F397125

General Info

Members Datasets Scaffolds Average Seq Length
303 158 303 178

Family's Representative Sequence

Representative Sequence 3300035086|Ga0373934_0002753|Ga0373934_0002753_4206_4850
Length 214
Sequence MRAGLPDRRFGGKGLGGGADGEKSRRGYFSGGKERGDGMKKVKVATVWLDGCSGCHMSLLDMDAAVIPLGRKIDLVYGPLVDAQEFPEGVDVTLVEGAVSSQDDLDKLQKIRQRTQVLISLGDCAVTGNVPAMRNFLPTNKLLQQVYVERADENKVIPKDGVPTLLKHARPLREYVKVDYFLPGCPPPSKAILNAINDLLEGRKPAANPNVKFG

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
71 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
72 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
73 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
74 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
75 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
76 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
86 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
87 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
88 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
89 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
92 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
93 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
94 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
113 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
117 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
153 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 1.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.99
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10004556 3300001991 Unclassified 2267
2 Ga0070670_100029946 3300005331 Bacteria 4687
3 Ga0070670_100246663 3300005331 Bacteria 1555
4 Ga0070660_100655206 3300005339 Bacteria 879
5 Ga0070661_100027869 3300005344 Bacteria 4071
6 Ga0070709_10552695 3300005434 Bacteria 881
7 Ga0070714_100091795 3300005435 Bacteria 2661
8 Ga0070714_100507266 3300005435 Bacteria 1151
9 Ga0070714_100845382 3300005435 Bacteria 887
10 Ga0070713_100001364 3300005436 Bacteria 15622
11 Ga0070713_100048522 3300005436 Unclassified 3496
12 Ga0070713_100529697 3300005436 Unclassified 1114
13 Ga0070713_101242647 3300005436 Bacteria 721
14 Ga0070710_10039722 3300005437 Bacteria 2590
15 Ga0070711_100001326 3300005439 Bacteria 13503
16 Ga0070711_100034459 3300005439 Bacteria 3377
17 Ga0070711_100336332 3300005439 Bacteria 1210
18 Ga0070711_101268107 3300005439 Bacteria 639
19 Ga0070663_100041585 3300005455 Bacteria 3225
20 Ga0070678_100218080 3300005456 Bacteria 1584
21 Ga0070684_100064936 3300005535 Bacteria 3203
22 Ga0070665_100041419 3300005548 Bacteria 4630
23 Ga0070665_100241978 3300005548 Bacteria 1805
24 Ga0068855_100066806 3300005563 Bacteria 4192
25 Ga0068855_100458085 3300005563 Unclassified 1391
26 Ga0070664_100024349 3300005564 Bacteria 5006
27 Ga0070664_100168339 3300005564 Bacteria 1943
28 Ga0068857_100058198 3300005577 Bacteria 3431
29 Ga0068856_100004001 3300005614 Bacteria 14757
30 Ga0068856_100102032 3300005614 Bacteria 2862
31 Ga0068856_100435376 3300005614 Bacteria 1331
32 Ga0068864_100022994 3300005618 Bacteria 5231
33 Ga0068864_100137724 3300005618 Bacteria 2199
34 Ga0068866_10715099 3300005718 Bacteria 688
35 Ga0068863_100004839 3300005841 Bacteria 13260
36 Ga0068858_100617987 3300005842 Bacteria 1052
37 Ga0068858_100688184 3300005842 Bacteria 995
38 Ga0068862_100032077 3300005844 Bacteria 4438
39 Ga0070717_10033098 3300006028 Bacteria 4168
40 Ga0070717_10279331 3300006028 Bacteria 1481
41 Ga0070717_11276831 3300006028 Bacteria 668
42 Ga0070717_11425875 3300006028 Unclassified 629
43 Ga0070715_10038861 3300006163 Unclassified 1978
44 Ga0070715_10040951 3300006163 Bacteria 1939
45 Ga0070716_100023603 3300006173 Unclassified 3263
46 Ga0070716_100119867 3300006173 Bacteria 1645
47 Ga0070716_100234042 3300006173 Unclassified 1242
48 Ga0070712_100006911 3300006175 Bacteria 7070
49 Ga0070712_100035482 3300006175 Unclassified 3385
50 Ga0068871_100903379 3300006358 Bacteria 819
51 Ga0068871_101387110 3300006358 Bacteria 662
52 Ga0075436_100182218 3300006914 Bacteria 1484
53 Ga0105240_10113561 3300009093 Bacteria 3273
54 Ga0105245_10000869 3300009098 Bacteria 27383
55 Ga0105241_10057134 3300009174 Bacteria 2993
56 Ga0105248_11881941 3300009177 Bacteria 679
57 Ga0105237_10015737 3300009545 Bacteria 7865
58 Ga0105238_10055595 3300009551 Unclassified 3972
59 Ga0105239_10015113 3300010375 Bacteria 8558
60 Ga0105239_11536516 3300010375 Unclassified 769
61 Ga0157369_10528449 3300013105 Bacteria 1220
62 Ga0157374_10213546 3300013296 Bacteria 1892
63 Ga0157374_10635637 3300013296 Bacteria 1078
64 Ga0157372_11025342 3300013307 Bacteria 955
65 Ga0163163_10007731 3300014325 Bacteria 9498
66 Ga0163163_10017193 3300014325 Bacteria 6740
67 Ga0163163_10407856 3300014325 Bacteria 1417
68 Ga0163163_10496607 3300014325 Bacteria 1282
69 Ga0163163_10649049 3300014325 Bacteria 1119
70 Ga0157379_10011503 3300014968 Bacteria 7724
71 Ga0157379_10093757 3300014968 Bacteria 2694
72 Ga0157376_10839747 3300014969 Bacteria 933
73 Ga0157376_11290677 3300014969 Bacteria 760
74 Ga0207692_10002633 3300025898 Bacteria 6903
75 Ga0207692_10273038 3300025898 Bacteria 1020
76 Ga0207688_10000141 3300025901 Bacteria 30619
77 Ga0207685_10048806 3300025905 Unclassified 1623
78 Ga0207685_10070764 3300025905 Bacteria 1413
79 Ga0207699_10000327 3300025906 Bacteria 25260
80 Ga0207699_10030006 3300025906 Bacteria 3039
81 Ga0207699_10737647 3300025906 Bacteria 722
82 Ga0207707_10462037 3300025912 Bacteria 1085
83 Ga0207695_10168070 3300025913 Bacteria 2120
84 Ga0207671_10073422 3300025914 Bacteria 2555
85 Ga0207693_10000160 3300025915 Bacteria 62687
86 Ga0207693_10002319 3300025915 Bacteria 16545
87 Ga0207663_10003219 3300025916 Bacteria 7954
88 Ga0207663_10011633 3300025916 Bacteria 4733
89 Ga0207657_10089852 3300025919 Bacteria 2564
90 Ga0207649_10646824 3300025920 Bacteria 817
91 Ga0207650_10081669 3300025925 Bacteria 2452
92 Ga0207700_10001825 3300025928 Bacteria 12078
93 Ga0207700_10024393 3300025928 Bacteria 4185
94 Ga0207700_10091661 3300025928 Unclassified 2401
95 Ga0207664_10000017 3300025929 Bacteria 230967
96 Ga0207664_10067410 3300025929 Bacteria 2872
97 Ga0207664_10296162 3300025929 Unclassified 1422
98 Ga0207664_10334091 3300025929 Bacteria 1339
99 Ga0207670_10107511 3300025936 Bacteria 2003
100 Ga0207665_10018764 3300025939 Unclassified 4545
101 Ga0207665_10430103 3300025939 Bacteria 1010
102 Ga0207661_10689735 3300025944 Unclassified 939
103 Ga0207667_10184125 3300025949 Bacteria 2144
104 Ga0207667_10208518 3300025949 Bacteria 2003
105 Ga0207702_10012302 3300026078 Bacteria 7123
106 Ga0207702_10354638 3300026078 Bacteria 1404
107 Ga0207702_10377390 3300026078 Bacteria 1363
108 Ga0207702_10392817 3300026078 Bacteria 1336
109 Ga0207641_10030052 3300026088 Bacteria 4498
110 Ga0207641_10816270 3300026088 Bacteria 923
111 Ga0207676_10091838 3300026095 Bacteria 2495
112 Ga0207676_10549800 3300026095 Bacteria 1103
113 Ga0207674_10045908 3300026116 Bacteria 4490
114 Ga0207683_10260193 3300026121 Bacteria 1584
115 Ga0207698_10179919 3300026142 Unclassified 1872
116 Ga0268266_10199531 3300028379 Bacteria 1830
117 Ga0268266_10456824 3300028379 Bacteria 1215
118 Ga0268264_10461642 3300028381 Bacteria 1232
119 Ga0265326_10000800 3300028558 Bacteria 11642
120 Ga0265318_10019636 3300028577 Bacteria 2739
121 Ga0265323_10061884 3300028653 Bacteria 1300
122 Ga0265322_10053241 3300028654 Bacteria 1148
123 Ga0265336_10022640 3300028666 Bacteria 1999
124 Ga0265338_10003792 3300028800 Bacteria 21011
125 Ga0265338_10004299 3300028800 Bacteria 19334
126 Ga0265338_10013784 3300028800 Bacteria 9085
127 Ga0265338_10055647 3300028800 Bacteria 3517
128 Ga0265338_10062227 3300028800 Bacteria 3263
129 Ga0265338_10098466 3300028800 Bacteria 2392
130 Ga0265338_10570909 3300028800 Unclassified 790
131 Ga0265330_10001011 3300031235 Bacteria 17072
132 Ga0265330_10082921 3300031235 Bacteria 1380
133 Ga0265332_10009475 3300031238 Bacteria 4345
134 Ga0265332_10070281 3300031238 Bacteria 1492
135 Ga0265328_10129254 3300031239 Bacteria 945
136 Ga0265320_10004173 3300031240 Bacteria 9493
137 Ga0265320_10083296 3300031240 Bacteria 1491
138 Ga0265325_10002504 3300031241 Bacteria 12376
139 Ga0265325_10005772 3300031241 Bacteria 7591
140 Ga0265325_10053111 3300031241 Bacteria 2078
141 Ga0265329_10054902 3300031242 Bacteria 1264
142 Ga0265340_10004079 3300031247 Bacteria 8206
143 Ga0265340_10083498 3300031247 Bacteria 1501
144 Ga0265340_10202620 3300031247 Bacteria 892
145 Ga0265339_10002113 3300031249 Bacteria 14479
146 Ga0265339_10015547 3300031249 Bacteria 4559
147 Ga0265339_10031198 3300031249 Bacteria 3012
148 Ga0265339_10254167 3300031249 Bacteria 849
149 Ga0265331_10007927 3300031250 Bacteria 6081
150 Ga0265331_10113165 3300031250 Bacteria 1244
151 Ga0265331_10143069 3300031250 Bacteria 1087
152 Ga0265316_10001130 3300031344 Bacteria 28937
153 Ga0265316_10004969 3300031344 Bacteria 13060
154 Ga0265316_10010255 3300031344 Bacteria 8550
155 Ga0265316_10054475 3300031344 Bacteria 3131
156 Ga0265316_10056287 3300031344 Unclassified 3073
157 Ga0265316_10070964 3300031344 Bacteria 2686
158 Ga0265316_10095236 3300031344 Unclassified 2268
159 Ga0265316_10211892 3300031344 Bacteria 1432
160 Ga0265316_10258386 3300031344 Bacteria 1278
161 Ga0265316_10292601 3300031344 Unclassified 1188
162 Ga0265316_10580030 3300031344 Bacteria 796
163 Ga0307408_100146787 3300031548 Bacteria 1858
164 Ga0265314_10001611 3300031711 Bacteria 24771
165 Ga0265314_10013908 3300031711 Bacteria 6473
166 Ga0265314_10028434 3300031711 Bacteria 4168
167 Ga0265314_10030087 3300031711 Bacteria 4024
168 Ga0265314_10078063 3300031711 Bacteria 2194
169 Ga0265314_10181959 3300031711 Bacteria 1259
170 Ga0265314_10209133 3300031711 Bacteria 1147
171 Ga0265342_10023836 3300031712 Bacteria 3867
172 Ga0265342_10068020 3300031712 Bacteria 2083
173 Ga0316578_10075577 3300031728 Bacteria 1999
174 Ga0316578_10192361 3300031728 Bacteria 1229
175 Ga0316577_10006294 3300031733 Bacteria 6262
176 Ga0316577_10027499 3300031733 Archaea 3171
177 Ga0316577_10077363 3300031733 Bacteria 1858
178 Ga0307407_10387920 3300031903 Bacteria 999
179 Ga0307409_101158980 3300031995 Bacteria 795
180 Ga0316583_10037815 3300032133 Archaea 1711
181 Ga0316585_10054533 3300032137 Unclassified 1286
182 Ga0316580_10105969 3300032139 Bacteria 861
183 Ga0316580_10189893 3300032139 Bacteria 632
184 Ga0316593_10012035 3300032168 Bacteria 2531
185 Ga0316593_10115332 3300032168 Bacteria 962
186 Ga0316593_10321286 3300032168 Bacteria 589
187 Ga0316588_1025777 3300033528 Bacteria 1360
188 Ga0373934_0002753 3300035086 Bacteria 6450
189 Ga0373934_0018033 3300035086 Bacteria 2700
190 Ga0373923_0020430 3300035111 Bacteria 2573
191 Ga0373923_0021254 3300035111 Bacteria 2531
192 Ga0373923_0049433 3300035111 Bacteria 1759
193 Ga0373945_0005071 3300035116 Bacteria 4198
194 Ga0373953_0017715 3300035117 Bacteria 2623
195 Ga0373954_0000203 3300035118 Bacteria 21693
196 Ga0373954_0012949 3300035118 Bacteria 3714
197 Ga0373954_0132175 3300035118 Bacteria 1215
198 Ga0373956_0098889 3300035119 Bacteria 1351
199 Ga0373943_0001742 3300035170 Bacteria 9871
200 Ga0373943_0023306 3300035170 Unclassified 2878
201 Ga0373946_0024904 3300035171 Bacteria 2350
202 Ga0373946_0088841 3300035171 Bacteria 1366
203 Ga0373955_0001502 3300035172 Bacteria 9937
204 Ga0373955_0013474 3300035172 Bacteria 3956
205 Ga0373955_0174034 3300035172 Bacteria 1275
206 Ga0316574_0175723 3300035398 Bacteria 1378
207 Ga0373924_0007288 3300035410 Bacteria 3988
208 Ga0373924_0025518 3300035410 Bacteria 2337
209 Ga0373935_0041029 3300035692 Bacteria 2906
210 Ga0373935_0075396 3300035692 Bacteria 2182
211 Ga0373927_0000085 3300035695 Bacteria 70359
212 Ga0373933_0002456 3300035724 Bacteria 10430
213 Ga0373933_0078602 3300035724 Bacteria 2019
214 Ga0373933_0080731 3300035724 Bacteria 1994
215 Ga0373933_0196028 3300035724 Unclassified 1291
216 Ga0373947_0000284 3300035725 Bacteria 28729
217 Ga0373937_0003494 3300036401 Bacteria 13218
218 Ga0373937_0009518 3300036401 Bacteria 8448
219 Ga0373937_0031973 3300036401 Bacteria 4771
220 Ga0373937_0062085 3300036401 Bacteria 3435
221 Ga0373937_0077922 3300036401 Bacteria 3062
222 Ga0373937_0115706 3300036401 Unclassified 2497
223 Ga0373937_0131508 3300036401 Bacteria 2337
224 Ga0316582_0019715 3300036647 Bacteria 3954
225 Ga0316582_0050725 3300036647 Unclassified 2630
226 Ga0316582_0072195 3300036647 Unclassified 2237
227 Ga0316582_0312800 3300036647 Bacteria 1079
228 Ga0316582_1047610 3300036647 Bacteria 556
229 Ga0316584_0010617 3300036712 Bacteria 6444
230 Ga0316584_0071998 3300036712 Bacteria 2590
231 Ga0316584_0104098 3300036712 Bacteria 2125
232 Ga0373925_0001042 3300037068 Bacteria 25115
233 Ga0373925_0170408 3300037068 Bacteria 1719
234 Ga0436364_0478215 3300037853 Bacteria 1367
235 Ga0436360_0788754 3300039438 Unclassified 638
236 Ga0436362_0017988 3300039453 Bacteria 568
237 Ga0451577_0001746 3300042876 Bacteria 28024
238 Ga0451577_0116636 3300042876 Bacteria 2392
239 Ga0451577_0546728 3300042876 Bacteria 1051
240 Ga0451577_1034648 3300042876 Bacteria 737
241 Ga0453684_0001779 3300044712 Bacteria 57517
242 Ga0453684_0012641 3300044712 Bacteria 13880
243 Ga0453684_0194216 3300044712 Unclassified 2372
244 Ga0453684_0270511 3300044712 Archaea 1942
245 Ga0453684_0391288 3300044712 Bacteria 1559
246 Ga0466957_0009485 3300044842 Bacteria 5558
247 Ga0495592_0070317 3300046454 Unclassified 2550
248 Ga0495592_0131766 3300046454 Bacteria 1748
249 Ga0495603_0145690 3300046455 Unclassified 1377
250 Ga0495629_0015575 3300046459 Bacteria 5458
251 Ga0495651_0036150 3300046462 Bacteria 3845
252 Ga0495653_0056719 3300046463 Bacteria 2984
253 Ga0495653_0094425 3300046463 Bacteria 2179
254 Ga0495580_0005576 3300046472 Bacteria 10373
255 Ga0495580_0065581 3300046472 Bacteria 2543
256 Ga0495580_0265074 3300046472 Bacteria 1174
257 Ga0495582_0001074 3300046473 Bacteria 15354
258 Ga0495664_0001323 3300046477 Bacteria 13014
259 Ga0495664_0161514 3300046477 Bacteria 1359
260 Ga0495584_0379330 3300046491 Bacteria 718
261 Ga0495608_0013442 3300046511 Bacteria 5677
262 Ga0495608_0574623 3300046511 Bacteria 678
263 Ga0495628_0030561 3300046516 Bacteria 4361
264 Ga0495630_0191936 3300046517 Bacteria 1558
265 Ga0495666_0227566 3300046526 Unclassified 853
266 Ga0495652_0062429 3300046529 Unclassified 3142
267 Ga0495652_0151457 3300046529 Bacteria 1812
268 Ga0495665_0053092 3300046531 Bacteria 2145
269 Ga0495665_0089496 3300046531 Unclassified 1617
270 Ga0495665_0458311 3300046531 Bacteria 644
271 Ga0495586_0125122 3300046535 Bacteria 1438
272 Ga0495586_0150282 3300046535 Bacteria 1310
273 Ga0495587_0004956 3300046536 Bacteria 8728
274 Ga0495635_0060187 3300046663 Bacteria 2611
275 Ga0495635_0297992 3300046663 Bacteria 1081
276 Ga0495657_0058437 3300046675 Bacteria 2561
277 Ga0495657_0414686 3300046675 Bacteria 791
278 Ga0495623_0018934 3300046679 Bacteria 4445
279 Ga0495658_0034683 3300046683 Unclassified 2770
280 Ga0495669_0001489 3300046684 Bacteria 9652
281 Ga0495669_0338092 3300046684 Bacteria 727
282 Ga0495613_0368572 3300046689 Unclassified 984
283 Ga0495624_0093331 3300046690 Bacteria 1856
284 Ga0495624_0196991 3300046690 Bacteria 1224
285 Ga0495581_0014429 3300047315 Unclassified 4582
286 Ga0495604_0004923 3300047317 Bacteria 10592
287 Ga0495604_0305110 3300047317 Bacteria 1068
288 Ga0495674_0012895 3300047319 Bacteria 7871
289 Ga0495684_0002027 3300047471 Bacteria 16297
290 Ga0495684_0182746 3300047471 Bacteria 1554
291 Ga0495602_0012156 3300048088 Bacteria 8864
292 Ga0496101_0248673 3300048904 Unclassified 1385
293 Ga0496105_0038255 3300048908 Bacteria 3952
294 Ga0496115_0027382 3300048918 Unclassified 4457
295 Ga0501325_018320 3300049541 Bacteria 716
296 Ga0501039_0513079 3300049575 Bacteria 941
297 nmdc:mga05p37_23989_c1 3300050507 Bacteria 7408
298 nmdc:mga08x19_225406_c1 3300050514 Bacteria 1289
299 Ga0495619_0023670 3300053085 Bacteria 3939
300 Ga0495619_0057196 3300053085 Bacteria 2587
301 Ga0501082_0000235 3300060353 Bacteria 48331
302 Ga0501082_0022096 3300060353 Bacteria 5484
303 Ga0501082_0942483 3300060353 Bacteria 755

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036647 Ga0316582_1047610 Ga0316582_1047610_27_506 157
2 3300031548 Ga0307408_100146787 Ga0307408_1001467873 165
3 3300031903 Ga0307407_10387920 Ga0307407_103879202 165
4 3300049541 Ga0501325_018320 Ga0501325_018320_122_655 165
5 3300031995 Ga0307409_101158980 Ga0307409_1011589801 169
6 3300031733 Ga0316577_10077363 Ga0316577_100773632 172
7 3300032137 Ga0316585_10054533 Ga0316585_100545332 172
8 3300032168 Ga0316593_10012035 Ga0316593_100120352 172
9 3300005434 Ga0070709_10552695 Ga0070709_105526952 173
10 3300005439 Ga0070711_100336332 Ga0070711_1003363322 173
11 3300025906 Ga0207699_10737647 Ga0207699_107376471 173
12 3300005436 Ga0070713_101242647 Ga0070713_1012426472 174
13 3300014969 Ga0157376_10839747 Ga0157376_108397472 174
14 3300039453 Ga0436362_0017988 Ga0436362_0017988_16_546 174
15 3300060353 Ga0501082_0022096 Ga0501082_0022096_3090_3620 174
16 3300005548 Ga0070665_100041419 Ga0070665_1000414192 175
17 3300005563 Ga0068855_100458085 Ga0068855_1004580852 175
18 3300005614 Ga0068856_100102032 Ga0068856_1001020322 175
19 3300005718 Ga0068866_10715099 Ga0068866_107150991 175
20 3300005842 Ga0068858_100688184 Ga0068858_1006881842 175
21 3300006028 Ga0070717_10279331 Ga0070717_102793312 175
22 3300013296 Ga0157374_10635637 Ga0157374_106356372 175
23 3300026078 Ga0207702_10377390 Ga0207702_103773902 175
24 3300026142 Ga0207698_10179919 Ga0207698_101799193 175
25 3300028379 Ga0268266_10199531 Ga0268266_101995312 175
26 3300031344 Ga0265316_10056287 Ga0265316_100562873 175
27 3300031733 Ga0316577_10027499 Ga0316577_100274993 175
28 3300032133 Ga0316583_10037815 Ga0316583_100378153 175
29 3300036647 Ga0316582_0050725 Ga0316582_0050725_206_748 175
30 3300036647 Ga0316582_0072195 Ga0316582_0072195_948_1490 175
31 3300044712 Ga0453684_0270511 Ga0453684_0270511_804_1340 175
32 3300060353 Ga0501082_0000235 Ga0501082_0000235_32903_33430 175
33 3300005331 Ga0070670_100246663 Ga0070670_1002466632 176
34 3300005339 Ga0070660_100655206 Ga0070660_1006552061 176
35 3300005435 Ga0070714_100091795 Ga0070714_1000917953 176
36 3300005435 Ga0070714_100507266 Ga0070714_1005072662 176
37 3300005435 Ga0070714_100845382 Ga0070714_1008453822 176
38 3300005436 Ga0070713_100001364 Ga0070713_10000136411 176
39 3300005436 Ga0070713_100048522 Ga0070713_1000485222 176
40 3300005436 Ga0070713_100529697 Ga0070713_1005296972 176
41 3300005437 Ga0070710_10039722 Ga0070710_100397223 176
42 3300005439 Ga0070711_100001326 Ga0070711_1000013266 176
43 3300005439 Ga0070711_101268107 Ga0070711_1012681071 176
44 3300005456 Ga0070678_100218080 Ga0070678_1002180802 176
45 3300005535 Ga0070684_100064936 Ga0070684_1000649363 176
46 3300005548 Ga0070665_100241978 Ga0070665_1002419783 176
47 3300005563 Ga0068855_100066806 Ga0068855_1000668064 176
48 3300005564 Ga0070664_100168339 Ga0070664_1001683392 176
49 3300005577 Ga0068857_100058198 Ga0068857_1000581983 176
50 3300005614 Ga0068856_100004001 Ga0068856_1000040018 176
51 3300005614 Ga0068856_100435376 Ga0068856_1004353762 176
52 3300005618 Ga0068864_100137724 Ga0068864_1001377242 176
53 3300005841 Ga0068863_100004839 Ga0068863_1000048395 176
54 3300005842 Ga0068858_100617987 Ga0068858_1006179872 176
55 3300006028 Ga0070717_10033098 Ga0070717_100330981 176
56 3300006028 Ga0070717_11276831 Ga0070717_112768311 176
57 3300006028 Ga0070717_11425875 Ga0070717_114258751 176
58 3300006163 Ga0070715_10038861 Ga0070715_100388612 176
59 3300006163 Ga0070715_10040951 Ga0070715_100409512 176
60 3300006173 Ga0070716_100023603 Ga0070716_1000236032 176
61 3300006173 Ga0070716_100119867 Ga0070716_1001198671 176
62 3300006173 Ga0070716_100234042 Ga0070716_1002340422 176
63 3300006175 Ga0070712_100006911 Ga0070712_1000069115 176
64 3300006175 Ga0070712_100035482 Ga0070712_1000354822 176
65 3300006358 Ga0068871_100903379 Ga0068871_1009033791 176
66 3300006358 Ga0068871_101387110 Ga0068871_1013871101 176
67 3300006914 Ga0075436_100182218 Ga0075436_1001822182 176
68 3300009093 Ga0105240_10113561 Ga0105240_101135612 176
69 3300009174 Ga0105241_10057134 Ga0105241_100571343 176
70 3300009177 Ga0105248_11881941 Ga0105248_118819412 176
71 3300009545 Ga0105237_10015737 Ga0105237_100157374 176
72 3300009551 Ga0105238_10055595 Ga0105238_100555953 176
73 3300010375 Ga0105239_10015113 Ga0105239_100151132 176
74 3300013105 Ga0157369_10528449 Ga0157369_105284492 176
75 3300013307 Ga0157372_11025342 Ga0157372_110253422 176
76 3300014325 Ga0163163_10007731 Ga0163163_100077316 176
77 3300014325 Ga0163163_10017193 Ga0163163_100171932 176
78 3300014325 Ga0163163_10407856 Ga0163163_104078561 176
79 3300014325 Ga0163163_10496607 Ga0163163_104966072 176
80 3300014325 Ga0163163_10649049 Ga0163163_106490492 176
81 3300014968 Ga0157379_10011503 Ga0157379_100115039 176
82 3300014968 Ga0157379_10093757 Ga0157379_100937573 176
83 3300014969 Ga0157376_11290677 Ga0157376_112906772 176
84 3300025898 Ga0207692_10002633 Ga0207692_100026333 176
85 3300025898 Ga0207692_10273038 Ga0207692_102730382 176
86 3300025905 Ga0207685_10048806 Ga0207685_100488062 176
87 3300025905 Ga0207685_10070764 Ga0207685_100707642 176
88 3300025906 Ga0207699_10000327 Ga0207699_1000032715 176
89 3300025906 Ga0207699_10030006 Ga0207699_100300062 176
90 3300025912 Ga0207707_10462037 Ga0207707_104620372 176
91 3300025913 Ga0207695_10168070 Ga0207695_101680703 176
92 3300025914 Ga0207671_10073422 Ga0207671_100734223 176
93 3300025915 Ga0207693_10000160 Ga0207693_1000016028 176
94 3300025915 Ga0207693_10002319 Ga0207693_1000231912 176
95 3300025916 Ga0207663_10003219 Ga0207663_100032192 176
96 3300025919 Ga0207657_10089852 Ga0207657_100898523 176
97 3300025920 Ga0207649_10646824 Ga0207649_106468242 176
98 3300025925 Ga0207650_10081669 Ga0207650_100816692 176
99 3300025928 Ga0207700_10001825 Ga0207700_100018253 176
100 3300025928 Ga0207700_10024393 Ga0207700_100243932 176
101 3300025928 Ga0207700_10091661 Ga0207700_100916613 176
102 3300025929 Ga0207664_10067410 Ga0207664_100674103 176
103 3300025929 Ga0207664_10296162 Ga0207664_102961622 176
104 3300025929 Ga0207664_10334091 Ga0207664_103340912 176
105 3300025939 Ga0207665_10018764 Ga0207665_100187643 176
106 3300025939 Ga0207665_10430103 Ga0207665_104301032 176
107 3300025944 Ga0207661_10689735 Ga0207661_106897352 176
108 3300025949 Ga0207667_10184125 Ga0207667_101841252 176
109 3300025949 Ga0207667_10208518 Ga0207667_102085181 176
110 3300026078 Ga0207702_10012302 Ga0207702_100123025 176
111 3300026078 Ga0207702_10354638 Ga0207702_103546382 176
112 3300026078 Ga0207702_10392817 Ga0207702_103928172 176
113 3300026088 Ga0207641_10030052 Ga0207641_100300521 176
114 3300026088 Ga0207641_10816270 Ga0207641_108162701 176
115 3300026095 Ga0207676_10091838 Ga0207676_100918383 176
116 3300026095 Ga0207676_10549800 Ga0207676_105498002 176
117 3300026116 Ga0207674_10045908 Ga0207674_100459083 176
118 3300026121 Ga0207683_10260193 Ga0207683_102601932 176
119 3300028379 Ga0268266_10456824 Ga0268266_104568242 176
120 3300028381 Ga0268264_10461642 Ga0268264_104616422 176
121 3300028558 Ga0265326_10000800 Ga0265326_100008002 176
122 3300028577 Ga0265318_10019636 Ga0265318_100196362 176
123 3300028653 Ga0265323_10061884 Ga0265323_100618842 176
124 3300028654 Ga0265322_10053241 Ga0265322_100532412 176
125 3300028666 Ga0265336_10022640 Ga0265336_100226402 176
126 3300028800 Ga0265338_10004299 Ga0265338_100042992 176
127 3300028800 Ga0265338_10055647 Ga0265338_100556473 176
128 3300028800 Ga0265338_10062227 Ga0265338_100622273 176
129 3300028800 Ga0265338_10570909 Ga0265338_105709092 176
130 3300031235 Ga0265330_10001011 Ga0265330_100010118 176
131 3300031235 Ga0265330_10082921 Ga0265330_100829212 176
132 3300031238 Ga0265332_10009475 Ga0265332_100094752 176
133 3300031238 Ga0265332_10070281 Ga0265332_100702812 176
134 3300031239 Ga0265328_10129254 Ga0265328_101292542 176
135 3300031240 Ga0265320_10004173 Ga0265320_1000417310 176
136 3300031240 Ga0265320_10083296 Ga0265320_100832962 176
137 3300031241 Ga0265325_10005772 Ga0265325_100057722 176
138 3300031241 Ga0265325_10053111 Ga0265325_100531112 176
139 3300031242 Ga0265329_10054902 Ga0265329_100549023 176
140 3300031247 Ga0265340_10004079 Ga0265340_100040797 176
141 3300031247 Ga0265340_10083498 Ga0265340_100834982 176
142 3300031249 Ga0265339_10002113 Ga0265339_100021136 176
143 3300031249 Ga0265339_10015547 Ga0265339_100155474 176
144 3300031249 Ga0265339_10254167 Ga0265339_102541671 176
145 3300031250 Ga0265331_10007927 Ga0265331_100079275 176
146 3300031250 Ga0265331_10113165 Ga0265331_101131651 176
147 3300031250 Ga0265331_10143069 Ga0265331_101430692 176
148 3300031344 Ga0265316_10001130 Ga0265316_100011308 176
149 3300031344 Ga0265316_10004969 Ga0265316_100049696 176
150 3300031344 Ga0265316_10054475 Ga0265316_100544753 176
151 3300031344 Ga0265316_10070964 Ga0265316_100709643 176
152 3300031344 Ga0265316_10095236 Ga0265316_100952363 176
153 3300031344 Ga0265316_10211892 Ga0265316_102118922 176
154 3300031344 Ga0265316_10258386 Ga0265316_102583862 176
155 3300031344 Ga0265316_10292601 Ga0265316_102926012 176
156 3300031344 Ga0265316_10580030 Ga0265316_105800301 176
157 3300031711 Ga0265314_10001611 Ga0265314_100016114 176
158 3300031711 Ga0265314_10013908 Ga0265314_100139082 176
159 3300031711 Ga0265314_10028434 Ga0265314_100284342 176
160 3300031711 Ga0265314_10030087 Ga0265314_100300874 176
161 3300031711 Ga0265314_10078063 Ga0265314_100780631 176
162 3300031711 Ga0265314_10181959 Ga0265314_101819592 176
163 3300031711 Ga0265314_10209133 Ga0265314_102091332 176
164 3300031712 Ga0265342_10023836 Ga0265342_100238363 176
165 3300031712 Ga0265342_10068020 Ga0265342_100680202 176
166 3300031728 Ga0316578_10075577 Ga0316578_100755773 176
167 3300031728 Ga0316578_10192361 Ga0316578_101923612 176
168 3300031733 Ga0316577_10006294 Ga0316577_100062945 176
169 3300032139 Ga0316580_10105969 Ga0316580_101059692 176
170 3300032139 Ga0316580_10189893 Ga0316580_101898931 176
171 3300035086 Ga0373934_0002753 Ga0373934_0002753_4206_4850 176
172 3300035111 Ga0373923_0020430 Ga0373923_0020430_1633_2166 176
173 3300035111 Ga0373923_0049433 Ga0373923_0049433_754_1284 176
174 3300035117 Ga0373953_0017715 Ga0373953_0017715_1256_1786 176
175 3300035118 Ga0373954_0000203 Ga0373954_0000203_2796_3326 176
176 3300035118 Ga0373954_0132175 Ga0373954_0132175_293_826 176
177 3300035170 Ga0373943_0023306 Ga0373943_0023306_2258_2788 176
178 3300035172 Ga0373955_0001502 Ga0373955_0001502_7140_7784 176
179 3300035398 Ga0316574_0175723 Ga0316574_0175723_178_723 176
180 3300035410 Ga0373924_0025518 Ga0373924_0025518_1515_2045 176
181 3300035692 Ga0373935_0041029 Ga0373935_0041029_2255_2788 176
182 3300035692 Ga0373935_0075396 Ga0373935_0075396_861_1391 176
183 3300035724 Ga0373933_0002456 Ga0373933_0002456_1778_2422 176
184 3300035724 Ga0373933_0078602 Ga0373933_0078602_973_1506 176
185 3300036401 Ga0373937_0003494 Ga0373937_0003494_4451_4984 176
186 3300036401 Ga0373937_0009518 Ga0373937_0009518_4915_5445 176
187 3300036401 Ga0373937_0115706 Ga0373937_0115706_962_1492 176
188 3300036401 Ga0373937_0131508 Ga0373937_0131508_1048_1578 176
189 3300036647 Ga0316582_0019715 Ga0316582_0019715_704_1249 176
190 3300036647 Ga0316582_0312800 Ga0316582_0312800_427_963 176
191 3300036712 Ga0316584_0010617 Ga0316584_0010617_686_1216 176
192 3300036712 Ga0316584_0071998 Ga0316584_0071998_1217_1762 176
193 3300036712 Ga0316584_0104098 Ga0316584_0104098_79_624 176
194 3300037068 Ga0373925_0170408 Ga0373925_0170408_887_1420 176
195 3300037853 Ga0436364_0478215 Ga0436364_0478215_386_919 176
196 3300039438 Ga0436360_0788754 Ga0436360_0788754_25_555 176
197 3300042876 Ga0451577_0001746 Ga0451577_0001746_18185_18715 176
198 3300042876 Ga0451577_0116636 Ga0451577_0116636_1417_1947 176
199 3300042876 Ga0451577_0546728 Ga0451577_0546728_321_851 176
200 3300042876 Ga0451577_1034648 Ga0451577_1034648_15_545 176
201 3300044712 Ga0453684_0001779 Ga0453684_0001779_43885_44415 176
202 3300044712 Ga0453684_0194216 Ga0453684_0194216_95_625 176
203 3300044712 Ga0453684_0391288 Ga0453684_0391288_311_841 176
204 3300046454 Ga0495592_0070317 Ga0495592_0070317_1637_2167 176
205 3300046455 Ga0495603_0145690 Ga0495603_0145690_662_1192 176
206 3300046459 Ga0495629_0015575 Ga0495629_0015575_3585_4115 176
207 3300046462 Ga0495651_0036150 Ga0495651_0036150_1880_2410 176
208 3300046463 Ga0495653_0094425 Ga0495653_0094425_72_716 176
209 3300046472 Ga0495580_0005576 Ga0495580_0005576_4195_4725 176
210 3300046472 Ga0495580_0065581 Ga0495580_0065581_1256_1786 176
211 3300046472 Ga0495580_0265074 Ga0495580_0265074_286_816 176
212 3300046473 Ga0495582_0001074 Ga0495582_0001074_2390_2920 176
213 3300046477 Ga0495664_0161514 Ga0495664_0161514_693_1223 176
214 3300046491 Ga0495584_0379330 Ga0495584_0379330_73_603 176
215 3300046511 Ga0495608_0013442 Ga0495608_0013442_1930_2460 176
216 3300046526 Ga0495666_0227566 Ga0495666_0227566_260_790 176
217 3300046529 Ga0495652_0062429 Ga0495652_0062429_204_848 176
218 3300046529 Ga0495652_0151457 Ga0495652_0151457_752_1282 176
219 3300046531 Ga0495665_0053092 Ga0495665_0053092_786_1316 176
220 3300046531 Ga0495665_0089496 Ga0495665_0089496_959_1489 176
221 3300046531 Ga0495665_0458311 Ga0495665_0458311_34_564 176
222 3300046535 Ga0495586_0150282 Ga0495586_0150282_407_937 176
223 3300046536 Ga0495587_0004956 Ga0495587_0004956_185_829 176
224 3300046663 Ga0495635_0297992 Ga0495635_0297992_145_675 176
225 3300046675 Ga0495657_0058437 Ga0495657_0058437_1310_1954 176
226 3300046675 Ga0495657_0414686 Ga0495657_0414686_122_652 176
227 3300046679 Ga0495623_0018934 Ga0495623_0018934_2842_3372 176
228 3300046683 Ga0495658_0034683 Ga0495658_0034683_1318_1848 176
229 3300046684 Ga0495669_0001489 Ga0495669_0001489_5372_5902 176
230 3300046684 Ga0495669_0338092 Ga0495669_0338092_90_620 176
231 3300046689 Ga0495613_0368572 Ga0495613_0368572_44_574 176
232 3300046690 Ga0495624_0093331 Ga0495624_0093331_926_1456 176
233 3300047315 Ga0495581_0014429 Ga0495581_0014429_97_627 176
234 3300047317 Ga0495604_0004923 Ga0495604_0004923_3537_4181 176
235 3300047317 Ga0495604_0305110 Ga0495604_0305110_426_956 176
236 3300047319 Ga0495674_0012895 Ga0495674_0012895_5569_6099 176
237 3300047471 Ga0495684_0002027 Ga0495684_0002027_1742_2272 176
238 3300047471 Ga0495684_0182746 Ga0495684_0182746_190_720 176
239 3300048088 Ga0495602_0012156 Ga0495602_0012156_6745_7275 176
240 3300048904 Ga0496101_0248673 Ga0496101_0248673_714_1244 176
241 3300048908 Ga0496105_0038255 Ga0496105_0038255_2482_3012 176
242 3300048918 Ga0496115_0027382 Ga0496115_0027382_360_890 176
243 3300049575 Ga0501039_0513079 Ga0501039_0513079_47_586 176
244 3300050514 nmdc:mga08x19_225406_c1 nmdc:mga08x19_225406_c1_346_876 176
245 3300053085 Ga0495619_0023670 Ga0495619_0023670_780_1310 176
246 3300053085 Ga0495619_0057196 Ga0495619_0057196_702_1232 176
247 3300060353 Ga0501082_0942483 Ga0501082_0942483_142_681 176
248 3300001991 JGI24743J22301_10004556 JGI24743J22301_100045562 177
249 3300005331 Ga0070670_100029946 Ga0070670_1000299465 177
250 3300005344 Ga0070661_100027869 Ga0070661_1000278694 177
251 3300005439 Ga0070711_100034459 Ga0070711_1000344595 177
252 3300005455 Ga0070663_100041585 Ga0070663_1000415852 177
253 3300005564 Ga0070664_100024349 Ga0070664_1000243495 177
254 3300005618 Ga0068864_100022994 Ga0068864_1000229946 177
255 3300005844 Ga0068862_100032077 Ga0068862_1000320776 177
256 3300009098 Ga0105245_10000869 Ga0105245_1000086922 177
257 3300010375 Ga0105239_11536516 Ga0105239_115365162 177
258 3300013296 Ga0157374_10213546 Ga0157374_102135462 177
259 3300025901 Ga0207688_10000141 Ga0207688_100001419 177
260 3300025916 Ga0207663_10011633 Ga0207663_100116333 177
261 3300025929 Ga0207664_10000017 Ga0207664_10000017146 177
262 3300025936 Ga0207670_10107511 Ga0207670_101075112 177
263 3300028800 Ga0265338_10003792 Ga0265338_100037922 177
264 3300028800 Ga0265338_10013784 Ga0265338_100137843 177
265 3300028800 Ga0265338_10098466 Ga0265338_100984663 177
266 3300031241 Ga0265325_10002504 Ga0265325_100025043 177
267 3300031247 Ga0265340_10202620 Ga0265340_102026201 177
268 3300031249 Ga0265339_10031198 Ga0265339_100311983 177
269 3300031344 Ga0265316_10010255 Ga0265316_100102556 177
270 3300032168 Ga0316593_10115332 Ga0316593_101153322 177
271 3300032168 Ga0316593_10321286 Ga0316593_103212861 177
272 3300033528 Ga0316588_1025777 Ga0316588_10257772 177
273 3300035086 Ga0373934_0018033 Ga0373934_0018033_1894_2439 177
274 3300035111 Ga0373923_0021254 Ga0373923_0021254_1773_2318 177
275 3300035116 Ga0373945_0005071 Ga0373945_0005071_2045_2590 177
276 3300035118 Ga0373954_0012949 Ga0373954_0012949_1318_1863 177
277 3300035119 Ga0373956_0098889 Ga0373956_0098889_673_1218 177
278 3300035170 Ga0373943_0001742 Ga0373943_0001742_5412_5957 177
279 3300035171 Ga0373946_0024904 Ga0373946_0024904_101_646 177
280 3300035171 Ga0373946_0088841 Ga0373946_0088841_92_625 177
281 3300035172 Ga0373955_0013474 Ga0373955_0013474_1823_2368 177
282 3300035172 Ga0373955_0174034 Ga0373955_0174034_134_667 177
283 3300035410 Ga0373924_0007288 Ga0373924_0007288_655_1200 177
284 3300035695 Ga0373927_0000085 Ga0373927_0000085_62756_63301 177
285 3300035724 Ga0373933_0080731 Ga0373933_0080731_771_1304 177
286 3300035724 Ga0373933_0196028 Ga0373933_0196028_693_1226 177
287 3300035725 Ga0373947_0000284 Ga0373947_0000284_1280_1825 177
288 3300036401 Ga0373937_0031973 Ga0373937_0031973_89_622 177
289 3300036401 Ga0373937_0062085 Ga0373937_0062085_285_818 177
290 3300036401 Ga0373937_0077922 Ga0373937_0077922_2287_2832 177
291 3300037068 Ga0373925_0001042 Ga0373925_0001042_209_754 177
292 3300044712 Ga0453684_0012641 Ga0453684_0012641_2878_3411 177
293 3300044842 Ga0466957_0009485 Ga0466957_0009485_793_1326 177
294 3300046454 Ga0495592_0131766 Ga0495592_0131766_773_1318 177
295 3300046463 Ga0495653_0056719 Ga0495653_0056719_1161_1706 177
296 3300046477 Ga0495664_0001323 Ga0495664_0001323_6327_6872 177
297 3300046511 Ga0495608_0574623 Ga0495608_0574623_83_628 177
298 3300046516 Ga0495628_0030561 Ga0495628_0030561_1065_1610 177
299 3300046517 Ga0495630_0191936 Ga0495630_0191936_966_1511 177
300 3300046535 Ga0495586_0125122 Ga0495586_0125122_209_754 177
301 3300046663 Ga0495635_0060187 Ga0495635_0060187_1597_2142 177
302 3300046690 Ga0495624_0196991 Ga0495624_0196991_413_958 177
303 3300050507 nmdc:mga05p37_23989_c1 nmdc:mga05p37_23989_c1_5796_6329 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

52

199

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5odr-assembly1.cif.gz_K heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 2 minutes. 0.9355 4 168
5xfa-assembly1.cif.gz_C crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state 0.9181 2 175
7t2r-assembly1.cif.gz_E structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state 0.9131 1 175
5xfa-assembly1.cif.gz_C crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state 0.9033 2 175
7t2r-assembly1.cif.gz_E structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state 0.9032 1 175
ID Description Score Start End Superfamily
af_Q58591_5_180_3.40.50.700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.9246 4 172 3.40.50.700
af_Q60340_4_160_3.40.50.700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.7857 4 163 3.40.50.700
af_Q58136_4_129_3.40.50.700 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit 0.7603 53 163 3.40.50.700
af_Q57936_1_148_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7443 3 158 3.40.50.12280
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7358 3 164 3.40.50.12280
ID Description Score Start End GO Terms
AF-A0A2W0A1I1-F1-model_v4 NADP oxidoreductase 0.9645 19 176 GO:0016491
GO:0051536
AF-A0A7C3U7A0-F1-model_v4 F420-nonreducing hydrogenase 0.9544 34 167 GO:0016491
GO:0051536
AF-Q5GJ61-F1-model_v4 NiFe-hydrogenase small subunit 0.9534 19 147 GO:0016491
GO:0051536
AF-A0A2W0A1I1-F1-model_v4 NADP oxidoreductase 0.9527 19 176 GO:0016491
GO:0051536
AF-Q6PQE9-F1-model_v4 NiFe hydrogenase small subunit 0.9504 25 175 GO:0016491
GO:0051536

Feature Viewer

pLDDT pTM Quality
89.9 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map