F397167

General Info

Members Datasets Scaffolds Average Seq Length
303 165 606 832

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0262179|Ga0436362_0262179_1091_3865
Length 915
Sequence MTNGWIDIKNTDMMLIMGGNPAENHPCGFKWAVEAKRNRNAKLICVDPRFTRTASQADLFLQIRAGSDIAFLGGLINYAINNNRLARDYLAHYTNAAFIIKEGFKLPEDGLYSGFNEDTHIYDKSTWNYEEGGNVTPKGALVAAALTGGAQGIAGNIPGGARPGSVGSVSANVTGNQHASGAAANAFEQSAPKAHAAPXXXXGSVQATQGGHGPPVGAKGAXXXXAPVPMLPGNVAYDLSLQHPRCVFQLLKQQYSRYTPEMVERITGIPQDQFLKAADLFTSVRKDGDMKKAATIIYAVGWTQHTFGTQIIRTGAMLQLLLGNVGRAGGGVNALRGHSNIQGATDMGGVFDIFPGYLKVGNPTDTDFAAYIKRSTPTPSKPKEWDSFNYWSNTPKFAVSLLKAFYGDNAKKENDWAFHNLPKIDRRYSWVELFDRMYNGEVKGLFAFGMNAVMIGPDSKKNVDALKKLDWLVDSEIYADETSEFWRYPGTTADELKAINTTVYRLPGAGFAEKDGNMVNSARWTQWKNIALPPPGDAKVDQEILARIFLRIRDLYKSGGTFPDPVLAVTWAYSNPLNPPLAEVAKEINGRALQDVTDEKTNTTIKAGQQLPGFAFLRDDGSTLCGNWLYSGSWTEAGCQSARRDTSDPSGLGIYQGWSWSWPANRRVMYNRASCDVNGQPWDASRKQVWWSEASKKWVGNDVPDFKPDSPPQDHMGPFIMLPEGVGRIFAPIGNFAEGPFPEHYEPYESPIQNPLHPNRSTNPVLIQFKTADDKYGSVKEGFNIICTTYRLTEHYHYWTKNNPMNVQLVPEPFVEIPVELAHEMGISGGDNVRVSSARNYYVAKAMVTNRIRPMTIDGKKTYQIGIPIHWGYRGIQEDRDKTAHTPANNLSPTIMDPNAYTPEFKGFMVKLEKA

Samples

Sample ID Description Type Environment
1 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
68 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
69 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
70 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
99 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
140 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
147 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
164 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
165 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 4.62
Rhizosphere 94.06
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436362_0262179 3300039453 Bacteria 5794
2 JGI25406J46586_10011780 3300003203 Bacteria 3818
3 Ga0058861_10098190 3300004800 Bacteria 4280
4 Ga0065714_10064428 3300005288 Bacteria 144890
5 Ga0065712_10000115 3300005290 Bacteria 144502
6 Ga0065712_10069147 3300005290 Bacteria 7907
7 Ga0065707_10084087 3300005295 Bacteria 7717
8 Ga0065707_10086232 3300005295 Bacteria 5577
9 Ga0070683_100002043 3300005329 Bacteria 15891
10 Ga0070690_100001008 3300005330 Bacteria 14392
11 Ga0070670_100013705 3300005331 Bacteria 6948
12 Ga0070666_10019218 3300005335 Bacteria 4407
13 Ga0070682_100002460 3300005337 Bacteria 10234
14 Ga0070671_100011670 3300005355 Bacteria 7066
15 Ga0070709_10000318 3300005434 Bacteria 30634
16 Ga0070709_10001166 3300005434 Bacteria 14415
17 Ga0070709_10040917 3300005434 Bacteria 2852
18 Ga0070714_100017558 3300005435 Bacteria 5799
19 Ga0070713_100000548 3300005436 Bacteria 23893
20 Ga0070713_100005782 3300005436 Bacteria 8500
21 Ga0070713_100046271 3300005436 Bacteria 3569
22 Ga0070711_100000007 3300005439 Bacteria 182651
23 Ga0070711_100000781 3300005439 Bacteria 16615
24 Ga0070711_100005523 3300005439 Bacteria 7569
25 Ga0070711_100020421 3300005439 Bacteria 4269
26 Ga0070711_100020987 3300005439 Bacteria 4219
27 Ga0070700_100030498 3300005441 Bacteria 3223
28 Ga0070694_100006234 3300005444 Bacteria 7239
29 Ga0070708_100000365 3300005445 Bacteria 34262
30 Ga0070708_100000509 3300005445 Bacteria 29265
31 Ga0070708_100003617 3300005445 Bacteria 12126
32 Ga0070708_100011408 3300005445 Bacteria 7231
33 Ga0070708_100011616 3300005445 Bacteria 7167
34 Ga0070708_100014264 3300005445 Bacteria 6531
35 Ga0070708_100040572 3300005445 Bacteria 4076
36 Ga0070681_10027312 3300005458 Bacteria 5738
37 Ga0070681_10086269 3300005458 Bacteria 3092
38 Ga0070706_100000003 3300005467 Bacteria 284182
39 Ga0070706_100000019 3300005467 Bacteria 166483
40 Ga0070706_100003813 3300005467 Bacteria 14729
41 Ga0070706_100004343 3300005467 Bacteria 13711
42 Ga0070707_100000341 3300005468 Bacteria 45882
43 Ga0070707_100000674 3300005468 Bacteria 33906
44 Ga0070707_100006382 3300005468 Bacteria 10964
45 Ga0070707_100006472 3300005468 Bacteria 10884
46 Ga0070707_100017627 3300005468 Bacteria 6717
47 Ga0070707_100017804 3300005468 Bacteria 6679
48 Ga0070707_100087102 3300005468 Bacteria 3021
49 Ga0070698_100000900 3300005471 Bacteria 32637
50 Ga0070698_100005849 3300005471 Bacteria 13441
51 Ga0070698_100026271 3300005471 Bacteria 6062
52 Ga0070698_100074489 3300005471 Bacteria 3400
53 Ga0070699_100002656 3300005518 Bacteria 15972
54 Ga0070699_100015328 3300005518 Bacteria 6587
55 Ga0070699_100030531 3300005518 Bacteria 4653
56 Ga0070684_100001401 3300005535 Bacteria 17347
57 Ga0070697_100004333 3300005536 Bacteria 10887
58 Ga0070697_100024595 3300005536 Bacteria 4796
59 Ga0070697_100027844 3300005536 Bacteria 4524
60 Ga0070697_100038221 3300005536 Bacteria 3878
61 Ga0070697_100052554 3300005536 Bacteria 3310
62 Ga0070697_100063040 3300005536 Bacteria 3027
63 Ga0070686_100001146 3300005544 Bacteria 15210
64 Ga0070686_100003149 3300005544 Bacteria 9036
65 Ga0070695_100033116 3300005545 Bacteria 3232
66 Ga0070696_100010280 3300005546 Bacteria 6265
67 Ga0070665_100000292 3300005548 Bacteria 79257
68 Ga0070704_100007899 3300005549 Bacteria 6349
69 Ga0068854_100018534 3300005578 Bacteria 4675
70 Ga0068859_100017173 3300005617 Bacteria 7266
71 Ga0068864_100015948 3300005618 Bacteria 6253
72 Ga0068861_100037652 3300005719 Bacteria 3596
73 Ga0068860_100002021 3300005843 Bacteria 21410
74 Ga0068862_100054328 3300005844 Bacteria 3429
75 Ga0081540_1000023 3300005983 Bacteria 159665
76 Ga0081539_10000318 3300005985 Bacteria 107294
77 Ga0081539_10001943 3300005985 Bacteria 31691
78 Ga0070717_10003600 3300006028 Bacteria 11114
79 Ga0070717_10015835 3300006028 Bacteria 5831
80 Ga0070715_10009372 3300006163 Bacteria 3450
81 Ga0070716_100000007 3300006173 Bacteria 256300
82 Ga0070716_100003744 3300006173 Bacteria 7199
83 Ga0070716_100028576 3300006173 Bacteria 3006
84 Ga0070712_100002791 3300006175 Bacteria 10788
85 Ga0070712_100007981 3300006175 Bacteria 6637
86 Ga0070712_100039223 3300006175 Bacteria 3240
87 Ga0097621_100001861 3300006237 Bacteria 14473
88 Ga0075430_100040051 3300006846 Bacteria 3966
89 Ga0075431_100003707 3300006847 Bacteria 14845
90 Ga0075433_10003446 3300006852 Bacteria 12201
91 Ga0075434_100006188 3300006871 Bacteria 10957
92 Ga0075434_100007526 3300006871 Bacteria 10084
93 Ga0075434_100014660 3300006871 Bacteria 7498
94 Ga0075434_100034470 3300006871 Bacteria 4998
95 Ga0075434_100099300 3300006871 Bacteria 2916
96 Ga0075436_100011247 3300006914 Bacteria 6138
97 Ga0097620_100017173 3300006931 Bacteria 7266
98 Ga0075435_100005662 3300007076 Bacteria 8759
99 Ga0075435_100014738 3300007076 Bacteria 5858
100 Ga0099794_10000010 3300007265 Bacteria 90057
101 Ga0105240_10006309 3300009093 Bacteria 17447
102 Ga0105240_10018024 3300009093 Bacteria 9497
103 Ga0111539_10085712 3300009094 Bacteria 3702
104 Ga0111539_10111747 3300009094 Bacteria 3206
105 Ga0114129_10002607 3300009147 Bacteria 25068
106 Ga0114129_10010081 3300009147 Bacteria 13469
107 Ga0114129_10012186 3300009147 Bacteria 12232
108 Ga0105248_10058384 3300009177 Bacteria 4333
109 Ga0105237_10000953 3300009545 Bacteria 38916
110 Ga0105237_10042946 3300009545 Bacteria 4557
111 Ga0105238_10071488 3300009551 Bacteria 3467
112 Ga0105249_10009458 3300009553 Bacteria 8535
113 Ga0105249_10038332 3300009553 Bacteria 4349
114 Ga0157369_10000299 3300013105 Bacteria 66242
115 Ga0157378_10056575 3300013297 Bacteria 3495
116 Ga0157372_10019643 3300013307 Bacteria 7283
117 Ga0163163_10023088 3300014325 Bacteria 5900
118 Ga0157380_10024278 3300014326 Bacteria 4587
119 Ga0157376_10000029 3300014969 Bacteria 201828
120 Ga0157376_10001873 3300014969 Bacteria 14030
121 Ga0213876_10000107 3300021384 Bacteria 91959
122 Ga0224570_100269 3300022730 Bacteria 3875
123 Ga0224569_100021 3300022732 Bacteria 9369
124 Ga0224572_1000010 3300024225 Bacteria 9457
125 Ga0228598_1000679 3300024227 Bacteria 7196
126 Ga0228598_1000837 3300024227 Bacteria 6646
127 Ga0228598_1001403 3300024227 Bacteria 5301
128 Ga0207647_10001223 3300025904 Bacteria 19761
129 Ga0207685_10009654 3300025905 Bacteria 2812
130 Ga0207699_10000011 3300025906 Bacteria 282783
131 Ga0207699_10000270 3300025906 Bacteria 28509
132 Ga0207684_10000032 3300025910 Bacteria 293234
133 Ga0207684_10000387 3300025910 Bacteria 59233
134 Ga0207684_10000843 3300025910 Bacteria 35325
135 Ga0207684_10017771 3300025910 Bacteria 6100
136 Ga0207695_10003354 3300025913 Bacteria 22633
137 Ga0207671_10029435 3300025914 Bacteria 4100
138 Ga0207693_10000011 3300025915 Bacteria 160684
139 Ga0207693_10000193 3300025915 Bacteria 55368
140 Ga0207693_10000256 3300025915 Bacteria 48996
141 Ga0207693_10042266 3300025915 Bacteria 3588
142 Ga0207663_10000001 3300025916 Bacteria 591990
143 Ga0207663_10003308 3300025916 Bacteria 7863
144 Ga0207663_10011283 3300025916 Bacteria 4794
145 Ga0207657_10001666 3300025919 Bacteria 23968
146 Ga0207646_10000165 3300025922 Bacteria 89540
147 Ga0207646_10000209 3300025922 Bacteria 80063
148 Ga0207646_10006882 3300025922 Bacteria 11676
149 Ga0207646_10015769 3300025922 Bacteria 7117
150 Ga0207646_10017141 3300025922 Bacteria 6785
151 Ga0207646_10084859 3300025922 Bacteria 2833
152 Ga0207687_10000669 3300025927 Bacteria 23062
153 Ga0207700_10000080 3300025928 Bacteria 59420
154 Ga0207700_10000359 3300025928 Bacteria 26508
155 Ga0207700_10015253 3300025928 Bacteria 5060
156 Ga0207700_10017148 3300025928 Bacteria 4829
157 Ga0207700_10021176 3300025928 Bacteria 4433
158 Ga0207700_10056734 3300025928 Unclassified 2949
159 Ga0207664_10000337 3300025929 Bacteria 34549
160 Ga0207664_10002492 3300025929 Bacteria 12189
161 Ga0207644_10029628 3300025931 Bacteria 3799
162 Ga0207665_10000018 3300025939 Bacteria 122653
163 Ga0207665_10000479 3300025939 Bacteria 27061
164 Ga0207665_10005886 3300025939 Bacteria 8160
165 Ga0207665_10013353 3300025939 Bacteria 5399
166 Ga0207665_10015687 3300025939 Bacteria 4972
167 Ga0207665_10039288 3300025939 Bacteria 3155
168 Ga0207665_10040502 3300025939 Bacteria 3109
169 Ga0207711_10064296 3300025941 Bacteria 3169
170 Ga0207661_10001049 3300025944 Bacteria 18344
171 Ga0207679_10008519 3300025945 Bacteria 6532
172 Ga0207667_10004793 3300025949 Bacteria 16538
173 Ga0207640_10018915 3300025981 Bacteria 4058
174 Ga0207708_10001124 3300026075 Bacteria 20108
175 Ga0207641_10000423 3300026088 Bacteria 49293
176 Ga0207648_10008329 3300026089 Bacteria 10059
177 Ga0207675_100012153 3300026118 Bacteria 8042
178 Ga0207698_10014678 3300026142 Bacteria 5216
179 Ga0209588_1000008 3300027671 Bacteria 177025
180 Ga0209588_1000643 3300027671 Bacteria 8804
181 Ga0207428_10025723 3300027907 Bacteria 4923
182 Ga0265354_1000838 3300028016 Bacteria 4954
183 Ga0265356_1000659 3300028017 Bacteria 5999
184 Ga0268266_10000885 3300028379 Bacteria 38797
185 Ga0268264_10012234 3300028381 Bacteria 7060
186 Ga0268264_10028270 3300028381 Bacteria 4585
187 Ga0265338_10002594 3300028800 Bacteria 26721
188 Ga0265338_10018083 3300028800 Bacteria 7563
189 Ga0265338_10056775 3300028800 Bacteria 3468
190 Ga0265762_1002423 3300030760 Bacteria 3378
191 Ga0265760_10000589 3300031090 Bacteria 10333
192 Ga0265325_10001173 3300031241 Bacteria 18706
193 Ga0265325_10003113 3300031241 Bacteria 10945
194 Ga0265316_10023529 3300031344 Bacteria 5173
195 Ga0265316_10026401 3300031344 Bacteria 4832
196 Ga0265314_10013470 3300031711 Bacteria 6603
197 Ga0265314_10016348 3300031711 Bacteria 5861
198 Ga0373926_0004277 3300035083 Bacteria 4671
199 Ga0373954_0000199 3300035118 Bacteria 21899
200 Ga0373956_0003907 3300035119 Bacteria 5990
201 Ga0373957_0000864 3300035120 Bacteria 7940
202 Ga0373961_0000548 3300035241 Bacteria 14262
203 Ga0373935_0016094 3300035692 Bacteria 4525
204 Ga0373927_0000871 3300035695 Bacteria 23001
205 Ga0373927_0002869 3300035695 Bacteria 12548
206 Ga0373933_0000646 3300035724 Bacteria 21746
207 Ga0373933_0021206 3300035724 Bacteria 3688
208 Ga0373933_0028661 3300035724 Bacteria 3214
209 Ga0373947_0000576 3300035725 Bacteria 21462
210 Ga0373947_0001791 3300035725 Bacteria 13147
211 Ga0373947_0047696 3300035725 Bacteria 2568
212 Ga0373937_0000094 3300036401 Bacteria 82254
213 Ga0373937_0000412 3300036401 Bacteria 39962
214 Ga0373937_0001134 3300036401 Bacteria 22421
215 Ga0373937_0003107 3300036401 Bacteria 13885
216 Ga0373937_0045114 3300036401 Bacteria 4027
217 Ga0373937_0061217 3300036401 Bacteria 3460
218 Ga0373937_0076236 3300036401 Bacteria 3097
219 Ga0373925_0000656 3300037068 Bacteria 32516
220 Ga0373925_0008993 3300037068 Bacteria 7277
221 Ga0373925_0013897 3300037068 Bacteria 5827
222 Ga0373925_0025851 3300037068 Bacteria 4292
223 Ga0373925_0027307 3300037068 Bacteria 4179
224 Ga0373925_0045134 3300037068 Bacteria 3273
225 Ga0395905_0047396 3300037471 Bacteria 4028
226 Ga0436365_0267269 3300039437 Bacteria 105504
227 Ga0436360_0100490 3300039438 Bacteria 3893
228 Ga0436360_1316568 3300039438 Bacteria 3518
229 Ga0436361_0676432 3300039447 Bacteria 5454
230 Ga0453683_0007585 3300044673 Bacteria 7350
231 Ga0453684_0038597 3300044712 Bacteria 6524
232 Ga0466957_0000262 3300044842 Bacteria 25321
233 Ga0495629_0004647 3300046459 Bacteria 10281
234 Ga0495651_0014179 3300046462 Bacteria 6161
235 Ga0495580_0000575 3300046472 Bacteria 30922
236 Ga0495580_0000774 3300046472 Bacteria 27522
237 Ga0495580_0000873 3300046472 Bacteria 26074
238 Ga0495580_0001305 3300046472 Bacteria 22019
239 Ga0495580_0001776 3300046472 Bacteria 18958
240 Ga0495580_0023303 3300046472 Bacteria 4549
241 Ga0495580_0034567 3300046472 Bacteria 3639
242 Ga0495580_0046775 3300046472 Bacteria 3069
243 Ga0495582_0000120 3300046473 Bacteria 41888
244 Ga0495582_0001668 3300046473 Bacteria 12525
245 Ga0495582_0019204 3300046473 Bacteria 3738
246 Ga0495664_0002839 3300046477 Bacteria 9326
247 Ga0495664_0015780 3300046477 Bacteria 4299
248 Ga0495663_0001161 3300046525 Bacteria 8513
249 Ga0495640_0037012 3300046533 Bacteria 3445
250 Ga0495587_0000200 3300046536 Bacteria 43851
251 Ga0495587_0000677 3300046536 Bacteria 22843
252 Ga0495598_0000323 3300046537 Bacteria 8568
253 Ga0495621_0000050 3300046539 Bacteria 22810
254 Ga0495645_0011501 3300046543 Bacteria 6229
255 Ga0495657_0019587 3300046675 Bacteria 4880
256 Ga0495599_0002655 3300046678 Bacteria 10429
257 Ga0495669_0008319 3300046684 Unclassified 4359
258 Ga0495604_0002007 3300047317 Bacteria 16413
259 Ga0495604_0005211 3300047317 Bacteria 10300
260 Ga0495674_0003053 3300047319 Bacteria 16284
261 Ga0495674_0008174 3300047319 Bacteria 9981
262 Ga0495675_0002119 3300047444 Bacteria 11820
263 Ga0495675_0003124 3300047444 Bacteria 9938
264 Ga0495684_0004846 3300047471 Bacteria 10498
265 Ga0495684_0010786 3300047471 Bacteria 7063
266 Ga0495602_0005701 3300048088 Bacteria 13058
267 Ga0496102_0007643 3300048905 Bacteria 9234
268 Ga0496104_0003243 3300048907 Bacteria 14015
269 Ga0496104_0141042 3300048907 Bacteria 2315
270 Ga0496105_0000394 3300048908 Bacteria 28691
271 Ga0496108_0002229 3300048911 Bacteria 15527
272 Ga0496109_0008479 3300048912 Bacteria 8737
273 Ga0496112_0009420 3300048915 Bacteria 8799
274 Ga0496112_0023825 3300048915 Bacteria 5855
275 Ga0496112_0025895 3300048915 Bacteria 5637
276 Ga0496112_0063804 3300048915 Bacteria 3634
277 Ga0496112_0064322 3300048915 Bacteria 3620
278 Ga0496113_0001756 3300048916 Bacteria 12291
279 Ga0496114_0000064 3300048917 Bacteria 83513
280 Ga0496115_0022012 3300048918 Bacteria 4931
281 Ga0501067_0014248 3300049583 Bacteria 4402
282 Ga0501077_0000071 3300049593 Bacteria 50853
283 nmdc:mga05p37_22248_c1 3300050507 Bacteria 7686
284 nmdc:mga05p37_22920_c1 3300050507 Bacteria 7573
285 nmdc:mga05p37_43074_c1 3300050507 Bacteria 5551
286 nmdc:mga06r32_5540_c1 3300050510 Bacteria 11376
287 nmdc:mga08y16_35825_c1 3300050511 Bacteria 5212
288 nmdc:mga08y16_89106_c1 3300050511 Bacteria 3215
289 nmdc:mga0n895_6212_c1 3300050512 Bacteria 10106
290 nmdc:mga0n895_91662_c1 3300050512 Bacteria 3042
291 nmdc:mga0rr50_3709_c1 3300050513 Bacteria 8850
292 nmdc:mga08x19_21237_c1 3300050514 Bacteria 4005
293 nmdc:mga08x19_21985_c1 3300050514 Bacteria 3945
294 nmdc:mga08x19_28_c1 3300050514 Bacteria 224933
295 nmdc:mga08x19_6578_c1 3300050514 Bacteria 6887
296 nmdc:mga0a205_18765_c1 3300050515 Bacteria 6510
297 nmdc:mga0a205_45275_c1 3300050515 Bacteria 4242
298 nmdc:mga0a205_68559_c1 3300050515 Bacteria 3425
299 nmdc:mga0a205_82385_c1 3300050515 Bacteria 3107
300 nmdc:mga0a205_8672_c2 3300050515 Bacteria 7842
301 Ga0500555_002074 3300053103 Bacteria 5892
302 Ga0500645_001622 3300053730 Bacteria 11134
303 Ga0501082_0000703 3300060353 Bacteria 29422
304 Ga0436362_0262179
305 JGI25406J46586_10011780
306 Ga0058861_10098190
307 Ga0065714_10064428
308 Ga0065712_10000115
309 Ga0065712_10069147
310 Ga0065707_10084087
311 Ga0065707_10086232
312 Ga0070683_100002043
313 Ga0070690_100001008
314 Ga0070670_100013705
315 Ga0070666_10019218
316 Ga0070682_100002460
317 Ga0070671_100011670
318 Ga0070709_10000318
319 Ga0070709_10001166
320 Ga0070709_10040917
321 Ga0070714_100017558
322 Ga0070713_100000548
323 Ga0070713_100005782
324 Ga0070713_100046271
325 Ga0070711_100000007
326 Ga0070711_100000781
327 Ga0070711_100005523
328 Ga0070711_100020421
329 Ga0070711_100020987
330 Ga0070700_100030498
331 Ga0070694_100006234
332 Ga0070708_100000365
333 Ga0070708_100000509
334 Ga0070708_100003617
335 Ga0070708_100011408
336 Ga0070708_100011616
337 Ga0070708_100014264
338 Ga0070708_100040572
339 Ga0070681_10027312
340 Ga0070681_10086269
341 Ga0070706_100000003
342 Ga0070706_100000019
343 Ga0070706_100003813
344 Ga0070706_100004343
345 Ga0070707_100000341
346 Ga0070707_100000674
347 Ga0070707_100006382
348 Ga0070707_100006472
349 Ga0070707_100017627
350 Ga0070707_100017804
351 Ga0070707_100087102
352 Ga0070698_100000900
353 Ga0070698_100005849
354 Ga0070698_100026271
355 Ga0070698_100074489
356 Ga0070699_100002656
357 Ga0070699_100015328
358 Ga0070699_100030531
359 Ga0070684_100001401
360 Ga0070697_100004333
361 Ga0070697_100024595
362 Ga0070697_100027844
363 Ga0070697_100038221
364 Ga0070697_100052554
365 Ga0070697_100063040
366 Ga0070686_100001146
367 Ga0070686_100003149
368 Ga0070695_100033116
369 Ga0070696_100010280
370 Ga0070665_100000292
371 Ga0070704_100007899
372 Ga0068854_100018534
373 Ga0068859_100017173
374 Ga0068864_100015948
375 Ga0068861_100037652
376 Ga0068860_100002021
377 Ga0068862_100054328
378 Ga0081540_1000023
379 Ga0081539_10000318
380 Ga0081539_10001943
381 Ga0070717_10003600
382 Ga0070717_10015835
383 Ga0070715_10009372
384 Ga0070716_100000007
385 Ga0070716_100003744
386 Ga0070716_100028576
387 Ga0070712_100002791
388 Ga0070712_100007981
389 Ga0070712_100039223
390 Ga0097621_100001861
391 Ga0075430_100040051
392 Ga0075431_100003707
393 Ga0075433_10003446
394 Ga0075434_100006188
395 Ga0075434_100007526
396 Ga0075434_100014660
397 Ga0075434_100034470
398 Ga0075434_100099300
399 Ga0075436_100011247
400 Ga0097620_100017173
401 Ga0075435_100005662
402 Ga0075435_100014738
403 Ga0099794_10000010
404 Ga0105240_10006309
405 Ga0105240_10018024
406 Ga0111539_10085712
407 Ga0111539_10111747
408 Ga0114129_10002607
409 Ga0114129_10010081
410 Ga0114129_10012186
411 Ga0105248_10058384
412 Ga0105237_10000953
413 Ga0105237_10042946
414 Ga0105238_10071488
415 Ga0105249_10009458
416 Ga0105249_10038332
417 Ga0157369_10000299
418 Ga0157378_10056575
419 Ga0157372_10019643
420 Ga0163163_10023088
421 Ga0157380_10024278
422 Ga0157376_10000029
423 Ga0157376_10001873
424 Ga0213876_10000107
425 Ga0224570_100269
426 Ga0224569_100021
427 Ga0224572_1000010
428 Ga0228598_1000679
429 Ga0228598_1000837
430 Ga0228598_1001403
431 Ga0207647_10001223
432 Ga0207685_10009654
433 Ga0207699_10000011
434 Ga0207699_10000270
435 Ga0207684_10000032
436 Ga0207684_10000387
437 Ga0207684_10000843
438 Ga0207684_10017771
439 Ga0207695_10003354
440 Ga0207671_10029435
441 Ga0207693_10000011
442 Ga0207693_10000193
443 Ga0207693_10000256
444 Ga0207693_10042266
445 Ga0207663_10000001
446 Ga0207663_10003308
447 Ga0207663_10011283
448 Ga0207657_10001666
449 Ga0207646_10000165
450 Ga0207646_10000209
451 Ga0207646_10006882
452 Ga0207646_10015769
453 Ga0207646_10017141
454 Ga0207646_10084859
455 Ga0207687_10000669
456 Ga0207700_10000080
457 Ga0207700_10000359
458 Ga0207700_10015253
459 Ga0207700_10017148
460 Ga0207700_10021176
461 Ga0207700_10056734
462 Ga0207664_10000337
463 Ga0207664_10002492
464 Ga0207644_10029628
465 Ga0207665_10000018
466 Ga0207665_10000479
467 Ga0207665_10005886
468 Ga0207665_10013353
469 Ga0207665_10015687
470 Ga0207665_10039288
471 Ga0207665_10040502
472 Ga0207711_10064296
473 Ga0207661_10001049
474 Ga0207679_10008519
475 Ga0207667_10004793
476 Ga0207640_10018915
477 Ga0207708_10001124
478 Ga0207641_10000423
479 Ga0207648_10008329
480 Ga0207675_100012153
481 Ga0207698_10014678
482 Ga0209588_1000008
483 Ga0209588_1000643
484 Ga0207428_10025723
485 Ga0265354_1000838
486 Ga0265356_1000659
487 Ga0268266_10000885
488 Ga0268264_10012234
489 Ga0268264_10028270
490 Ga0265338_10002594
491 Ga0265338_10018083
492 Ga0265338_10056775
493 Ga0265762_1002423
494 Ga0265760_10000589
495 Ga0265325_10001173
496 Ga0265325_10003113
497 Ga0265316_10023529
498 Ga0265316_10026401
499 Ga0265314_10013470
500 Ga0265314_10016348
501 Ga0373926_0004277
502 Ga0373954_0000199
503 Ga0373956_0003907
504 Ga0373957_0000864
505 Ga0373961_0000548
506 Ga0373935_0016094
507 Ga0373927_0000871
508 Ga0373927_0002869
509 Ga0373933_0000646
510 Ga0373933_0021206
511 Ga0373933_0028661
512 Ga0373947_0000576
513 Ga0373947_0001791
514 Ga0373947_0047696
515 Ga0373937_0000094
516 Ga0373937_0000412
517 Ga0373937_0001134
518 Ga0373937_0003107
519 Ga0373937_0045114
520 Ga0373937_0061217
521 Ga0373937_0076236
522 Ga0373925_0000656
523 Ga0373925_0008993
524 Ga0373925_0013897
525 Ga0373925_0025851
526 Ga0373925_0027307
527 Ga0373925_0045134
528 Ga0395905_0047396
529 Ga0436365_0267269
530 Ga0436360_0100490
531 Ga0436360_1316568
532 Ga0436361_0676432
533 Ga0453683_0007585
534 Ga0453684_0038597
535 Ga0466957_0000262
536 Ga0495629_0004647
537 Ga0495651_0014179
538 Ga0495580_0000575
539 Ga0495580_0000774
540 Ga0495580_0000873
541 Ga0495580_0001305
542 Ga0495580_0001776
543 Ga0495580_0023303
544 Ga0495580_0034567
545 Ga0495580_0046775
546 Ga0495582_0000120
547 Ga0495582_0001668
548 Ga0495582_0019204
549 Ga0495664_0002839
550 Ga0495664_0015780
551 Ga0495663_0001161
552 Ga0495640_0037012
553 Ga0495587_0000200
554 Ga0495587_0000677
555 Ga0495598_0000323
556 Ga0495621_0000050
557 Ga0495645_0011501
558 Ga0495657_0019587
559 Ga0495599_0002655
560 Ga0495669_0008319
561 Ga0495604_0002007
562 Ga0495604_0005211
563 Ga0495674_0003053
564 Ga0495674_0008174
565 Ga0495675_0002119
566 Ga0495675_0003124
567 Ga0495684_0004846
568 Ga0495684_0010786
569 Ga0495602_0005701
570 Ga0496102_0007643
571 Ga0496104_0003243
572 Ga0496104_0141042
573 Ga0496105_0000394
574 Ga0496108_0002229
575 Ga0496109_0008479
576 Ga0496112_0009420
577 Ga0496112_0023825
578 Ga0496112_0025895
579 Ga0496112_0063804
580 Ga0496112_0064322
581 Ga0496113_0001756
582 Ga0496114_0000064
583 Ga0496115_0022012
584 Ga0501067_0014248
585 Ga0501077_0000071
586 nmdc:mga05p37_22248_c1
587 nmdc:mga05p37_22920_c1
588 nmdc:mga05p37_43074_c1
589 nmdc:mga06r32_5540_c1
590 nmdc:mga08y16_35825_c1
591 nmdc:mga08y16_89106_c1
592 nmdc:mga0n895_6212_c1
593 nmdc:mga0n895_91662_c1
594 nmdc:mga0rr50_3709_c1
595 nmdc:mga08x19_21237_c1
596 nmdc:mga08x19_21985_c1
597 nmdc:mga08x19_28_c1
598 nmdc:mga08x19_6578_c1
599 nmdc:mga0a205_18765_c1
600 nmdc:mga0a205_45275_c1
601 nmdc:mga0a205_68559_c1
602 nmdc:mga0a205_82385_c1
603 nmdc:mga0a205_8672_c2
604 Ga0500555_002074
605 Ga0500645_001622
606 Ga0501082_0000703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00384

Molybdopterin

Molybdopterin oxidoreductase

1

550

0.94

PF01568

Molydop_binding

Molydopterin dinucleotide binding domain

785

909

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oz8-assembly1.cif.gz_D crystal structure of mtb aspartate decarboxylase in active form 0.8917 735 770
1kqf-assembly1.cif.gz_A formate dehydrogenase n from e. coli 0.8717 1 834
4d7z-assembly1.cif.gz_B e. coli l-aspartate-alpha-decarboxylase mutant n72q to a resolution of 1.9 angstroms 0.8621 735 770
1pyu-assembly1.cif.gz_B processed aspartate decarboxylase mutant with ser25 mutated to cys 0.8547 734 770
3tm7-assembly1.cif.gz_D processed aspartate decarboxylase mutant with asn72 mutated to ala 0.8512 734 770
ID Description Score Start End Superfamily
1kqgA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.934 657 834 2.40.40.20
1kqgA03 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.931 1 283 3.40.228.10
1kqgA04 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.9137 657 834 2.40.40.20
2iv2X03 Alpha Beta;3-Layer(aba) Sandwich;Dimethylsulfoxide Reductase; domain 2;Dimethylsulfoxide Reductase, domain 2 0.897 1 279 3.40.228.10
4aonE00 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.8523 734 770 2.40.40.20
ID Description Score Start End GO Terms
AF-A0A2V9UWJ9-F1-model_v4 Molybdopterin dinucleotide-binding domain-containing protein 0.942 595 834 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0043546
GO:0051539
AF-A0A7V9VT16-F1-model_v4 deleted 0.9371 637 834
AF-A0A621B1Y1-F1-model_v4 Molybdopterin dinucleotide binding domain protein 0.9355 655 834 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0043546
GO:0051539
AF-F9QAY6-F1-model_v4 Putative formate dehydrogenase, nitrate-inducible, major subunit 0.9317 1 408 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0051539
AF-A0A621B1Y1-F1-model_v4 Molybdopterin dinucleotide binding domain protein 0.9304 655 834 GO:0009055
GO:0009061
GO:0016491
GO:0030151
GO:0030313
GO:0043546
GO:0051539

Map