F397102

General Info

Members Datasets Scaffolds Average Seq Length
303 227 606 446

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10047639|Ga0265325_100476391
Length 485
Sequence MHRREFLLATAAAGIAPRLLAAEPKTPAAARAADPSCCGPGYASPQEAAKAPPEKLLYTVGLYVGTEVKKPDYLATVDVDPSSPTYSQVIHRLPMPQVGDELHHFGWNACSSCHADGSKSRRYLIVPGQRSSRIHIVDMADPRAPKMHKVIEPETVKAKVNLTAPHTVHCTPDGRIVISMLGDRDGNAPGGFLVLDEKFDIAGRWENSATGMNYNYDFWYQPRHNVMVSSEWAAPHTYYEGFKVEEVAAGKYGTHIHFWDWAKRDILQTVDLGDQGRIPLEVRFLHNPDSTHGFVGAALSSTMWHWHRSADGKWQVEKVIDVEPIENAGWPFPVPGLITDLVVSMDDRYLYFSNWLHGDLRQYDISDPAKPKLTGQLWLGGVLGRKSEIPAGKIAKPTGGPQMLQLSLDGRRLYVTSSLFSSWDNQFYPEMAKTGSYMLQIDCDPAGGMKVNDRFAVDFGAEPDGPARAHEMRYPGGDCTSDIWT

Samples

Sample ID Description Type Environment
1 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
74 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
79 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
176 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
192 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
193 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
194 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
195 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
196 2831426010 Nostoc sp. 106C Isolate Unclassified
197 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
198 2849660919 Nostoc sp. T09 Isolate Unclassified
199 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
200 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
201 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
202 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
203 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
204 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
205 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
206 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
207 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
208 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
209 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
210 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
211 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
212 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
213 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
214 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified
215 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
216 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
217 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
218 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
219 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
220 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
221 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
222 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
223 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
224 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
225 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
226 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
227 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.53
Metatranscriptomes 7.26
Isolates 12.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 8.91
Rhizoplane 5.28
Rhizosphere 78.55
Stem 0
Stem Tuber 0
Unclassified 8.91

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265325_10047639 3300031241 Bacteria 2218
2 Ga0058863_10082335 3300004799 Bacteria 1930
3 Ga0058862_10077091 3300004803 Bacteria 1778
4 Ga0058862_12851697 3300004803 Unclassified 1916
5 Ga0065712_10115421 3300005290 Bacteria 1752
6 Ga0068869_100000600 3300005334 Bacteria 20255
7 Ga0068869_100095839 3300005334 Bacteria 2239
8 Ga0070680_100000089 3300005336 Bacteria 51222
9 Ga0070682_100043815 3300005337 Unclassified 2768
10 Ga0068868_100009011 3300005338 Bacteria 7164
11 Ga0068868_100028556 3300005338 Bacteria 4266
12 Ga0068868_100070315 3300005338 Bacteria 2791
13 Ga0070660_100026007 3300005339 Bacteria 4356
14 Ga0070689_100170990 3300005340 Bacteria 1761
15 Ga0070691_10001497 3300005341 Bacteria 10020
16 Ga0070691_10026091 3300005341 Unclassified 2722
17 Ga0070687_100020139 3300005343 Bacteria 3114
18 Ga0070661_100204385 3300005344 Unclassified 1510
19 Ga0070692_10004537 3300005345 Bacteria 5810
20 Ga0070692_10046453 3300005345 Unclassified 2244
21 Ga0070659_100054985 3300005366 Bacteria 3136
22 Ga0070714_100009851 3300005435 Bacteria 7532
23 Ga0070713_100000687 3300005436 Bacteria 21729
24 Ga0070701_10000224 3300005438 Bacteria 17823
25 Ga0070705_100000867 3300005440 Bacteria 16937
26 Ga0070700_100120552 3300005441 Bacteria 1757
27 Ga0070708_100000758 3300005445 Bacteria 24349
28 Ga0070681_10020500 3300005458 Bacteria 6625
29 Ga0070706_100004482 3300005467 Bacteria 13466
30 Ga0070706_100251836 3300005467 Bacteria 1649
31 Ga0070707_100002287 3300005468 Bacteria 18310
32 Ga0070707_100002688 3300005468 Bacteria 16902
33 Ga0070707_100053041 3300005468 Bacteria 3887
34 Ga0070698_100022755 3300005471 Bacteria 6553
35 Ga0070698_100081290 3300005471 Bacteria 3235
36 Ga0070698_100093602 3300005471 Bacteria 2984
37 Ga0070698_100096341 3300005471 Bacteria 2936
38 Ga0070699_100123283 3300005518 Bacteria 2280
39 Ga0070679_100001678 3300005530 Bacteria 19963
40 Ga0070679_100028655 3300005530 Bacteria 5491
41 Ga0070684_100047844 3300005535 Unclassified 3708
42 Ga0070697_100029791 3300005536 Bacteria 4379
43 Ga0070697_100052172 3300005536 Unclassified 3323
44 Ga0070697_100134226 3300005536 Bacteria 2078
45 Ga0070697_100137656 3300005536 Bacteria 2051
46 Ga0070686_100109150 3300005544 Bacteria 1882
47 Ga0070696_100000958 3300005546 Bacteria 18702
48 Ga0070665_100002982 3300005548 Bacteria 18282
49 Ga0070665_100143733 3300005548 Unclassified 2389
50 Ga0070704_100024781 3300005549 Bacteria 3941
51 Ga0068855_100011440 3300005563 Bacteria 10721
52 Ga0070664_100010230 3300005564 Bacteria 7609
53 Ga0068857_100000443 3300005577 Bacteria 29428
54 Ga0068857_100004525 3300005577 Bacteria 11760
55 Ga0068856_100000254 3300005614 Bacteria 58259
56 Ga0068856_100027169 3300005614 Bacteria 5584
57 Ga0070702_100078879 3300005615 Bacteria 1967
58 Ga0068859_100107297 3300005617 Bacteria 2852
59 Ga0068864_100183569 3300005618 Bacteria 1914
60 Ga0068866_10000950 3300005718 Bacteria 12744
61 Ga0068858_100023846 3300005842 Bacteria 5701
62 Ga0068858_100030682 3300005842 Bacteria 4993
63 Ga0068860_100040323 3300005843 Bacteria 4463
64 Ga0081538_10003557 3300005981 Bacteria 14660
65 Ga0070717_10035795 3300006028 Bacteria 4022
66 Ga0070717_10058347 3300006028 Bacteria 3191
67 Ga0070717_10216875 3300006028 Bacteria 1681
68 Ga0075365_10025007 3300006038 Bacteria 3775
69 Ga0075364_10033258 3300006051 Bacteria 3318
70 Ga0075369_10009747 3300006186 Bacteria 3741
71 Ga0097621_100044946 3300006237 Bacteria 3565
72 Ga0075428_100005195 3300006844 Bacteria 14462
73 Ga0075428_100032865 3300006844 Bacteria 5729
74 Ga0075428_100085223 3300006844 Bacteria 3446
75 Ga0075430_100125718 3300006846 Bacteria 2137
76 Ga0075433_10001586 3300006852 Bacteria 16840
77 Ga0075434_100000643 3300006871 Bacteria 27037
78 Ga0075434_100116388 3300006871 Bacteria 2686
79 Ga0075429_100000103 3300006880 Bacteria 47421
80 Ga0075436_100008789 3300006914 Bacteria 6907
81 Ga0097620_100107303 3300006931 Bacteria 2852
82 Ga0075435_100003906 3300007076 Bacteria 10177
83 Ga0075435_100073052 3300007076 Bacteria 2803
84 Ga0114129_10001184 3300009147 Bacteria 34627
85 Ga0114129_10033762 3300009147 Bacteria 7228
86 Ga0105243_10025965 3300009148 Bacteria 4482
87 Ga0105238_10065307 3300009551 Bacteria 3640
88 Ga0105249_10000917 3300009553 Bacteria 26070
89 Ga0105246_10001825 3300011119 Bacteria 12762
90 Ga0105246_10032309 3300011119 Unclassified 3470
91 Ga0157369_10064182 3300013105 Unclassified 3955
92 Ga0157378_10075149 3300013297 Unclassified 3041
93 Ga0163162_10121343 3300013306 Unclassified 2718
94 Ga0163163_10213398 3300014325 Bacteria 1979
95 Ga0157377_10041542 3300014745 Bacteria 2552
96 Ga0157379_10040034 3300014968 Bacteria 4182
97 Ga0157376_10024001 3300014969 Bacteria 4782
98 Ga0157376_10080483 3300014969 Bacteria 2795
99 Ga0197907_11483924 3300020069 Bacteria 2166
100 Ga0206356_10304196 3300020070 Unclassified 2390
101 Ga0206349_1060555 3300020075 Bacteria 1787
102 Ga0206349_1960679 3300020075 Bacteria 1438
103 Ga0206355_1246510 3300020076 Unclassified 1444
104 Ga0206351_10033705 3300020077 Unclassified 2133
105 Ga0206352_10288816 3300020078 Bacteria 1851
106 Ga0206352_11338295 3300020078 Unclassified 2199
107 Ga0206350_10259274 3300020080 Bacteria 2179
108 Ga0206350_10345055 3300020080 Unclassified 1546
109 Ga0206350_10798553 3300020080 Bacteria 2684
110 Ga0206350_10948445 3300020080 Unclassified 1560
111 Ga0154015_1338429 3300020610 Unclassified 1503
112 Ga0213874_10000141 3300021377 Bacteria 12268
113 Ga0213874_10004754 3300021377 Bacteria 3127
114 Ga0224712_10012045 3300022467 Unclassified 2705
115 Ga0224712_10014368 3300022467 Bacteria 2547
116 Ga0224712_10017534 3300022467 Bacteria 2376
117 Ga0224712_10031484 3300022467 Bacteria 1925
118 Ga0224712_10038713 3300022467 Unclassified 1783
119 Ga0224712_10046536 3300022467 Bacteria 1665
120 Ga0207697_10027870 3300025315 Bacteria 2309
121 Ga0207692_10008354 3300025898 Bacteria 4280
122 Ga0207642_10003001 3300025899 Bacteria 5287
123 Ga0207688_10003082 3300025901 Bacteria 9097
124 Ga0207688_10063086 3300025901 Bacteria 2090
125 Ga0207645_10122780 3300025907 Bacteria 1687
126 Ga0207705_10088747 3300025909 Unclassified 2262
127 Ga0207684_10042147 3300025910 Bacteria 3869
128 Ga0207684_10064605 3300025910 Bacteria 3107
129 Ga0207684_10168111 3300025910 Bacteria 1890
130 Ga0207707_10034865 3300025912 Bacteria 4402
131 Ga0207660_10007958 3300025917 Bacteria 6857
132 Ga0207662_10000215 3300025918 Bacteria 26901
133 Ga0207657_10003935 3300025919 Bacteria 15772
134 Ga0207652_10004840 3300025921 Bacteria 10907
135 Ga0207652_10045768 3300025921 Bacteria 3731
136 Ga0207646_10002364 3300025922 Bacteria 22293
137 Ga0207646_10003460 3300025922 Bacteria 17827
138 Ga0207646_10029777 3300025922 Archaea 4957
139 Ga0207646_10083565 3300025922 Bacteria 2856
140 Ga0207694_10057999 3300025924 Bacteria 3011
141 Ga0207650_10055205 3300025925 Bacteria 2948
142 Ga0207650_10072395 3300025925 Bacteria 2594
143 Ga0207687_10001049 3300025927 Bacteria 18747
144 Ga0207687_10001258 3300025927 Bacteria 17331
145 Ga0207700_10002354 3300025928 Bacteria 10850
146 Ga0207664_10005335 3300025929 Bacteria 8782
147 Ga0207686_10000992 3300025934 Bacteria 16854
148 Ga0207686_10057282 3300025934 Bacteria 2453
149 Ga0207709_10003004 3300025935 Bacteria 10256
150 Ga0207709_10036725 3300025935 Bacteria 2905
151 Ga0207670_10001450 3300025936 Bacteria 12451
152 Ga0207665_10030893 3300025939 Bacteria 3542
153 Ga0207689_10000007 3300025942 Bacteria 132362
154 Ga0207689_10114559 3300025942 Bacteria 2216
155 Ga0207689_10208972 3300025942 Bacteria 1612
156 Ga0207679_10015078 3300025945 Bacteria 5096
157 Ga0207667_10007409 3300025949 Bacteria 13194
158 Ga0207667_10085497 3300025949 Unclassified 3265
159 Ga0207651_10089565 3300025960 Bacteria 2247
160 Ga0207712_10024748 3300025961 Bacteria 3981
161 Ga0207640_10017947 3300025981 Unclassified 4149
162 Ga0207677_10004234 3300026023 Bacteria 7683
163 Ga0207677_10007040 3300026023 Bacteria 6187
164 Ga0207703_10022382 3300026035 Unclassified 4957
165 Ga0207703_10071911 3300026035 Bacteria 2858
166 Ga0207639_10082481 3300026041 Bacteria 2549
167 Ga0207708_10001220 3300026075 Bacteria 19421
168 Ga0207708_10108072 3300026075 Bacteria 2157
169 Ga0207702_10000673 3300026078 Bacteria 37164
170 Ga0207702_10011284 3300026078 Bacteria 7446
171 Ga0207702_10046538 3300026078 Bacteria 3653
172 Ga0207648_10000135 3300026089 Bacteria 73544
173 Ga0207648_10195757 3300026089 Bacteria 1792
174 Ga0207676_10186306 3300026095 Bacteria 1822
175 Ga0207674_10000025 3300026116 Bacteria 152434
176 Ga0207674_10011315 3300026116 Bacteria 10028
177 Ga0207675_100000825 3300026118 Bacteria 30861
178 Ga0207683_10051756 3300026121 Unclassified 3598
179 Ga0207698_10147905 3300026142 Bacteria 2034
180 Ga0207428_10000265 3300027907 Bacteria 70984
181 Ga0268266_10002786 3300028379 Bacteria 18236
182 Ga0268266_10114337 3300028379 Unclassified 2395
183 Ga0268265_10014985 3300028380 Bacteria 5293
184 Ga0268264_10001495 3300028381 Bacteria 21802
185 Ga0265314_10001651 3300031711 Bacteria 24405
186 Ga0307416_100213995 3300032002 Bacteria 1841
187 Ga0373926_0004490 3300035083 Bacteria 4578
188 Ga0373934_0055780 3300035086 Bacteria 1571
189 Ga0373945_0018305 3300035116 Bacteria 2382
190 Ga0373954_0001441 3300035118 Bacteria 9662
191 Ga0373954_0069177 3300035118 Bacteria 1676
192 Ga0373946_0006424 3300035171 Bacteria 4261
193 Ga0373942_0007031 3300035207 Bacteria 2600
194 Ga0373961_0008441 3300035241 Bacteria 2504
195 Ga0373931_0000804 3300035691 Bacteria 13123
196 Ga0373927_0000827 3300035695 Bacteria 23687
197 Ga0373933_0010448 3300035724 Bacteria 5090
198 Ga0395898_0011116 3300037466 Bacteria 9372
199 Ga0395905_0229627 3300037471 Bacteria 1735
200 Ga0395901_0057795 3300038443 Bacteria 4034
201 Ga0400483_032669 3300039062 Bacteria 15614
202 Ga0400483_150837 3300039062 Bacteria 3002
203 Ga0436363_1429931 3300039450 Bacteria 3153
204 Ga0466959_0046875 3300045049 Bacteria 3181
205 Ga0451576_0066134 3300045051 Bacteria 3763
206 Ga0495617_025291 3300046452 Bacteria 2002
207 Ga0495603_0045916 3300046455 Bacteria 2604
208 Ga0495603_0064139 3300046455 Bacteria 2166
209 Ga0495638_0042320 3300046460 Bacteria 2878
210 Ga0495580_0138933 3300046472 Bacteria 1684
211 Ga0495610_0056302 3300046512 Bacteria 1891
212 Ga0495643_0028908 3300046522 Bacteria 3104
213 Ga0495666_0100921 3300046526 Bacteria 1360
214 Ga0495668_0100144 3300046616 Bacteria 1585
215 Ga0495668_0161828 3300046616 Bacteria 1226
216 Ga0495588_0021785 3300046674 Bacteria 3162
217 Ga0495676_0124385 3300047321 Bacteria 1871
218 Ga0496100_0011051 3300048903 Bacteria 5123
219 Ga0496101_0004492 3300048904 Bacteria 8795
220 Ga0496101_0063466 3300048904 Bacteria 2689
221 Ga0496102_0016712 3300048905 Bacteria 6417
222 Ga0496103_0087379 3300048906 Bacteria 1965
223 Ga0496104_0003862 3300048907 Bacteria 12962
224 Ga0496105_0247200 3300048908 Bacteria 1446
225 Ga0496106_0017644 3300048909 Bacteria 5279
226 Ga0496107_0004001 3300048910 Bacteria 9925
227 Ga0496108_0001257 3300048911 Bacteria 19827
228 Ga0496110_0015982 3300048913 Bacteria 6258
229 Ga0496110_0136005 3300048913 Bacteria 2221
230 Ga0496111_0001771 3300048914 Bacteria 12662
231 Ga0496112_0003550 3300048915 Bacteria 12954
232 Ga0496113_0001083 3300048916 Bacteria 14762
233 Ga0496114_0047686 3300048917 Bacteria 3563
234 Ga0501034_0003984 3300049571 Bacteria 16594
235 Ga0501034_0128892 3300049571 Bacteria 2514
236 Ga0501036_0127777 3300049572 Bacteria 2146
237 Ga0501042_0128987 3300049578 Bacteria 1822
238 Ga0501043_0038403 3300049579 Bacteria 3765
239 Ga0501070_0000060 3300049586 Bacteria 93388
240 Ga0501071_0048271 3300049587 Bacteria 3061
241 Ga0501075_0124856 3300049591 Bacteria 1959
242 Ga0501077_0104562 3300049593 Bacteria 1794
243 Ga0501044_0146866 3300049823 Bacteria 2343
244 nmdc:mga00v17_39746_c1 3300050491 Bacteria 2818
245 nmdc:mga0yw44_37319_c1 3300050492 Bacteria 2869
246 nmdc:mga05p37_834_c1 3300050507 Bacteria 34530
247 nmdc:mga09592_8386_c1 3300050508 Bacteria 8400
248 nmdc:mga0qj67_70897_c1 3300050509 Bacteria 2781
249 nmdc:mga06r32_64778_c1 3300050510 Bacteria 3525
250 nmdc:mga08y16_251250_c1 3300050511 Bacteria 1827
251 nmdc:mga08y16_645_c1 3300050511 Bacteria 32765
252 nmdc:mga0n895_1503_c1 3300050512 Bacteria 17494
253 nmdc:mga0n895_196998_c1 3300050512 Bacteria 2046
254 nmdc:mga0rr50_162102_c1 3300050513 Bacteria 1816
255 nmdc:mga0rr50_17094_c1 3300050513 Bacteria 4833
256 nmdc:mga08x19_30432_c1 3300050514 Bacteria 3391
257 nmdc:mga0a205_16778_c1 3300050515 Bacteria 6858
258 nmdc:mga0a205_86019_c1 3300050515 Bacteria 3036
259 nmdc:mga0sz30_10131_c1 3300050516 Bacteria 3605
260 Ga0500620_051505 3300053155 Bacteria 1381
261 Ga0501084_0107560 3300054114 Bacteria 2343
262 Ga0501082_0055631 3300060353 Bacteria 3408
263 Ga0501082_0312897 3300060353 Bacteria 1368
264 Ga0530510_0005674 3300061734 Bacteria 8652
265 Ga0530510_0115486 3300061734 Bacteria 1968
266 Ga0530510_0146562 3300061734 Bacteria 1741
267 2514418325 2513237305 Bacteria 7293571
268 2673167617 2671180531 Bacteria 9045424
269 2723577149 2721755686 Bacteria 7343952
270 2792750811 2791355123 Bacteria 8049106
271 2816506965 2816332139 Bacteria 9138787
272 2831431258 2831426010 Bacteria 8662725
273 2848701694 2848694841 Bacteria 9205737
274 2849661045 2849660919 Bacteria 8251853
275 2856349853 2856349417 Bacteria 6230045
276 2856356820 2856356410 Bacteria 6297484
277 2871489412 2871488783 Bacteria 6929816
278 2874169665 2874168670 Bacteria 8062617
279 2878753946 2878753008 Bacteria 6922523
280 2881156867 2881155292 Bacteria 6461656
281 2881846047 2881845957 Bacteria 6611900
282 2881854987 2881853255 Bacteria 6698367
283 2881861898 2881861095 Bacteria 7128710
284 2882914754 2882912400 Bacteria 6801539
285 2885321741 2885318864 Bacteria 6729568
286 2885345820 2885342637 Bacteria 7011821
287 2885354919 2885350715 Bacteria 6787678
288 2886632346 2886627955 Bacteria 7618130
289 2903497291 2903492973 Bacteria 13473544
290 2913914914 2913912277 Bacteria 9037797
291 2924766299 2924762789 Bacteria 6561353
292 2924791801 2924784321 Bacteria 7416538
293 2937823373 2937822353 Bacteria 7290551
294 2961129210 2961127735 Bacteria 7196641
295 2961171447 2961170736 Bacteria 7072258
296 2967996478 2967996073 Bacteria 6787468
297 2968004710 2968003550 Bacteria 6929263
298 2970504175 2970503327 Bacteria 7099517
299 2977823164 2977821940 Bacteria 6906439
300 2977832838 2977828996 Bacteria 7007971
301 2979808811 2979808191 Bacteria 7179355
302 2987670776 2987666974 Bacteria 6509233
303 8004375520 8004374579 Bacteria 6898112
304 Ga0265325_10047639
305 Ga0058863_10082335
306 Ga0058862_10077091
307 Ga0058862_12851697
308 Ga0065712_10115421
309 Ga0068869_100000600
310 Ga0068869_100095839
311 Ga0070680_100000089
312 Ga0070682_100043815
313 Ga0068868_100009011
314 Ga0068868_100028556
315 Ga0068868_100070315
316 Ga0070660_100026007
317 Ga0070689_100170990
318 Ga0070691_10001497
319 Ga0070691_10026091
320 Ga0070687_100020139
321 Ga0070661_100204385
322 Ga0070692_10004537
323 Ga0070692_10046453
324 Ga0070659_100054985
325 Ga0070714_100009851
326 Ga0070713_100000687
327 Ga0070701_10000224
328 Ga0070705_100000867
329 Ga0070700_100120552
330 Ga0070708_100000758
331 Ga0070681_10020500
332 Ga0070706_100004482
333 Ga0070706_100251836
334 Ga0070707_100002287
335 Ga0070707_100002688
336 Ga0070707_100053041
337 Ga0070698_100022755
338 Ga0070698_100081290
339 Ga0070698_100093602
340 Ga0070698_100096341
341 Ga0070699_100123283
342 Ga0070679_100001678
343 Ga0070679_100028655
344 Ga0070684_100047844
345 Ga0070697_100029791
346 Ga0070697_100052172
347 Ga0070697_100134226
348 Ga0070697_100137656
349 Ga0070686_100109150
350 Ga0070696_100000958
351 Ga0070665_100002982
352 Ga0070665_100143733
353 Ga0070704_100024781
354 Ga0068855_100011440
355 Ga0070664_100010230
356 Ga0068857_100000443
357 Ga0068857_100004525
358 Ga0068856_100000254
359 Ga0068856_100027169
360 Ga0070702_100078879
361 Ga0068859_100107297
362 Ga0068864_100183569
363 Ga0068866_10000950
364 Ga0068858_100023846
365 Ga0068858_100030682
366 Ga0068860_100040323
367 Ga0081538_10003557
368 Ga0070717_10035795
369 Ga0070717_10058347
370 Ga0070717_10216875
371 Ga0075365_10025007
372 Ga0075364_10033258
373 Ga0075369_10009747
374 Ga0097621_100044946
375 Ga0075428_100005195
376 Ga0075428_100032865
377 Ga0075428_100085223
378 Ga0075430_100125718
379 Ga0075433_10001586
380 Ga0075434_100000643
381 Ga0075434_100116388
382 Ga0075429_100000103
383 Ga0075436_100008789
384 Ga0097620_100107303
385 Ga0075435_100003906
386 Ga0075435_100073052
387 Ga0114129_10001184
388 Ga0114129_10033762
389 Ga0105243_10025965
390 Ga0105238_10065307
391 Ga0105249_10000917
392 Ga0105246_10001825
393 Ga0105246_10032309
394 Ga0157369_10064182
395 Ga0157378_10075149
396 Ga0163162_10121343
397 Ga0163163_10213398
398 Ga0157377_10041542
399 Ga0157379_10040034
400 Ga0157376_10024001
401 Ga0157376_10080483
402 Ga0197907_11483924
403 Ga0206356_10304196
404 Ga0206349_1060555
405 Ga0206349_1960679
406 Ga0206355_1246510
407 Ga0206351_10033705
408 Ga0206352_10288816
409 Ga0206352_11338295
410 Ga0206350_10259274
411 Ga0206350_10345055
412 Ga0206350_10798553
413 Ga0206350_10948445
414 Ga0154015_1338429
415 Ga0213874_10000141
416 Ga0213874_10004754
417 Ga0224712_10012045
418 Ga0224712_10014368
419 Ga0224712_10017534
420 Ga0224712_10031484
421 Ga0224712_10038713
422 Ga0224712_10046536
423 Ga0207697_10027870
424 Ga0207692_10008354
425 Ga0207642_10003001
426 Ga0207688_10003082
427 Ga0207688_10063086
428 Ga0207645_10122780
429 Ga0207705_10088747
430 Ga0207684_10042147
431 Ga0207684_10064605
432 Ga0207684_10168111
433 Ga0207707_10034865
434 Ga0207660_10007958
435 Ga0207662_10000215
436 Ga0207657_10003935
437 Ga0207652_10004840
438 Ga0207652_10045768
439 Ga0207646_10002364
440 Ga0207646_10003460
441 Ga0207646_10029777
442 Ga0207646_10083565
443 Ga0207694_10057999
444 Ga0207650_10055205
445 Ga0207650_10072395
446 Ga0207687_10001049
447 Ga0207687_10001258
448 Ga0207700_10002354
449 Ga0207664_10005335
450 Ga0207686_10000992
451 Ga0207686_10057282
452 Ga0207709_10003004
453 Ga0207709_10036725
454 Ga0207670_10001450
455 Ga0207665_10030893
456 Ga0207689_10000007
457 Ga0207689_10114559
458 Ga0207689_10208972
459 Ga0207679_10015078
460 Ga0207667_10007409
461 Ga0207667_10085497
462 Ga0207651_10089565
463 Ga0207712_10024748
464 Ga0207640_10017947
465 Ga0207677_10004234
466 Ga0207677_10007040
467 Ga0207703_10022382
468 Ga0207703_10071911
469 Ga0207639_10082481
470 Ga0207708_10001220
471 Ga0207708_10108072
472 Ga0207702_10000673
473 Ga0207702_10011284
474 Ga0207702_10046538
475 Ga0207648_10000135
476 Ga0207648_10195757
477 Ga0207676_10186306
478 Ga0207674_10000025
479 Ga0207674_10011315
480 Ga0207675_100000825
481 Ga0207683_10051756
482 Ga0207698_10147905
483 Ga0207428_10000265
484 Ga0268266_10002786
485 Ga0268266_10114337
486 Ga0268265_10014985
487 Ga0268264_10001495
488 Ga0265314_10001651
489 Ga0307416_100213995
490 Ga0373926_0004490
491 Ga0373934_0055780
492 Ga0373945_0018305
493 Ga0373954_0001441
494 Ga0373954_0069177
495 Ga0373946_0006424
496 Ga0373942_0007031
497 Ga0373961_0008441
498 Ga0373931_0000804
499 Ga0373927_0000827
500 Ga0373933_0010448
501 Ga0395898_0011116
502 Ga0395905_0229627
503 Ga0395901_0057795
504 Ga0400483_032669
505 Ga0400483_150837
506 Ga0436363_1429931
507 Ga0466959_0046875
508 Ga0451576_0066134
509 Ga0495617_025291
510 Ga0495603_0045916
511 Ga0495603_0064139
512 Ga0495638_0042320
513 Ga0495580_0138933
514 Ga0495610_0056302
515 Ga0495643_0028908
516 Ga0495666_0100921
517 Ga0495668_0100144
518 Ga0495668_0161828
519 Ga0495588_0021785
520 Ga0495676_0124385
521 Ga0496100_0011051
522 Ga0496101_0004492
523 Ga0496101_0063466
524 Ga0496102_0016712
525 Ga0496103_0087379
526 Ga0496104_0003862
527 Ga0496105_0247200
528 Ga0496106_0017644
529 Ga0496107_0004001
530 Ga0496108_0001257
531 Ga0496110_0015982
532 Ga0496110_0136005
533 Ga0496111_0001771
534 Ga0496112_0003550
535 Ga0496113_0001083
536 Ga0496114_0047686
537 Ga0501034_0003984
538 Ga0501034_0128892
539 Ga0501036_0127777
540 Ga0501042_0128987
541 Ga0501043_0038403
542 Ga0501070_0000060
543 Ga0501071_0048271
544 Ga0501075_0124856
545 Ga0501077_0104562
546 Ga0501044_0146866
547 nmdc:mga00v17_39746_c1
548 nmdc:mga0yw44_37319_c1
549 nmdc:mga05p37_834_c1
550 nmdc:mga09592_8386_c1
551 nmdc:mga0qj67_70897_c1
552 nmdc:mga06r32_64778_c1
553 nmdc:mga08y16_251250_c1
554 nmdc:mga08y16_645_c1
555 nmdc:mga0n895_1503_c1
556 nmdc:mga0n895_196998_c1
557 nmdc:mga0rr50_162102_c1
558 nmdc:mga0rr50_17094_c1
559 nmdc:mga08x19_30432_c1
560 nmdc:mga0a205_16778_c1
561 nmdc:mga0a205_86019_c1
562 nmdc:mga0sz30_10131_c1
563 Ga0500620_051505
564 Ga0501084_0107560
565 Ga0501082_0055631
566 Ga0501082_0312897
567 Ga0530510_0005674
568 Ga0530510_0115486
569 Ga0530510_0146562
570 2514418325
571 2673167617
572 2723577149
573 2792750811
574 2816506965
575 2831431258
576 2848701694
577 2849661045
578 2856349853
579 2856356820
580 2871489412
581 2874169665
582 2878753946
583 2881156867
584 2881846047
585 2881854987
586 2881861898
587 2882914754
588 2885321741
589 2885345820
590 2885354919
591 2886632346
592 2903497291
593 2913914914
594 2924766299
595 2924791801
596 2937823373
597 2961129210
598 2961171447
599 2967996478
600 2968004710
601 2970504175
602 2977823164
603 2977832838
604 2979808811
605 2987670776
606 8004375520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05694

SBP56

56kDa selenium binding protein (SBP56)

36

485

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ece-assembly1.cif.gz_A x-ray structure of hypothetical selenium-binding protein from sulfolobus tokodaii, st0059 0.9511 14 454
2ece-assembly1.cif.gz_A x-ray structure of hypothetical selenium-binding protein from sulfolobus tokodaii, st0059 0.9222 14 454
5m89-assembly1.cif.gz_A spliceosome component 0.7956 73 422
1l0q-assembly3.cif.gz_C tandem yvtn beta-propeller and pkd domains from an archaeal surface layer protein 0.7861 30 419
7peq-assembly1.cif.gz_AI model of the outer rings of the human nuclear pore complex 0.7831 22 383
ID Description Score Start End Superfamily
af_Q8RZW7_110_449_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9807 104 421 2.130.10.10
af_Q21950_81_542_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9347 22 454 2.130.10.10
af_Q6PHD9_6_457_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9295 8 454 2.130.10.10
af_Q6PHD9_6_457_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9173 8 454 2.130.10.10
af_Q8RZW7_110_449_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9153 104 421 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1Z4I6N9-F1-model_v4 Methanethiol oxidase (EC 1.8.3.4) 0.9948 5 454 GO:0008430
GO:0018549
AF-A0A3C1B588-F1-model_v4 Methanethiol oxidase (EC 1.8.3.4) 0.9939 188 454 GO:0008430
GO:0018549
AF-A0A0R2TN60-F1-model_v4 Selenium-binding protein 0.9926 9 454 GO:0008430
AF-A0A1Z4I6N9-F1-model_v4 Methanethiol oxidase (EC 1.8.3.4) 0.9926 5 454 GO:0008430
GO:0018549
AF-A0A3E0N3A0-F1-model_v4 Selenium-binding protein 0.9922 11 454 GO:0008430

Map