant (e336a) in complex with a synthetic csim tetrapeptide from the c-terminus of prelamin a 0.6739 7 290
ID Description Score Start End Superfamily
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 1.002 71 162 3.30.2010.10
af_P23894_64_157_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9705 71 162 3.30.2010.10
af_Q59076_58_147_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.89 75 157 3.30.2010.10
af_P9WHS5_62_152_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8677 75 160 3.30.2010.10
af_O53978_67_150_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.8642 76 157 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A6I1IQ61-F1-model_v4 deleted 0.992 45 176
AF-A0A377CHR2-F1-model_v4 M48B family peptidase (EC 3.4.24.-) 0.9754 61 153 GO:0004222
GO:0005886
GO:0006508
GO:0046872
AF-A0A6I1IQ61-F1-model_v4 deleted 0.9701 45 176
AF-A0A833KN15-F1-model_v4 deleted 0.9681 36 185
AF-A0A1A8XYF2-F1-model_v4 Protease HtpX homolog (EC 3.4.24.-) 0.9471 1 289 GO:0004222
GO:0005886
GO:0006508
GO:0008270

Map