F397125
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 158 | 303 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300035086|Ga0373934_0002753|Ga0373934_0002753_4206_4850 |
| Length | 214 |
| Sequence | MRAGLPDRRFGGKGLGGGADGEKSRRGYFSGGKERGDGMKKVKVATVWLDGCSGCHMSLLDMDAAVIPLGRKIDLVYGPLVDAQEFPEGVDVTLVEGAVSSQDDLDKLQKIRQRTQVLISLGDCAVTGNVPAMRNFLPTNKLLQQVYVERADENKVIPKDGVPTLLKHARPLREYVKVDYFLPGCPPPSKAILNAINDLLEGRKPAANPNVKFG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 15 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 17 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 18 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 19 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 20 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 21 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 22 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 23 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 28 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 29 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 69 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 70 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 71 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 72 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 73 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 74 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 75 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 76 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 77 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 78 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 79 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 80 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 81 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 82 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 83 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 84 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 85 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 86 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 87 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 88 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 89 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 90 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 91 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 92 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 93 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 94 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 97 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 98 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 99 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 100 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 101 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 102 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 103 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 104 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 105 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 106 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 107 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 108 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 109 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 110 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 111 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 113 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 114 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 115 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 116 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 117 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 118 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 119 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 120 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 121 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 152 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 153 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 154 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 156 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.35 |
| Metatranscriptomes | 1.65 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.99 |
| Rhizosphere | 98.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10004556 | 3300001991 | Unclassified | 2267 |
| 2 | Ga0070670_100029946 | 3300005331 | Bacteria | 4687 |
| 3 | Ga0070670_100246663 | 3300005331 | Bacteria | 1555 |
| 4 | Ga0070660_100655206 | 3300005339 | Bacteria | 879 |
| 5 | Ga0070661_100027869 | 3300005344 | Bacteria | 4071 |
| 6 | Ga0070709_10552695 | 3300005434 | Bacteria | 881 |
| 7 | Ga0070714_100091795 | 3300005435 | Bacteria | 2661 |
| 8 | Ga0070714_100507266 | 3300005435 | Bacteria | 1151 |
| 9 | Ga0070714_100845382 | 3300005435 | Bacteria | 887 |
| 10 | Ga0070713_100001364 | 3300005436 | Bacteria | 15622 |
| 11 | Ga0070713_100048522 | 3300005436 | Unclassified | 3496 |
| 12 | Ga0070713_100529697 | 3300005436 | Unclassified | 1114 |
| 13 | Ga0070713_101242647 | 3300005436 | Bacteria | 721 |
| 14 | Ga0070710_10039722 | 3300005437 | Bacteria | 2590 |
| 15 | Ga0070711_100001326 | 3300005439 | Bacteria | 13503 |
| 16 | Ga0070711_100034459 | 3300005439 | Bacteria | 3377 |
| 17 | Ga0070711_100336332 | 3300005439 | Bacteria | 1210 |
| 18 | Ga0070711_101268107 | 3300005439 | Bacteria | 639 |
| 19 | Ga0070663_100041585 | 3300005455 | Bacteria | 3225 |
| 20 | Ga0070678_100218080 | 3300005456 | Bacteria | 1584 |
| 21 | Ga0070684_100064936 | 3300005535 | Bacteria | 3203 |
| 22 | Ga0070665_100041419 | 3300005548 | Bacteria | 4630 |
| 23 | Ga0070665_100241978 | 3300005548 | Bacteria | 1805 |
| 24 | Ga0068855_100066806 | 3300005563 | Bacteria | 4192 |
| 25 | Ga0068855_100458085 | 3300005563 | Unclassified | 1391 |
| 26 | Ga0070664_100024349 | 3300005564 | Bacteria | 5006 |
| 27 | Ga0070664_100168339 | 3300005564 | Bacteria | 1943 |
| 28 | Ga0068857_100058198 | 3300005577 | Bacteria | 3431 |
| 29 | Ga0068856_100004001 | 3300005614 | Bacteria | 14757 |
| 30 | Ga0068856_100102032 | 3300005614 | Bacteria | 2862 |
| 31 | Ga0068856_100435376 | 3300005614 | Bacteria | 1331 |
| 32 | Ga0068864_100022994 | 3300005618 | Bacteria | 5231 |
| 33 | Ga0068864_100137724 | 3300005618 | Bacteria | 2199 |
| 34 | Ga0068866_10715099 | 3300005718 | Bacteria | 688 |
| 35 | Ga0068863_100004839 | 3300005841 | Bacteria | 13260 |
| 36 | Ga0068858_100617987 | 3300005842 | Bacteria | 1052 |
| 37 | Ga0068858_100688184 | 3300005842 | Bacteria | 995 |
| 38 | Ga0068862_100032077 | 3300005844 | Bacteria | 4438 |
| 39 | Ga0070717_10033098 | 3300006028 | Bacteria | 4168 |
| 40 | Ga0070717_10279331 | 3300006028 | Bacteria | 1481 |
| 41 | Ga0070717_11276831 | 3300006028 | Bacteria | 668 |
| 42 | Ga0070717_11425875 | 3300006028 | Unclassified | 629 |
| 43 | Ga0070715_10038861 | 3300006163 | Unclassified | 1978 |
| 44 | Ga0070715_10040951 | 3300006163 | Bacteria | 1939 |
| 45 | Ga0070716_100023603 | 3300006173 | Unclassified | 3263 |
| 46 | Ga0070716_100119867 | 3300006173 | Bacteria | 1645 |
| 47 | Ga0070716_100234042 | 3300006173 | Unclassified | 1242 |
| 48 | Ga0070712_100006911 | 3300006175 | Bacteria | 7070 |
| 49 | Ga0070712_100035482 | 3300006175 | Unclassified | 3385 |
| 50 | Ga0068871_100903379 | 3300006358 | Bacteria | 819 |
| 51 | Ga0068871_101387110 | 3300006358 | Bacteria | 662 |
| 52 | Ga0075436_100182218 | 3300006914 | Bacteria | 1484 |
| 53 | Ga0105240_10113561 | 3300009093 | Bacteria | 3273 |
| 54 | Ga0105245_10000869 | 3300009098 | Bacteria | 27383 |
| 55 | Ga0105241_10057134 | 3300009174 | Bacteria | 2993 |
| 56 | Ga0105248_11881941 | 3300009177 | Bacteria | 679 |
| 57 | Ga0105237_10015737 | 3300009545 | Bacteria | 7865 |
| 58 | Ga0105238_10055595 | 3300009551 | Unclassified | 3972 |
| 59 | Ga0105239_10015113 | 3300010375 | Bacteria | 8558 |
| 60 | Ga0105239_11536516 | 3300010375 | Unclassified | 769 |
| 61 | Ga0157369_10528449 | 3300013105 | Bacteria | 1220 |
| 62 | Ga0157374_10213546 | 3300013296 | Bacteria | 1892 |
| 63 | Ga0157374_10635637 | 3300013296 | Bacteria | 1078 |
| 64 | Ga0157372_11025342 | 3300013307 | Bacteria | 955 |
| 65 | Ga0163163_10007731 | 3300014325 | Bacteria | 9498 |
| 66 | Ga0163163_10017193 | 3300014325 | Bacteria | 6740 |
| 67 | Ga0163163_10407856 | 3300014325 | Bacteria | 1417 |
| 68 | Ga0163163_10496607 | 3300014325 | Bacteria | 1282 |
| 69 | Ga0163163_10649049 | 3300014325 | Bacteria | 1119 |
| 70 | Ga0157379_10011503 | 3300014968 | Bacteria | 7724 |
| 71 | Ga0157379_10093757 | 3300014968 | Bacteria | 2694 |
| 72 | Ga0157376_10839747 | 3300014969 | Bacteria | 933 |
| 73 | Ga0157376_11290677 | 3300014969 | Bacteria | 760 |
| 74 | Ga0207692_10002633 | 3300025898 | Bacteria | 6903 |
| 75 | Ga0207692_10273038 | 3300025898 | Bacteria | 1020 |
| 76 | Ga0207688_10000141 | 3300025901 | Bacteria | 30619 |
| 77 | Ga0207685_10048806 | 3300025905 | Unclassified | 1623 |
| 78 | Ga0207685_10070764 | 3300025905 | Bacteria | 1413 |
| 79 | Ga0207699_10000327 | 3300025906 | Bacteria | 25260 |
| 80 | Ga0207699_10030006 | 3300025906 | Bacteria | 3039 |
| 81 | Ga0207699_10737647 | 3300025906 | Bacteria | 722 |
| 82 | Ga0207707_10462037 | 3300025912 | Bacteria | 1085 |
| 83 | Ga0207695_10168070 | 3300025913 | Bacteria | 2120 |
| 84 | Ga0207671_10073422 | 3300025914 | Bacteria | 2555 |
| 85 | Ga0207693_10000160 | 3300025915 | Bacteria | 62687 |
| 86 | Ga0207693_10002319 | 3300025915 | Bacteria | 16545 |
| 87 | Ga0207663_10003219 | 3300025916 | Bacteria | 7954 |
| 88 | Ga0207663_10011633 | 3300025916 | Bacteria | 4733 |
| 89 | Ga0207657_10089852 | 3300025919 | Bacteria | 2564 |
| 90 | Ga0207649_10646824 | 3300025920 | Bacteria | 817 |
| 91 | Ga0207650_10081669 | 3300025925 | Bacteria | 2452 |
| 92 | Ga0207700_10001825 | 3300025928 | Bacteria | 12078 |
| 93 | Ga0207700_10024393 | 3300025928 | Bacteria | 4185 |
| 94 | Ga0207700_10091661 | 3300025928 | Unclassified | 2401 |
| 95 | Ga0207664_10000017 | 3300025929 | Bacteria | 230967 |
| 96 | Ga0207664_10067410 | 3300025929 | Bacteria | 2872 |
| 97 | Ga0207664_10296162 | 3300025929 | Unclassified | 1422 |
| 98 | Ga0207664_10334091 | 3300025929 | Bacteria | 1339 |
| 99 | Ga0207670_10107511 | 3300025936 | Bacteria | 2003 |
| 100 | Ga0207665_10018764 | 3300025939 | Unclassified | 4545 |
| 101 | Ga0207665_10430103 | 3300025939 | Bacteria | 1010 |
| 102 | Ga0207661_10689735 | 3300025944 | Unclassified | 939 |
| 103 | Ga0207667_10184125 | 3300025949 | Bacteria | 2144 |
| 104 | Ga0207667_10208518 | 3300025949 | Bacteria | 2003 |
| 105 | Ga0207702_10012302 | 3300026078 | Bacteria | 7123 |
| 106 | Ga0207702_10354638 | 3300026078 | Bacteria | 1404 |
| 107 | Ga0207702_10377390 | 3300026078 | Bacteria | 1363 |
| 108 | Ga0207702_10392817 | 3300026078 | Bacteria | 1336 |
| 109 | Ga0207641_10030052 | 3300026088 | Bacteria | 4498 |
| 110 | Ga0207641_10816270 | 3300026088 | Bacteria | 923 |
| 111 | Ga0207676_10091838 | 3300026095 | Bacteria | 2495 |
| 112 | Ga0207676_10549800 | 3300026095 | Bacteria | 1103 |
| 113 | Ga0207674_10045908 | 3300026116 | Bacteria | 4490 |
| 114 | Ga0207683_10260193 | 3300026121 | Bacteria | 1584 |
| 115 | Ga0207698_10179919 | 3300026142 | Unclassified | 1872 |
| 116 | Ga0268266_10199531 | 3300028379 | Bacteria | 1830 |
| 117 | Ga0268266_10456824 | 3300028379 | Bacteria | 1215 |
| 118 | Ga0268264_10461642 | 3300028381 | Bacteria | 1232 |
| 119 | Ga0265326_10000800 | 3300028558 | Bacteria | 11642 |
| 120 | Ga0265318_10019636 | 3300028577 | Bacteria | 2739 |
| 121 | Ga0265323_10061884 | 3300028653 | Bacteria | 1300 |
| 122 | Ga0265322_10053241 | 3300028654 | Bacteria | 1148 |
| 123 | Ga0265336_10022640 | 3300028666 | Bacteria | 1999 |
| 124 | Ga0265338_10003792 | 3300028800 | Bacteria | 21011 |
| 125 | Ga0265338_10004299 | 3300028800 | Bacteria | 19334 |
| 126 | Ga0265338_10013784 | 3300028800 | Bacteria | 9085 |
| 127 | Ga0265338_10055647 | 3300028800 | Bacteria | 3517 |
| 128 | Ga0265338_10062227 | 3300028800 | Bacteria | 3263 |
| 129 | Ga0265338_10098466 | 3300028800 | Bacteria | 2392 |
| 130 | Ga0265338_10570909 | 3300028800 | Unclassified | 790 |
| 131 | Ga0265330_10001011 | 3300031235 | Bacteria | 17072 |
| 132 | Ga0265330_10082921 | 3300031235 | Bacteria | 1380 |
| 133 | Ga0265332_10009475 | 3300031238 | Bacteria | 4345 |
| 134 | Ga0265332_10070281 | 3300031238 | Bacteria | 1492 |
| 135 | Ga0265328_10129254 | 3300031239 | Bacteria | 945 |
| 136 | Ga0265320_10004173 | 3300031240 | Bacteria | 9493 |
| 137 | Ga0265320_10083296 | 3300031240 | Bacteria | 1491 |
| 138 | Ga0265325_10002504 | 3300031241 | Bacteria | 12376 |
| 139 | Ga0265325_10005772 | 3300031241 | Bacteria | 7591 |
| 140 | Ga0265325_10053111 | 3300031241 | Bacteria | 2078 |
| 141 | Ga0265329_10054902 | 3300031242 | Bacteria | 1264 |
| 142 | Ga0265340_10004079 | 3300031247 | Bacteria | 8206 |
| 143 | Ga0265340_10083498 | 3300031247 | Bacteria | 1501 |
| 144 | Ga0265340_10202620 | 3300031247 | Bacteria | 892 |
| 145 | Ga0265339_10002113 | 3300031249 | Bacteria | 14479 |
| 146 | Ga0265339_10015547 | 3300031249 | Bacteria | 4559 |
| 147 | Ga0265339_10031198 | 3300031249 | Bacteria | 3012 |
| 148 | Ga0265339_10254167 | 3300031249 | Bacteria | 849 |
| 149 | Ga0265331_10007927 | 3300031250 | Bacteria | 6081 |
| 150 | Ga0265331_10113165 | 3300031250 | Bacteria | 1244 |
| 151 | Ga0265331_10143069 | 3300031250 | Bacteria | 1087 |
| 152 | Ga0265316_10001130 | 3300031344 | Bacteria | 28937 |
| 153 | Ga0265316_10004969 | 3300031344 | Bacteria | 13060 |
| 154 | Ga0265316_10010255 | 3300031344 | Bacteria | 8550 |
| 155 | Ga0265316_10054475 | 3300031344 | Bacteria | 3131 |
| 156 | Ga0265316_10056287 | 3300031344 | Unclassified | 3073 |
| 157 | Ga0265316_10070964 | 3300031344 | Bacteria | 2686 |
| 158 | Ga0265316_10095236 | 3300031344 | Unclassified | 2268 |
| 159 | Ga0265316_10211892 | 3300031344 | Bacteria | 1432 |
| 160 | Ga0265316_10258386 | 3300031344 | Bacteria | 1278 |
| 161 | Ga0265316_10292601 | 3300031344 | Unclassified | 1188 |
| 162 | Ga0265316_10580030 | 3300031344 | Bacteria | 796 |
| 163 | Ga0307408_100146787 | 3300031548 | Bacteria | 1858 |
| 164 | Ga0265314_10001611 | 3300031711 | Bacteria | 24771 |
| 165 | Ga0265314_10013908 | 3300031711 | Bacteria | 6473 |
| 166 | Ga0265314_10028434 | 3300031711 | Bacteria | 4168 |
| 167 | Ga0265314_10030087 | 3300031711 | Bacteria | 4024 |
| 168 | Ga0265314_10078063 | 3300031711 | Bacteria | 2194 |
| 169 | Ga0265314_10181959 | 3300031711 | Bacteria | 1259 |
| 170 | Ga0265314_10209133 | 3300031711 | Bacteria | 1147 |
| 171 | Ga0265342_10023836 | 3300031712 | Bacteria | 3867 |
| 172 | Ga0265342_10068020 | 3300031712 | Bacteria | 2083 |
| 173 | Ga0316578_10075577 | 3300031728 | Bacteria | 1999 |
| 174 | Ga0316578_10192361 | 3300031728 | Bacteria | 1229 |
| 175 | Ga0316577_10006294 | 3300031733 | Bacteria | 6262 |
| 176 | Ga0316577_10027499 | 3300031733 | Archaea | 3171 |
| 177 | Ga0316577_10077363 | 3300031733 | Bacteria | 1858 |
| 178 | Ga0307407_10387920 | 3300031903 | Bacteria | 999 |
| 179 | Ga0307409_101158980 | 3300031995 | Bacteria | 795 |
| 180 | Ga0316583_10037815 | 3300032133 | Archaea | 1711 |
| 181 | Ga0316585_10054533 | 3300032137 | Unclassified | 1286 |
| 182 | Ga0316580_10105969 | 3300032139 | Bacteria | 861 |
| 183 | Ga0316580_10189893 | 3300032139 | Bacteria | 632 |
| 184 | Ga0316593_10012035 | 3300032168 | Bacteria | 2531 |
| 185 | Ga0316593_10115332 | 3300032168 | Bacteria | 962 |
| 186 | Ga0316593_10321286 | 3300032168 | Bacteria | 589 |
| 187 | Ga0316588_1025777 | 3300033528 | Bacteria | 1360 |
| 188 | Ga0373934_0002753 | 3300035086 | Bacteria | 6450 |
| 189 | Ga0373934_0018033 | 3300035086 | Bacteria | 2700 |
| 190 | Ga0373923_0020430 | 3300035111 | Bacteria | 2573 |
| 191 | Ga0373923_0021254 | 3300035111 | Bacteria | 2531 |
| 192 | Ga0373923_0049433 | 3300035111 | Bacteria | 1759 |
| 193 | Ga0373945_0005071 | 3300035116 | Bacteria | 4198 |
| 194 | Ga0373953_0017715 | 3300035117 | Bacteria | 2623 |
| 195 | Ga0373954_0000203 | 3300035118 | Bacteria | 21693 |
| 196 | Ga0373954_0012949 | 3300035118 | Bacteria | 3714 |
| 197 | Ga0373954_0132175 | 3300035118 | Bacteria | 1215 |
| 198 | Ga0373956_0098889 | 3300035119 | Bacteria | 1351 |
| 199 | Ga0373943_0001742 | 3300035170 | Bacteria | 9871 |
| 200 | Ga0373943_0023306 | 3300035170 | Unclassified | 2878 |
| 201 | Ga0373946_0024904 | 3300035171 | Bacteria | 2350 |
| 202 | Ga0373946_0088841 | 3300035171 | Bacteria | 1366 |
| 203 | Ga0373955_0001502 | 3300035172 | Bacteria | 9937 |
| 204 | Ga0373955_0013474 | 3300035172 | Bacteria | 3956 |
| 205 | Ga0373955_0174034 | 3300035172 | Bacteria | 1275 |
| 206 | Ga0316574_0175723 | 3300035398 | Bacteria | 1378 |
| 207 | Ga0373924_0007288 | 3300035410 | Bacteria | 3988 |
| 208 | Ga0373924_0025518 | 3300035410 | Bacteria | 2337 |
| 209 | Ga0373935_0041029 | 3300035692 | Bacteria | 2906 |
| 210 | Ga0373935_0075396 | 3300035692 | Bacteria | 2182 |
| 211 | Ga0373927_0000085 | 3300035695 | Bacteria | 70359 |
| 212 | Ga0373933_0002456 | 3300035724 | Bacteria | 10430 |
| 213 | Ga0373933_0078602 | 3300035724 | Bacteria | 2019 |
| 214 | Ga0373933_0080731 | 3300035724 | Bacteria | 1994 |
| 215 | Ga0373933_0196028 | 3300035724 | Unclassified | 1291 |
| 216 | Ga0373947_0000284 | 3300035725 | Bacteria | 28729 |
| 217 | Ga0373937_0003494 | 3300036401 | Bacteria | 13218 |
| 218 | Ga0373937_0009518 | 3300036401 | Bacteria | 8448 |
| 219 | Ga0373937_0031973 | 3300036401 | Bacteria | 4771 |
| 220 | Ga0373937_0062085 | 3300036401 | Bacteria | 3435 |
| 221 | Ga0373937_0077922 | 3300036401 | Bacteria | 3062 |
| 222 | Ga0373937_0115706 | 3300036401 | Unclassified | 2497 |
| 223 | Ga0373937_0131508 | 3300036401 | Bacteria | 2337 |
| 224 | Ga0316582_0019715 | 3300036647 | Bacteria | 3954 |
| 225 | Ga0316582_0050725 | 3300036647 | Unclassified | 2630 |
| 226 | Ga0316582_0072195 | 3300036647 | Unclassified | 2237 |
| 227 | Ga0316582_0312800 | 3300036647 | Bacteria | 1079 |
| 228 | Ga0316582_1047610 | 3300036647 | Bacteria | 556 |
| 229 | Ga0316584_0010617 | 3300036712 | Bacteria | 6444 |
| 230 | Ga0316584_0071998 | 3300036712 | Bacteria | 2590 |
| 231 | Ga0316584_0104098 | 3300036712 | Bacteria | 2125 |
| 232 | Ga0373925_0001042 | 3300037068 | Bacteria | 25115 |
| 233 | Ga0373925_0170408 | 3300037068 | Bacteria | 1719 |
| 234 | Ga0436364_0478215 | 3300037853 | Bacteria | 1367 |
| 235 | Ga0436360_0788754 | 3300039438 | Unclassified | 638 |
| 236 | Ga0436362_0017988 | 3300039453 | Bacteria | 568 |
| 237 | Ga0451577_0001746 | 3300042876 | Bacteria | 28024 |
| 238 | Ga0451577_0116636 | 3300042876 | Bacteria | 2392 |
| 239 | Ga0451577_0546728 | 3300042876 | Bacteria | 1051 |
| 240 | Ga0451577_1034648 | 3300042876 | Bacteria | 737 |
| 241 | Ga0453684_0001779 | 3300044712 | Bacteria | 57517 |
| 242 | Ga0453684_0012641 | 3300044712 | Bacteria | 13880 |
| 243 | Ga0453684_0194216 | 3300044712 | Unclassified | 2372 |
| 244 | Ga0453684_0270511 | 3300044712 | Archaea | 1942 |
| 245 | Ga0453684_0391288 | 3300044712 | Bacteria | 1559 |
| 246 | Ga0466957_0009485 | 3300044842 | Bacteria | 5558 |
| 247 | Ga0495592_0070317 | 3300046454 | Unclassified | 2550 |
| 248 | Ga0495592_0131766 | 3300046454 | Bacteria | 1748 |
| 249 | Ga0495603_0145690 | 3300046455 | Unclassified | 1377 |
| 250 | Ga0495629_0015575 | 3300046459 | Bacteria | 5458 |
| 251 | Ga0495651_0036150 | 3300046462 | Bacteria | 3845 |
| 252 | Ga0495653_0056719 | 3300046463 | Bacteria | 2984 |
| 253 | Ga0495653_0094425 | 3300046463 | Bacteria | 2179 |
| 254 | Ga0495580_0005576 | 3300046472 | Bacteria | 10373 |
| 255 | Ga0495580_0065581 | 3300046472 | Bacteria | 2543 |
| 256 | Ga0495580_0265074 | 3300046472 | Bacteria | 1174 |
| 257 | Ga0495582_0001074 | 3300046473 | Bacteria | 15354 |
| 258 | Ga0495664_0001323 | 3300046477 | Bacteria | 13014 |
| 259 | Ga0495664_0161514 | 3300046477 | Bacteria | 1359 |
| 260 | Ga0495584_0379330 | 3300046491 | Bacteria | 718 |
| 261 | Ga0495608_0013442 | 3300046511 | Bacteria | 5677 |
| 262 | Ga0495608_0574623 | 3300046511 | Bacteria | 678 |
| 263 | Ga0495628_0030561 | 3300046516 | Bacteria | 4361 |
| 264 | Ga0495630_0191936 | 3300046517 | Bacteria | 1558 |
| 265 | Ga0495666_0227566 | 3300046526 | Unclassified | 853 |
| 266 | Ga0495652_0062429 | 3300046529 | Unclassified | 3142 |
| 267 | Ga0495652_0151457 | 3300046529 | Bacteria | 1812 |
| 268 | Ga0495665_0053092 | 3300046531 | Bacteria | 2145 |
| 269 | Ga0495665_0089496 | 3300046531 | Unclassified | 1617 |
| 270 | Ga0495665_0458311 | 3300046531 | Bacteria | 644 |
| 271 | Ga0495586_0125122 | 3300046535 | Bacteria | 1438 |
| 272 | Ga0495586_0150282 | 3300046535 | Bacteria | 1310 |
| 273 | Ga0495587_0004956 | 3300046536 | Bacteria | 8728 |
| 274 | Ga0495635_0060187 | 3300046663 | Bacteria | 2611 |
| 275 | Ga0495635_0297992 | 3300046663 | Bacteria | 1081 |
| 276 | Ga0495657_0058437 | 3300046675 | Bacteria | 2561 |
| 277 | Ga0495657_0414686 | 3300046675 | Bacteria | 791 |
| 278 | Ga0495623_0018934 | 3300046679 | Bacteria | 4445 |
| 279 | Ga0495658_0034683 | 3300046683 | Unclassified | 2770 |
| 280 | Ga0495669_0001489 | 3300046684 | Bacteria | 9652 |
| 281 | Ga0495669_0338092 | 3300046684 | Bacteria | 727 |
| 282 | Ga0495613_0368572 | 3300046689 | Unclassified | 984 |
| 283 | Ga0495624_0093331 | 3300046690 | Bacteria | 1856 |
| 284 | Ga0495624_0196991 | 3300046690 | Bacteria | 1224 |
| 285 | Ga0495581_0014429 | 3300047315 | Unclassified | 4582 |
| 286 | Ga0495604_0004923 | 3300047317 | Bacteria | 10592 |
| 287 | Ga0495604_0305110 | 3300047317 | Bacteria | 1068 |
| 288 | Ga0495674_0012895 | 3300047319 | Bacteria | 7871 |
| 289 | Ga0495684_0002027 | 3300047471 | Bacteria | 16297 |
| 290 | Ga0495684_0182746 | 3300047471 | Bacteria | 1554 |
| 291 | Ga0495602_0012156 | 3300048088 | Bacteria | 8864 |
| 292 | Ga0496101_0248673 | 3300048904 | Unclassified | 1385 |
| 293 | Ga0496105_0038255 | 3300048908 | Bacteria | 3952 |
| 294 | Ga0496115_0027382 | 3300048918 | Unclassified | 4457 |
| 295 | Ga0501325_018320 | 3300049541 | Bacteria | 716 |
| 296 | Ga0501039_0513079 | 3300049575 | Bacteria | 941 |
| 297 | nmdc:mga05p37_23989_c1 | 3300050507 | Bacteria | 7408 |
| 298 | nmdc:mga08x19_225406_c1 | 3300050514 | Bacteria | 1289 |
| 299 | Ga0495619_0023670 | 3300053085 | Bacteria | 3939 |
| 300 | Ga0495619_0057196 | 3300053085 | Bacteria | 2587 |
| 301 | Ga0501082_0000235 | 3300060353 | Bacteria | 48331 |
| 302 | Ga0501082_0022096 | 3300060353 | Bacteria | 5484 |
| 303 | Ga0501082_0942483 | 3300060353 | Bacteria | 755 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036647 | Ga0316582_1047610 | Ga0316582_1047610_27_506 | 157 |
| 2 | 3300031548 | Ga0307408_100146787 | Ga0307408_1001467873 | 165 |
| 3 | 3300031903 | Ga0307407_10387920 | Ga0307407_103879202 | 165 |
| 4 | 3300049541 | Ga0501325_018320 | Ga0501325_018320_122_655 | 165 |
| 5 | 3300031995 | Ga0307409_101158980 | Ga0307409_1011589801 | 169 |
| 6 | 3300031733 | Ga0316577_10077363 | Ga0316577_100773632 | 172 |
| 7 | 3300032137 | Ga0316585_10054533 | Ga0316585_100545332 | 172 |
| 8 | 3300032168 | Ga0316593_10012035 | Ga0316593_100120352 | 172 |
| 9 | 3300005434 | Ga0070709_10552695 | Ga0070709_105526952 | 173 |
| 10 | 3300005439 | Ga0070711_100336332 | Ga0070711_1003363322 | 173 |
| 11 | 3300025906 | Ga0207699_10737647 | Ga0207699_107376471 | 173 |
| 12 | 3300005436 | Ga0070713_101242647 | Ga0070713_1012426472 | 174 |
| 13 | 3300014969 | Ga0157376_10839747 | Ga0157376_108397472 | 174 |
| 14 | 3300039453 | Ga0436362_0017988 | Ga0436362_0017988_16_546 | 174 |
| 15 | 3300060353 | Ga0501082_0022096 | Ga0501082_0022096_3090_3620 | 174 |
| 16 | 3300005548 | Ga0070665_100041419 | Ga0070665_1000414192 | 175 |
| 17 | 3300005563 | Ga0068855_100458085 | Ga0068855_1004580852 | 175 |
| 18 | 3300005614 | Ga0068856_100102032 | Ga0068856_1001020322 | 175 |
| 19 | 3300005718 | Ga0068866_10715099 | Ga0068866_107150991 | 175 |
| 20 | 3300005842 | Ga0068858_100688184 | Ga0068858_1006881842 | 175 |
| 21 | 3300006028 | Ga0070717_10279331 | Ga0070717_102793312 | 175 |
| 22 | 3300013296 | Ga0157374_10635637 | Ga0157374_106356372 | 175 |
| 23 | 3300026078 | Ga0207702_10377390 | Ga0207702_103773902 | 175 |
| 24 | 3300026142 | Ga0207698_10179919 | Ga0207698_101799193 | 175 |
| 25 | 3300028379 | Ga0268266_10199531 | Ga0268266_101995312 | 175 |
| 26 | 3300031344 | Ga0265316_10056287 | Ga0265316_100562873 | 175 |
| 27 | 3300031733 | Ga0316577_10027499 | Ga0316577_100274993 | 175 |
| 28 | 3300032133 | Ga0316583_10037815 | Ga0316583_100378153 | 175 |
| 29 | 3300036647 | Ga0316582_0050725 | Ga0316582_0050725_206_748 | 175 |
| 30 | 3300036647 | Ga0316582_0072195 | Ga0316582_0072195_948_1490 | 175 |
| 31 | 3300044712 | Ga0453684_0270511 | Ga0453684_0270511_804_1340 | 175 |
| 32 | 3300060353 | Ga0501082_0000235 | Ga0501082_0000235_32903_33430 | 175 |
| 33 | 3300005331 | Ga0070670_100246663 | Ga0070670_1002466632 | 176 |
| 34 | 3300005339 | Ga0070660_100655206 | Ga0070660_1006552061 | 176 |
| 35 | 3300005435 | Ga0070714_100091795 | Ga0070714_1000917953 | 176 |
| 36 | 3300005435 | Ga0070714_100507266 | Ga0070714_1005072662 | 176 |
| 37 | 3300005435 | Ga0070714_100845382 | Ga0070714_1008453822 | 176 |
| 38 | 3300005436 | Ga0070713_100001364 | Ga0070713_10000136411 | 176 |
| 39 | 3300005436 | Ga0070713_100048522 | Ga0070713_1000485222 | 176 |
| 40 | 3300005436 | Ga0070713_100529697 | Ga0070713_1005296972 | 176 |
| 41 | 3300005437 | Ga0070710_10039722 | Ga0070710_100397223 | 176 |
| 42 | 3300005439 | Ga0070711_100001326 | Ga0070711_1000013266 | 176 |
| 43 | 3300005439 | Ga0070711_101268107 | Ga0070711_1012681071 | 176 |
| 44 | 3300005456 | Ga0070678_100218080 | Ga0070678_1002180802 | 176 |
| 45 | 3300005535 | Ga0070684_100064936 | Ga0070684_1000649363 | 176 |
| 46 | 3300005548 | Ga0070665_100241978 | Ga0070665_1002419783 | 176 |
| 47 | 3300005563 | Ga0068855_100066806 | Ga0068855_1000668064 | 176 |
| 48 | 3300005564 | Ga0070664_100168339 | Ga0070664_1001683392 | 176 |
| 49 | 3300005577 | Ga0068857_100058198 | Ga0068857_1000581983 | 176 |
| 50 | 3300005614 | Ga0068856_100004001 | Ga0068856_1000040018 | 176 |
| 51 | 3300005614 | Ga0068856_100435376 | Ga0068856_1004353762 | 176 |
| 52 | 3300005618 | Ga0068864_100137724 | Ga0068864_1001377242 | 176 |
| 53 | 3300005841 | Ga0068863_100004839 | Ga0068863_1000048395 | 176 |
| 54 | 3300005842 | Ga0068858_100617987 | Ga0068858_1006179872 | 176 |
| 55 | 3300006028 | Ga0070717_10033098 | Ga0070717_100330981 | 176 |
| 56 | 3300006028 | Ga0070717_11276831 | Ga0070717_112768311 | 176 |
| 57 | 3300006028 | Ga0070717_11425875 | Ga0070717_114258751 | 176 |
| 58 | 3300006163 | Ga0070715_10038861 | Ga0070715_100388612 | 176 |
| 59 | 3300006163 | Ga0070715_10040951 | Ga0070715_100409512 | 176 |
| 60 | 3300006173 | Ga0070716_100023603 | Ga0070716_1000236032 | 176 |
| 61 | 3300006173 | Ga0070716_100119867 | Ga0070716_1001198671 | 176 |
| 62 | 3300006173 | Ga0070716_100234042 | Ga0070716_1002340422 | 176 |
| 63 | 3300006175 | Ga0070712_100006911 | Ga0070712_1000069115 | 176 |
| 64 | 3300006175 | Ga0070712_100035482 | Ga0070712_1000354822 | 176 |
| 65 | 3300006358 | Ga0068871_100903379 | Ga0068871_1009033791 | 176 |
| 66 | 3300006358 | Ga0068871_101387110 | Ga0068871_1013871101 | 176 |
| 67 | 3300006914 | Ga0075436_100182218 | Ga0075436_1001822182 | 176 |
| 68 | 3300009093 | Ga0105240_10113561 | Ga0105240_101135612 | 176 |
| 69 | 3300009174 | Ga0105241_10057134 | Ga0105241_100571343 | 176 |
| 70 | 3300009177 | Ga0105248_11881941 | Ga0105248_118819412 | 176 |
| 71 | 3300009545 | Ga0105237_10015737 | Ga0105237_100157374 | 176 |
| 72 | 3300009551 | Ga0105238_10055595 | Ga0105238_100555953 | 176 |
| 73 | 3300010375 | Ga0105239_10015113 | Ga0105239_100151132 | 176 |
| 74 | 3300013105 | Ga0157369_10528449 | Ga0157369_105284492 | 176 |
| 75 | 3300013307 | Ga0157372_11025342 | Ga0157372_110253422 | 176 |
| 76 | 3300014325 | Ga0163163_10007731 | Ga0163163_100077316 | 176 |
| 77 | 3300014325 | Ga0163163_10017193 | Ga0163163_100171932 | 176 |
| 78 | 3300014325 | Ga0163163_10407856 | Ga0163163_104078561 | 176 |
| 79 | 3300014325 | Ga0163163_10496607 | Ga0163163_104966072 | 176 |
| 80 | 3300014325 | Ga0163163_10649049 | Ga0163163_106490492 | 176 |
| 81 | 3300014968 | Ga0157379_10011503 | Ga0157379_100115039 | 176 |
| 82 | 3300014968 | Ga0157379_10093757 | Ga0157379_100937573 | 176 |
| 83 | 3300014969 | Ga0157376_11290677 | Ga0157376_112906772 | 176 |
| 84 | 3300025898 | Ga0207692_10002633 | Ga0207692_100026333 | 176 |
| 85 | 3300025898 | Ga0207692_10273038 | Ga0207692_102730382 | 176 |
| 86 | 3300025905 | Ga0207685_10048806 | Ga0207685_100488062 | 176 |
| 87 | 3300025905 | Ga0207685_10070764 | Ga0207685_100707642 | 176 |
| 88 | 3300025906 | Ga0207699_10000327 | Ga0207699_1000032715 | 176 |
| 89 | 3300025906 | Ga0207699_10030006 | Ga0207699_100300062 | 176 |
| 90 | 3300025912 | Ga0207707_10462037 | Ga0207707_104620372 | 176 |
| 91 | 3300025913 | Ga0207695_10168070 | Ga0207695_101680703 | 176 |
| 92 | 3300025914 | Ga0207671_10073422 | Ga0207671_100734223 | 176 |
| 93 | 3300025915 | Ga0207693_10000160 | Ga0207693_1000016028 | 176 |
| 94 | 3300025915 | Ga0207693_10002319 | Ga0207693_1000231912 | 176 |
| 95 | 3300025916 | Ga0207663_10003219 | Ga0207663_100032192 | 176 |
| 96 | 3300025919 | Ga0207657_10089852 | Ga0207657_100898523 | 176 |
| 97 | 3300025920 | Ga0207649_10646824 | Ga0207649_106468242 | 176 |
| 98 | 3300025925 | Ga0207650_10081669 | Ga0207650_100816692 | 176 |
| 99 | 3300025928 | Ga0207700_10001825 | Ga0207700_100018253 | 176 |
| 100 | 3300025928 | Ga0207700_10024393 | Ga0207700_100243932 | 176 |
| 101 | 3300025928 | Ga0207700_10091661 | Ga0207700_100916613 | 176 |
| 102 | 3300025929 | Ga0207664_10067410 | Ga0207664_100674103 | 176 |
| 103 | 3300025929 | Ga0207664_10296162 | Ga0207664_102961622 | 176 |
| 104 | 3300025929 | Ga0207664_10334091 | Ga0207664_103340912 | 176 |
| 105 | 3300025939 | Ga0207665_10018764 | Ga0207665_100187643 | 176 |
| 106 | 3300025939 | Ga0207665_10430103 | Ga0207665_104301032 | 176 |
| 107 | 3300025944 | Ga0207661_10689735 | Ga0207661_106897352 | 176 |
| 108 | 3300025949 | Ga0207667_10184125 | Ga0207667_101841252 | 176 |
| 109 | 3300025949 | Ga0207667_10208518 | Ga0207667_102085181 | 176 |
| 110 | 3300026078 | Ga0207702_10012302 | Ga0207702_100123025 | 176 |
| 111 | 3300026078 | Ga0207702_10354638 | Ga0207702_103546382 | 176 |
| 112 | 3300026078 | Ga0207702_10392817 | Ga0207702_103928172 | 176 |
| 113 | 3300026088 | Ga0207641_10030052 | Ga0207641_100300521 | 176 |
| 114 | 3300026088 | Ga0207641_10816270 | Ga0207641_108162701 | 176 |
| 115 | 3300026095 | Ga0207676_10091838 | Ga0207676_100918383 | 176 |
| 116 | 3300026095 | Ga0207676_10549800 | Ga0207676_105498002 | 176 |
| 117 | 3300026116 | Ga0207674_10045908 | Ga0207674_100459083 | 176 |
| 118 | 3300026121 | Ga0207683_10260193 | Ga0207683_102601932 | 176 |
| 119 | 3300028379 | Ga0268266_10456824 | Ga0268266_104568242 | 176 |
| 120 | 3300028381 | Ga0268264_10461642 | Ga0268264_104616422 | 176 |
| 121 | 3300028558 | Ga0265326_10000800 | Ga0265326_100008002 | 176 |
| 122 | 3300028577 | Ga0265318_10019636 | Ga0265318_100196362 | 176 |
| 123 | 3300028653 | Ga0265323_10061884 | Ga0265323_100618842 | 176 |
| 124 | 3300028654 | Ga0265322_10053241 | Ga0265322_100532412 | 176 |
| 125 | 3300028666 | Ga0265336_10022640 | Ga0265336_100226402 | 176 |
| 126 | 3300028800 | Ga0265338_10004299 | Ga0265338_100042992 | 176 |
| 127 | 3300028800 | Ga0265338_10055647 | Ga0265338_100556473 | 176 |
| 128 | 3300028800 | Ga0265338_10062227 | Ga0265338_100622273 | 176 |
| 129 | 3300028800 | Ga0265338_10570909 | Ga0265338_105709092 | 176 |
| 130 | 3300031235 | Ga0265330_10001011 | Ga0265330_100010118 | 176 |
| 131 | 3300031235 | Ga0265330_10082921 | Ga0265330_100829212 | 176 |
| 132 | 3300031238 | Ga0265332_10009475 | Ga0265332_100094752 | 176 |
| 133 | 3300031238 | Ga0265332_10070281 | Ga0265332_100702812 | 176 |
| 134 | 3300031239 | Ga0265328_10129254 | Ga0265328_101292542 | 176 |
| 135 | 3300031240 | Ga0265320_10004173 | Ga0265320_1000417310 | 176 |
| 136 | 3300031240 | Ga0265320_10083296 | Ga0265320_100832962 | 176 |
| 137 | 3300031241 | Ga0265325_10005772 | Ga0265325_100057722 | 176 |
| 138 | 3300031241 | Ga0265325_10053111 | Ga0265325_100531112 | 176 |
| 139 | 3300031242 | Ga0265329_10054902 | Ga0265329_100549023 | 176 |
| 140 | 3300031247 | Ga0265340_10004079 | Ga0265340_100040797 | 176 |
| 141 | 3300031247 | Ga0265340_10083498 | Ga0265340_100834982 | 176 |
| 142 | 3300031249 | Ga0265339_10002113 | Ga0265339_100021136 | 176 |
| 143 | 3300031249 | Ga0265339_10015547 | Ga0265339_100155474 | 176 |
| 144 | 3300031249 | Ga0265339_10254167 | Ga0265339_102541671 | 176 |
| 145 | 3300031250 | Ga0265331_10007927 | Ga0265331_100079275 | 176 |
| 146 | 3300031250 | Ga0265331_10113165 | Ga0265331_101131651 | 176 |
| 147 | 3300031250 | Ga0265331_10143069 | Ga0265331_101430692 | 176 |
| 148 | 3300031344 | Ga0265316_10001130 | Ga0265316_100011308 | 176 |
| 149 | 3300031344 | Ga0265316_10004969 | Ga0265316_100049696 | 176 |
| 150 | 3300031344 | Ga0265316_10054475 | Ga0265316_100544753 | 176 |
| 151 | 3300031344 | Ga0265316_10070964 | Ga0265316_100709643 | 176 |
| 152 | 3300031344 | Ga0265316_10095236 | Ga0265316_100952363 | 176 |
| 153 | 3300031344 | Ga0265316_10211892 | Ga0265316_102118922 | 176 |
| 154 | 3300031344 | Ga0265316_10258386 | Ga0265316_102583862 | 176 |
| 155 | 3300031344 | Ga0265316_10292601 | Ga0265316_102926012 | 176 |
| 156 | 3300031344 | Ga0265316_10580030 | Ga0265316_105800301 | 176 |
| 157 | 3300031711 | Ga0265314_10001611 | Ga0265314_100016114 | 176 |
| 158 | 3300031711 | Ga0265314_10013908 | Ga0265314_100139082 | 176 |
| 159 | 3300031711 | Ga0265314_10028434 | Ga0265314_100284342 | 176 |
| 160 | 3300031711 | Ga0265314_10030087 | Ga0265314_100300874 | 176 |
| 161 | 3300031711 | Ga0265314_10078063 | Ga0265314_100780631 | 176 |
| 162 | 3300031711 | Ga0265314_10181959 | Ga0265314_101819592 | 176 |
| 163 | 3300031711 | Ga0265314_10209133 | Ga0265314_102091332 | 176 |
| 164 | 3300031712 | Ga0265342_10023836 | Ga0265342_100238363 | 176 |
| 165 | 3300031712 | Ga0265342_10068020 | Ga0265342_100680202 | 176 |
| 166 | 3300031728 | Ga0316578_10075577 | Ga0316578_100755773 | 176 |
| 167 | 3300031728 | Ga0316578_10192361 | Ga0316578_101923612 | 176 |
| 168 | 3300031733 | Ga0316577_10006294 | Ga0316577_100062945 | 176 |
| 169 | 3300032139 | Ga0316580_10105969 | Ga0316580_101059692 | 176 |
| 170 | 3300032139 | Ga0316580_10189893 | Ga0316580_101898931 | 176 |
| 171 | 3300035086 | Ga0373934_0002753 | Ga0373934_0002753_4206_4850 | 176 |
| 172 | 3300035111 | Ga0373923_0020430 | Ga0373923_0020430_1633_2166 | 176 |
| 173 | 3300035111 | Ga0373923_0049433 | Ga0373923_0049433_754_1284 | 176 |
| 174 | 3300035117 | Ga0373953_0017715 | Ga0373953_0017715_1256_1786 | 176 |
| 175 | 3300035118 | Ga0373954_0000203 | Ga0373954_0000203_2796_3326 | 176 |
| 176 | 3300035118 | Ga0373954_0132175 | Ga0373954_0132175_293_826 | 176 |
| 177 | 3300035170 | Ga0373943_0023306 | Ga0373943_0023306_2258_2788 | 176 |
| 178 | 3300035172 | Ga0373955_0001502 | Ga0373955_0001502_7140_7784 | 176 |
| 179 | 3300035398 | Ga0316574_0175723 | Ga0316574_0175723_178_723 | 176 |
| 180 | 3300035410 | Ga0373924_0025518 | Ga0373924_0025518_1515_2045 | 176 |
| 181 | 3300035692 | Ga0373935_0041029 | Ga0373935_0041029_2255_2788 | 176 |
| 182 | 3300035692 | Ga0373935_0075396 | Ga0373935_0075396_861_1391 | 176 |
| 183 | 3300035724 | Ga0373933_0002456 | Ga0373933_0002456_1778_2422 | 176 |
| 184 | 3300035724 | Ga0373933_0078602 | Ga0373933_0078602_973_1506 | 176 |
| 185 | 3300036401 | Ga0373937_0003494 | Ga0373937_0003494_4451_4984 | 176 |
| 186 | 3300036401 | Ga0373937_0009518 | Ga0373937_0009518_4915_5445 | 176 |
| 187 | 3300036401 | Ga0373937_0115706 | Ga0373937_0115706_962_1492 | 176 |
| 188 | 3300036401 | Ga0373937_0131508 | Ga0373937_0131508_1048_1578 | 176 |
| 189 | 3300036647 | Ga0316582_0019715 | Ga0316582_0019715_704_1249 | 176 |
| 190 | 3300036647 | Ga0316582_0312800 | Ga0316582_0312800_427_963 | 176 |
| 191 | 3300036712 | Ga0316584_0010617 | Ga0316584_0010617_686_1216 | 176 |
| 192 | 3300036712 | Ga0316584_0071998 | Ga0316584_0071998_1217_1762 | 176 |
| 193 | 3300036712 | Ga0316584_0104098 | Ga0316584_0104098_79_624 | 176 |
| 194 | 3300037068 | Ga0373925_0170408 | Ga0373925_0170408_887_1420 | 176 |
| 195 | 3300037853 | Ga0436364_0478215 | Ga0436364_0478215_386_919 | 176 |
| 196 | 3300039438 | Ga0436360_0788754 | Ga0436360_0788754_25_555 | 176 |
| 197 | 3300042876 | Ga0451577_0001746 | Ga0451577_0001746_18185_18715 | 176 |
| 198 | 3300042876 | Ga0451577_0116636 | Ga0451577_0116636_1417_1947 | 176 |
| 199 | 3300042876 | Ga0451577_0546728 | Ga0451577_0546728_321_851 | 176 |
| 200 | 3300042876 | Ga0451577_1034648 | Ga0451577_1034648_15_545 | 176 |
| 201 | 3300044712 | Ga0453684_0001779 | Ga0453684_0001779_43885_44415 | 176 |
| 202 | 3300044712 | Ga0453684_0194216 | Ga0453684_0194216_95_625 | 176 |
| 203 | 3300044712 | Ga0453684_0391288 | Ga0453684_0391288_311_841 | 176 |
| 204 | 3300046454 | Ga0495592_0070317 | Ga0495592_0070317_1637_2167 | 176 |
| 205 | 3300046455 | Ga0495603_0145690 | Ga0495603_0145690_662_1192 | 176 |
| 206 | 3300046459 | Ga0495629_0015575 | Ga0495629_0015575_3585_4115 | 176 |
| 207 | 3300046462 | Ga0495651_0036150 | Ga0495651_0036150_1880_2410 | 176 |
| 208 | 3300046463 | Ga0495653_0094425 | Ga0495653_0094425_72_716 | 176 |
| 209 | 3300046472 | Ga0495580_0005576 | Ga0495580_0005576_4195_4725 | 176 |
| 210 | 3300046472 | Ga0495580_0065581 | Ga0495580_0065581_1256_1786 | 176 |
| 211 | 3300046472 | Ga0495580_0265074 | Ga0495580_0265074_286_816 | 176 |
| 212 | 3300046473 | Ga0495582_0001074 | Ga0495582_0001074_2390_2920 | 176 |
| 213 | 3300046477 | Ga0495664_0161514 | Ga0495664_0161514_693_1223 | 176 |
| 214 | 3300046491 | Ga0495584_0379330 | Ga0495584_0379330_73_603 | 176 |
| 215 | 3300046511 | Ga0495608_0013442 | Ga0495608_0013442_1930_2460 | 176 |
| 216 | 3300046526 | Ga0495666_0227566 | Ga0495666_0227566_260_790 | 176 |
| 217 | 3300046529 | Ga0495652_0062429 | Ga0495652_0062429_204_848 | 176 |
| 218 | 3300046529 | Ga0495652_0151457 | Ga0495652_0151457_752_1282 | 176 |
| 219 | 3300046531 | Ga0495665_0053092 | Ga0495665_0053092_786_1316 | 176 |
| 220 | 3300046531 | Ga0495665_0089496 | Ga0495665_0089496_959_1489 | 176 |
| 221 | 3300046531 | Ga0495665_0458311 | Ga0495665_0458311_34_564 | 176 |
| 222 | 3300046535 | Ga0495586_0150282 | Ga0495586_0150282_407_937 | 176 |
| 223 | 3300046536 | Ga0495587_0004956 | Ga0495587_0004956_185_829 | 176 |
| 224 | 3300046663 | Ga0495635_0297992 | Ga0495635_0297992_145_675 | 176 |
| 225 | 3300046675 | Ga0495657_0058437 | Ga0495657_0058437_1310_1954 | 176 |
| 226 | 3300046675 | Ga0495657_0414686 | Ga0495657_0414686_122_652 | 176 |
| 227 | 3300046679 | Ga0495623_0018934 | Ga0495623_0018934_2842_3372 | 176 |
| 228 | 3300046683 | Ga0495658_0034683 | Ga0495658_0034683_1318_1848 | 176 |
| 229 | 3300046684 | Ga0495669_0001489 | Ga0495669_0001489_5372_5902 | 176 |
| 230 | 3300046684 | Ga0495669_0338092 | Ga0495669_0338092_90_620 | 176 |
| 231 | 3300046689 | Ga0495613_0368572 | Ga0495613_0368572_44_574 | 176 |
| 232 | 3300046690 | Ga0495624_0093331 | Ga0495624_0093331_926_1456 | 176 |
| 233 | 3300047315 | Ga0495581_0014429 | Ga0495581_0014429_97_627 | 176 |
| 234 | 3300047317 | Ga0495604_0004923 | Ga0495604_0004923_3537_4181 | 176 |
| 235 | 3300047317 | Ga0495604_0305110 | Ga0495604_0305110_426_956 | 176 |
| 236 | 3300047319 | Ga0495674_0012895 | Ga0495674_0012895_5569_6099 | 176 |
| 237 | 3300047471 | Ga0495684_0002027 | Ga0495684_0002027_1742_2272 | 176 |
| 238 | 3300047471 | Ga0495684_0182746 | Ga0495684_0182746_190_720 | 176 |
| 239 | 3300048088 | Ga0495602_0012156 | Ga0495602_0012156_6745_7275 | 176 |
| 240 | 3300048904 | Ga0496101_0248673 | Ga0496101_0248673_714_1244 | 176 |
| 241 | 3300048908 | Ga0496105_0038255 | Ga0496105_0038255_2482_3012 | 176 |
| 242 | 3300048918 | Ga0496115_0027382 | Ga0496115_0027382_360_890 | 176 |
| 243 | 3300049575 | Ga0501039_0513079 | Ga0501039_0513079_47_586 | 176 |
| 244 | 3300050514 | nmdc:mga08x19_225406_c1 | nmdc:mga08x19_225406_c1_346_876 | 176 |
| 245 | 3300053085 | Ga0495619_0023670 | Ga0495619_0023670_780_1310 | 176 |
| 246 | 3300053085 | Ga0495619_0057196 | Ga0495619_0057196_702_1232 | 176 |
| 247 | 3300060353 | Ga0501082_0942483 | Ga0501082_0942483_142_681 | 176 |
| 248 | 3300001991 | JGI24743J22301_10004556 | JGI24743J22301_100045562 | 177 |
| 249 | 3300005331 | Ga0070670_100029946 | Ga0070670_1000299465 | 177 |
| 250 | 3300005344 | Ga0070661_100027869 | Ga0070661_1000278694 | 177 |
| 251 | 3300005439 | Ga0070711_100034459 | Ga0070711_1000344595 | 177 |
| 252 | 3300005455 | Ga0070663_100041585 | Ga0070663_1000415852 | 177 |
| 253 | 3300005564 | Ga0070664_100024349 | Ga0070664_1000243495 | 177 |
| 254 | 3300005618 | Ga0068864_100022994 | Ga0068864_1000229946 | 177 |
| 255 | 3300005844 | Ga0068862_100032077 | Ga0068862_1000320776 | 177 |
| 256 | 3300009098 | Ga0105245_10000869 | Ga0105245_1000086922 | 177 |
| 257 | 3300010375 | Ga0105239_11536516 | Ga0105239_115365162 | 177 |
| 258 | 3300013296 | Ga0157374_10213546 | Ga0157374_102135462 | 177 |
| 259 | 3300025901 | Ga0207688_10000141 | Ga0207688_100001419 | 177 |
| 260 | 3300025916 | Ga0207663_10011633 | Ga0207663_100116333 | 177 |
| 261 | 3300025929 | Ga0207664_10000017 | Ga0207664_10000017146 | 177 |
| 262 | 3300025936 | Ga0207670_10107511 | Ga0207670_101075112 | 177 |
| 263 | 3300028800 | Ga0265338_10003792 | Ga0265338_100037922 | 177 |
| 264 | 3300028800 | Ga0265338_10013784 | Ga0265338_100137843 | 177 |
| 265 | 3300028800 | Ga0265338_10098466 | Ga0265338_100984663 | 177 |
| 266 | 3300031241 | Ga0265325_10002504 | Ga0265325_100025043 | 177 |
| 267 | 3300031247 | Ga0265340_10202620 | Ga0265340_102026201 | 177 |
| 268 | 3300031249 | Ga0265339_10031198 | Ga0265339_100311983 | 177 |
| 269 | 3300031344 | Ga0265316_10010255 | Ga0265316_100102556 | 177 |
| 270 | 3300032168 | Ga0316593_10115332 | Ga0316593_101153322 | 177 |
| 271 | 3300032168 | Ga0316593_10321286 | Ga0316593_103212861 | 177 |
| 272 | 3300033528 | Ga0316588_1025777 | Ga0316588_10257772 | 177 |
| 273 | 3300035086 | Ga0373934_0018033 | Ga0373934_0018033_1894_2439 | 177 |
| 274 | 3300035111 | Ga0373923_0021254 | Ga0373923_0021254_1773_2318 | 177 |
| 275 | 3300035116 | Ga0373945_0005071 | Ga0373945_0005071_2045_2590 | 177 |
| 276 | 3300035118 | Ga0373954_0012949 | Ga0373954_0012949_1318_1863 | 177 |
| 277 | 3300035119 | Ga0373956_0098889 | Ga0373956_0098889_673_1218 | 177 |
| 278 | 3300035170 | Ga0373943_0001742 | Ga0373943_0001742_5412_5957 | 177 |
| 279 | 3300035171 | Ga0373946_0024904 | Ga0373946_0024904_101_646 | 177 |
| 280 | 3300035171 | Ga0373946_0088841 | Ga0373946_0088841_92_625 | 177 |
| 281 | 3300035172 | Ga0373955_0013474 | Ga0373955_0013474_1823_2368 | 177 |
| 282 | 3300035172 | Ga0373955_0174034 | Ga0373955_0174034_134_667 | 177 |
| 283 | 3300035410 | Ga0373924_0007288 | Ga0373924_0007288_655_1200 | 177 |
| 284 | 3300035695 | Ga0373927_0000085 | Ga0373927_0000085_62756_63301 | 177 |
| 285 | 3300035724 | Ga0373933_0080731 | Ga0373933_0080731_771_1304 | 177 |
| 286 | 3300035724 | Ga0373933_0196028 | Ga0373933_0196028_693_1226 | 177 |
| 287 | 3300035725 | Ga0373947_0000284 | Ga0373947_0000284_1280_1825 | 177 |
| 288 | 3300036401 | Ga0373937_0031973 | Ga0373937_0031973_89_622 | 177 |
| 289 | 3300036401 | Ga0373937_0062085 | Ga0373937_0062085_285_818 | 177 |
| 290 | 3300036401 | Ga0373937_0077922 | Ga0373937_0077922_2287_2832 | 177 |
| 291 | 3300037068 | Ga0373925_0001042 | Ga0373925_0001042_209_754 | 177 |
| 292 | 3300044712 | Ga0453684_0012641 | Ga0453684_0012641_2878_3411 | 177 |
| 293 | 3300044842 | Ga0466957_0009485 | Ga0466957_0009485_793_1326 | 177 |
| 294 | 3300046454 | Ga0495592_0131766 | Ga0495592_0131766_773_1318 | 177 |
| 295 | 3300046463 | Ga0495653_0056719 | Ga0495653_0056719_1161_1706 | 177 |
| 296 | 3300046477 | Ga0495664_0001323 | Ga0495664_0001323_6327_6872 | 177 |
| 297 | 3300046511 | Ga0495608_0574623 | Ga0495608_0574623_83_628 | 177 |
| 298 | 3300046516 | Ga0495628_0030561 | Ga0495628_0030561_1065_1610 | 177 |
| 299 | 3300046517 | Ga0495630_0191936 | Ga0495630_0191936_966_1511 | 177 |
| 300 | 3300046535 | Ga0495586_0125122 | Ga0495586_0125122_209_754 | 177 |
| 301 | 3300046663 | Ga0495635_0060187 | Ga0495635_0060187_1597_2142 | 177 |
| 302 | 3300046690 | Ga0495624_0196991 | Ga0495624_0196991_413_958 | 177 |
| 303 | 3300050507 | nmdc:mga05p37_23989_c1 | nmdc:mga05p37_23989_c1_5796_6329 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5odr-assembly1.cif.gz_K | heterodisulfide reductase / [nife]-hydrogenase complex from methanothermococcus thermolithotrophicus soaked with heterodisulfide for 2 minutes. | 0.9355 | 4 | 168 |
| 5xfa-assembly1.cif.gz_C | crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state | 0.9181 | 2 | 175 |
| 7t2r-assembly1.cif.gz_E | structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state | 0.9131 | 1 | 175 |
| 5xfa-assembly1.cif.gz_C | crystal structure of nad+-reducing [nife]-hydrogenase in the h2-reduced state | 0.9033 | 2 | 175 |
| 7t2r-assembly1.cif.gz_E | structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state | 0.9032 | 1 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58591_5_180_3.40.50.700 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.9246 | 4 | 172 | 3.40.50.700 |
| af_Q60340_4_160_3.40.50.700 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.7857 | 4 | 163 | 3.40.50.700 |
| af_Q58136_4_129_3.40.50.700 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NADH:ubiquinone oxidoreductase-like, 20kDa subunit | 0.7603 | 53 | 163 | 3.40.50.700 |
| af_Q57936_1_148_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7443 | 3 | 158 | 3.40.50.12280 |
| af_I6XUD2_20_159_3.40.50.12280 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7358 | 3 | 164 | 3.40.50.12280 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W0A1I1-F1-model_v4 | NADP oxidoreductase | 0.9645 | 19 | 176 |
GO:0016491
GO:0051536 |
| AF-A0A7C3U7A0-F1-model_v4 | F420-nonreducing hydrogenase | 0.9544 | 34 | 167 |
GO:0016491
GO:0051536 |
| AF-Q5GJ61-F1-model_v4 | NiFe-hydrogenase small subunit | 0.9534 | 19 | 147 |
GO:0016491
GO:0051536 |
| AF-A0A2W0A1I1-F1-model_v4 | NADP oxidoreductase | 0.9527 | 19 | 176 |
GO:0016491
GO:0051536 |
| AF-Q6PQE9-F1-model_v4 | NiFe hydrogenase small subunit | 0.9504 | 25 | 175 |
GO:0016491
GO:0051536 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar