F397095

General Info

Members Datasets Scaffolds Average Seq Length
303 148 607 140

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10220814|Ga0265338_102208143
Length 144
Sequence MAVTKVSSTVHFVARRPAVSGRGGAASGHWVPNTDVYTTDTGLVVKVELPGMKSENLEITVDEGSRLRIRGNRPDCCRAAKCSFLVMEISYGPFESEIELPDGFDLSKAKAIYVNGFLRVDVPAASQPHFKTTKVPVAGDDNRA

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
75 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
76 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
79 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
80 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
87 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
88 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
104 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
113 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
114 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
119 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
131 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
146 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 2.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 0.33
Rhizosphere 98.02
Stem 0
Stem Tuber 0
Unclassified 41.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10220814 3300028800 Bacteria 1416
2 rootH2_10312934 3300003320 Unclassified 1222
3 rootH1_10006053 3300003316 Bacteria 5708
4 rootH1_10006053 3300003323 Bacteria 2711
5 Ga0058861_11948312 3300004800 Bacteria 643
6 Ga0058860_11677904 3300004801 Unclassified 513
7 Ga0058860_12065078 3300004801 Unclassified 707
8 Ga0058862_12669388 3300004803 Unclassified 719
9 Ga0070690_100002269 3300005330 Bacteria 10300
10 Ga0070690_101082981 3300005330 Unclassified 635
11 Ga0070670_101341961 3300005331 Unclassified 655
12 Ga0068869_100064865 3300005334 Bacteria 2687
13 Ga0070680_100892450 3300005336 Unclassified 767
14 Ga0070689_100043994 3300005340 Bacteria 3434
15 Ga0070689_100076160 3300005340 Bacteria 2628
16 Ga0070689_100836156 3300005340 Unclassified 811
17 Ga0070691_10940078 3300005341 Unclassified 536
18 Ga0070687_100236142 3300005343 Unclassified 1128
19 Ga0070675_100488546 3300005354 Bacteria 1108
20 Ga0070713_102312484 3300005436 Unclassified 520
21 Ga0070711_100426773 3300005439 Unclassified 1081
22 Ga0070711_101664146 3300005439 Unclassified 559
23 Ga0070681_10120082 3300005458 Bacteria 2564
24 Ga0070681_11567971 3300005458 Unclassified 584
25 Ga0070685_10891982 3300005466 Unclassified 661
26 Ga0068853_100203409 3300005539 Bacteria 1803
27 Ga0070686_100395037 3300005544 Unclassified 1050
28 Ga0068855_100066923 3300005563 Bacteria 4188
29 Ga0068855_100067268 3300005563 Unclassified 4175
30 Ga0068855_100343140 3300005563 Bacteria 1646
31 Ga0068857_100004877 3300005577 Bacteria 11383
32 Ga0068857_100338397 3300005577 Bacteria 1392
33 Ga0068856_100228615 3300005614 Bacteria 1875
34 Ga0068856_100964834 3300005614 Unclassified 871
35 Ga0068856_101586602 3300005614 Unclassified 668
36 Ga0068859_100014752 3300005617 Bacteria 7851
37 Ga0068859_102169916 3300005617 Unclassified 613
38 Ga0068864_100018402 3300005618 Bacteria 5837
39 Ga0068864_101651466 3300005618 Unclassified 645
40 Ga0068863_100307570 3300005841 Bacteria 1538
41 Ga0068858_100097939 3300005842 Bacteria 2734
42 Ga0075430_101269094 3300006846 Unclassified 606
43 Ga0075434_100294058 3300006871 Bacteria 1644
44 Ga0075434_100341133 3300006871 Unclassified 1519
45 Ga0075434_100893852 3300006871 Unclassified 903
46 Ga0097620_100014752 3300006931 Bacteria 7851
47 Ga0097620_102168966 3300006931 Unclassified 613
48 Ga0099794_10229289 3300007265 Unclassified 955
49 Ga0099795_10482801 3300007788 Unclassified 575
50 Ga0105240_10016892 3300009093 Bacteria 9864
51 Ga0105240_10201216 3300009093 Unclassified 2334
52 Ga0105240_10694988 3300009093 Unclassified 1111
53 Ga0105245_12229430 3300009098 Unclassified 601
54 Ga0105245_13105421 3300009098 Unclassified 515
55 Ga0105241_10605089 3300009174 Unclassified 990
56 Ga0105242_10305922 3300009176 Unclassified 1453
57 Ga0105237_11195014 3300009545 Unclassified 767
58 Ga0105238_10025464 3300009551 Bacteria 6031
59 Ga0105238_10352770 3300009551 Bacteria 1460
60 Ga0099796_10289350 3300010159 Unclassified 691
61 Ga0105239_10934744 3300010375 Unclassified 996
62 Ga0105239_12356892 3300010375 Unclassified 620
63 Ga0157373_10410600 3300013100 Unclassified 971
64 Ga0157371_10718406 3300013102 Unclassified 749
65 Ga0157369_10652317 3300013105 Bacteria 1085
66 Ga0157374_10105418 3300013296 Bacteria 2707
67 Ga0157374_10323427 3300013296 Bacteria 1529
68 Ga0157374_10479077 3300013296 Bacteria 1248
69 Ga0157378_11656907 3300013297 Bacteria 686
70 Ga0157378_11774883 3300013297 Unclassified 665
71 Ga0157378_11973068 3300013297 Unclassified 633
72 Ga0157372_11134616 3300013307 Unclassified 904
73 Ga0157375_10109491 3300013308 Bacteria 2859
74 Ga0163163_12757791 3300014325 Unclassified 548
75 Ga0157377_11129084 3300014745 Unclassified 602
76 Ga0157377_11324472 3300014745 Unclassified 564
77 Ga0157379_10223732 3300014968 Unclassified 1705
78 Ga0157379_11842925 3300014968 Unclassified 595
79 Ga0157376_11639417 3300014969 Unclassified 678
80 Ga0157376_11639864 3300014969 Unclassified 678
81 Ga0206356_11415624 3300020070 Unclassified 815
82 Ga0206356_11778494 3300020070 Bacteria 1163
83 Ga0224712_10154975 3300022467 Unclassified 1018
84 Ga0207707_10079375 3300025912 Bacteria 2866
85 Ga0207695_10078265 3300025913 Bacteria 3355
86 Ga0207695_10097361 3300025913 Bacteria 2943
87 Ga0207663_10017930 3300025916 Bacteria 3955
88 Ga0207663_10301992 3300025916 Unclassified 1196
89 Ga0207694_10020188 3300025924 Bacteria 5040
90 Ga0207694_10047187 3300025924 Bacteria 3331
91 Ga0207650_11567020 3300025925 Unclassified 559
92 Ga0207700_10270472 3300025928 Bacteria 1458
93 Ga0207644_10328568 3300025931 Bacteria 1238
94 Ga0207670_10016652 3300025936 Bacteria 4424
95 Ga0207670_10087668 3300025936 Bacteria 2193
96 Ga0207691_10665101 3300025940 Unclassified 879
97 Ga0207661_10778008 3300025944 Unclassified 881
98 Ga0207661_11077430 3300025944 Unclassified 740
99 Ga0207667_10076826 3300025949 Bacteria 3465
100 Ga0207667_10185694 3300025949 Bacteria 2134
101 Ga0207667_10221253 3300025949 Unclassified 1940
102 Ga0207667_10241277 3300025949 Bacteria 1849
103 Ga0207667_10352812 3300025949 Bacteria 1500
104 Ga0207640_10797157 3300025981 Unclassified 818
105 Ga0207677_10865158 3300026023 Unclassified 813
106 Ga0207703_10077711 3300026035 Bacteria 2756
107 Ga0207702_10107008 3300026078 Unclassified 2479
108 Ga0207702_10479581 3300026078 Bacteria 1210
109 Ga0207702_11492687 3300026078 Unclassified 669
110 Ga0207641_10168736 3300026088 Bacteria 1996
111 Ga0207641_10234293 3300026088 Bacteria 1708
112 Ga0207676_10469637 3300026095 Bacteria 1189
113 Ga0207674_10004014 3300026116 Bacteria 17870
114 Ga0207674_10207696 3300026116 Bacteria 1907
115 Ga0209588_1275102 3300027671 Unclassified 510
116 Ga0265337_1000035 3300028556 Bacteria 58448
117 Ga0265337_1000699 3300028556 Bacteria 17732
118 Ga0265337_1027961 3300028556 Bacteria 1696
119 Ga0265337_1050764 3300028556 Unclassified 1169
120 Ga0265326_10056030 3300028558 Bacteria 1115
121 Ga0265326_10068577 3300028558 Unclassified 1003
122 Ga0265319_1000007 3300028563 Bacteria 217194
123 Ga0265319_1082068 3300028563 Unclassified 1023
124 Ga0265319_1122019 3300028563 Unclassified 812
125 Ga0265319_1130442 3300028563 Unclassified 781
126 Ga0265319_1130988 3300028563 Bacteria 780
127 Ga0265319_1226678 3300028563 Unclassified 571
128 Ga0265334_10039685 3300028573 Bacteria 1847
129 Ga0265318_10023872 3300028577 Unclassified 2433
130 Ga0265318_10079797 3300028577 Bacteria 1209
131 Ga0265318_10187969 3300028577 Unclassified 756
132 Ga0265323_10000147 3300028653 Bacteria 41074
133 Ga0265323_10018853 3300028653 Bacteria 2666
134 Ga0265323_10131095 3300028653 Bacteria 811
135 Ga0265322_10024410 3300028654 Bacteria 1729
136 Ga0265322_10044267 3300028654 Unclassified 1268
137 Ga0265322_10085985 3300028654 Unclassified 893
138 Ga0265336_10000776 3300028666 Bacteria 16918
139 Ga0265338_10000138 3300028800 Bacteria 135457
140 Ga0265338_10000282 3300028800 Bacteria 91694
141 Ga0265338_10002629 3300028800 Bacteria 26496
142 Ga0265338_10003122 3300028800 Bacteria 23683
143 Ga0265338_10005911 3300028800 Bacteria 15772
144 Ga0265338_10008493 3300028800 Bacteria 12457
145 Ga0265338_10011605 3300028800 Bacteria 10154
146 Ga0265338_10012715 3300028800 Bacteria 9575
147 Ga0265338_10013727 3300028800 Bacteria 9109
148 Ga0265338_10023924 3300028800 Bacteria 6259
149 Ga0265338_10037876 3300028800 Bacteria 4579
150 Ga0265338_10038144 3300028800 Bacteria 4558
151 Ga0265338_10064382 3300028800 Bacteria 3189
152 Ga0265338_10101494 3300028800 Bacteria 2342
153 Ga0265338_10207105 3300028800 Bacteria 1475
154 Ga0265338_10584140 3300028800 Unclassified 779
155 Ga0265338_10585355 3300028800 Unclassified 778
156 Ga0265338_10733157 3300028800 Unclassified 680
157 Ga0265324_10000455 3300029957 Bacteria 28816
158 Ga0265324_10006701 3300029957 Bacteria 4760
159 Ga0265324_10019213 3300029957 Bacteria 2463
160 Ga0265324_10149188 3300029957 Bacteria 794
161 Ga0265324_10205603 3300029957 Unclassified 668
162 Ga0265324_10243697 3300029957 Unclassified 610
163 Ga0265777_108579 3300030877 Bacteria 728
164 Ga0265760_10114542 3300031090 Unclassified 861
165 Ga0265330_10314264 3300031235 Unclassified 661
166 Ga0265332_10102127 3300031238 Bacteria 1209
167 Ga0265332_10175147 3300031238 Bacteria 895
168 Ga0265320_10000893 3300031240 Bacteria 22450
169 Ga0265320_10006530 3300031240 Bacteria 7342
170 Ga0265320_10052105 3300031240 Bacteria 1983
171 Ga0265320_10058860 3300031240 Bacteria 1838
172 Ga0265320_10107032 3300031240 Unclassified 1284
173 Ga0265320_10141167 3300031240 Unclassified 1091
174 Ga0265320_10216369 3300031240 Unclassified 854
175 Ga0265325_10006155 3300031241 Bacteria 7321
176 Ga0265340_10000224 3300031247 Bacteria 28844
177 Ga0265340_10044400 3300031247 Unclassified 2174
178 Ga0265340_10086547 3300031247 Unclassified 1470
179 Ga0265340_10130609 3300031247 Unclassified 1152
180 Ga0265340_10196359 3300031247 Bacteria 908
181 Ga0265339_10260484 3300031249 Bacteria 837
182 Ga0265339_10269719 3300031249 Unclassified 818
183 Ga0265331_10285485 3300031250 Unclassified 739
184 Ga0265327_10000215 3300031251 Bacteria 119243
185 Ga0265316_10004569 3300031344 Bacteria 13743
186 Ga0265316_10017786 3300031344 Bacteria 6127
187 Ga0265316_10062765 3300031344 Bacteria 2883
188 Ga0265316_10090898 3300031344 Bacteria 2329
189 Ga0265316_10251472 3300031344 Bacteria 1298
190 Ga0265316_10419216 3300031344 Unclassified 963
191 Ga0265316_10690699 3300031344 Unclassified 720
192 Ga0265313_10005765 3300031595 Bacteria 9009
193 Ga0265313_10010617 3300031595 Bacteria 5800
194 Ga0265313_10121184 3300031595 Bacteria 1141
195 Ga0265314_10012008 3300031711 Bacteria 7102
196 Ga0265314_10066722 3300031711 Unclassified 2426
197 Ga0265342_10015188 3300031712 Bacteria 5075
198 Ga0265342_10043146 3300031712 Bacteria 2723
199 Ga0265342_10070918 3300031712 Bacteria 2031
200 Ga0265342_10369349 3300031712 Unclassified 745
201 Ga0373939_0105155 3300035114 Unclassified 975
202 Ga0373945_0039559 3300035116 Unclassified 1700
203 Ga0373953_0036734 3300035117 Bacteria 1931
204 Ga0373953_0497358 3300035117 Unclassified 540
205 Ga0373954_0016348 3300035118 Bacteria 3320
206 Ga0373956_0021055 3300035119 Bacteria 2779
207 Ga0373943_0451240 3300035170 Unclassified 747
208 Ga0373946_0014183 3300035171 Bacteria 3003
209 Ga0373955_0034546 3300035172 Bacteria 2672
210 Ga0373931_0029429 3300035691 Unclassified 2820
211 Ga0373931_1178652 3300035691 Unclassified 524
212 Ga0373935_0006031 3300035692 Bacteria 7199
213 Ga0373935_0947407 3300035692 Unclassified 639
214 Ga0373927_0002826 3300035695 Bacteria 12663
215 Ga0373927_0003832 3300035695 Bacteria 10680
216 Ga0373927_0477436 3300035695 Unclassified 824
217 Ga0373933_0140001 3300035724 Unclassified 1527
218 Ga0373947_0002100 3300035725 Bacteria 12145
219 Ga0373947_0454303 3300035725 Unclassified 868
220 Ga0373937_0003432 3300036401 Bacteria 13302
221 Ga0373937_0951342 3300036401 Unclassified 808
222 Ga0373925_0002801 3300037068 Bacteria 13766
223 Ga0373925_0008833 3300037068 Bacteria 7341
224 Ga0373925_0445635 3300037068 Bacteria 1060
225 Ga0373925_0561290 3300037068 Unclassified 939
226 Ga0451577_0063907 3300042876 Bacteria 3282
227 Ga0451577_0534257 3300042876 Bacteria 1065
228 Ga0451577_1333190 3300042876 Unclassified 638
229 Ga0451577_1458403 3300042876 Unclassified 606
230 Ga0453684_0002261 3300044712 Bacteria 47581
231 Ga0453684_0002665 3300044712 Bacteria 42549
232 Ga0453684_0020899 3300044712 Bacteria 9823
233 Ga0451576_0022136 3300045051 Bacteria 6896
234 Ga0451576_0036226 3300045051 Bacteria 5232
235 Ga0451576_0059036 3300045051 Bacteria 4006
236 Ga0451576_0079906 3300045051 Bacteria 3403
237 Ga0451576_0141370 3300045051 Bacteria 2510
238 Ga0451576_0161203 3300045051 Bacteria 2341
239 Ga0451576_0191889 3300045051 Bacteria 2134
240 Ga0451576_0439576 3300045051 Bacteria 1369
241 Ga0451576_0646504 3300045051 Bacteria 1111
242 Ga0451576_2140962 3300045051 Unclassified 575
243 Ga0495641_0052461 3300046461 Bacteria 1859
244 Ga0495651_0406332 3300046462 Unclassified 888
245 Ga0495662_0165592 3300046476 Unclassified 1089
246 Ga0495594_0526459 3300046499 Unclassified 671
247 Ga0495618_0004810 3300046514 Bacteria 8249
248 Ga0495628_0238121 3300046516 Bacteria 1362
249 Ga0495630_0000192 3300046517 Bacteria 47913
250 Ga0495630_0059642 3300046517 Bacteria 2863
251 Ga0495630_0060642 3300046517 Bacteria 2840
252 Ga0495630_0114988 3300046517 Bacteria 2039
253 Ga0495630_0266891 3300046517 Unclassified 1308
254 Ga0495666_0170783 3300046526 Unclassified 1006
255 Ga0495666_0403748 3300046526 Bacteria 614
256 Ga0495652_0188949 3300046529 Bacteria 1574
257 Ga0495640_0026718 3300046533 Bacteria 4167
258 Ga0495640_0294816 3300046533 Unclassified 1008
259 Ga0495586_0000115 3300046535 Bacteria 47977
260 Ga0495586_0006510 3300046535 Bacteria 6237
261 Ga0495586_0165411 3300046535 Bacteria 1249
262 Ga0495586_0255161 3300046535 Unclassified 1001
263 Ga0495587_0225783 3300046536 Unclassified 1056
264 Ga0495645_0058924 3300046543 Bacteria 2785
265 Ga0495645_0241689 3300046543 Bacteria 1204
266 Ga0495667_0020401 3300046559 Bacteria 4473
267 Ga0495667_0258827 3300046559 Bacteria 1107
268 Ga0495667_0371968 3300046559 Bacteria 902
269 Ga0495667_0434462 3300046559 Unclassified 826
270 Ga0495667_0546012 3300046559 Unclassified 724
271 Ga0495634_0000669 3300046642 Bacteria 33295
272 Ga0495634_0094261 3300046642 Bacteria 1940
273 Ga0495635_0223325 3300046663 Bacteria 1274
274 Ga0495599_0582215 3300046678 Unclassified 653
275 Ga0495599_0868818 3300046678 Bacteria 512
276 Ga0495647_0035531 3300046681 Bacteria 1872
277 Ga0495647_0039189 3300046681 Bacteria 1795
278 Ga0495658_0001939 3300046683 Bacteria 10581
279 Ga0495613_0012721 3300046689 Bacteria 6257
280 Ga0495613_0031885 3300046689 Bacteria 3914
281 Ga0495624_0085213 3300046690 Unclassified 1952
282 Ga0495624_0124865 3300046690 Bacteria 1580
283 Ga0495624_0712899 3300046690 Unclassified 595
284 Ga0495600_0076162 3300046809 Bacteria 2191
285 Ga0495600_0244010 3300046809 Bacteria 1144
286 Ga0495581_0335740 3300047315 Unclassified 882
287 Ga0495581_0578665 3300047315 Unclassified 651
288 Ga0495674_0007208 3300047319 Bacteria 10634
289 Ga0495674_0495280 3300047319 Bacteria 978
290 Ga0495676_0039408 3300047321 Bacteria 3913
291 Ga0495680_0043040 3300047322 Bacteria 3579
292 Ga0495680_0296246 3300047322 Bacteria 1137
293 Ga0495684_0118782 3300047471 Bacteria 1992
294 Ga0496115_0001109 3300048918 Bacteria 19444
295 Ga0501033_0060052 3300049570 Bacteria 2806
296 Ga0501034_0513312 3300049571 Unclassified 1111
297 Ga0501034_0514734 3300049571 Bacteria 1109
298 nmdc:mga0qj67_918282_c1 3300050509 Unclassified 689
299 nmdc:mga0n895_289684_c1 3300050512 Bacteria 1660
300 nmdc:mga0n895_500665_c1 3300050512 Unclassified 1224
301 nmdc:mga0n895_833286_c1 3300050512 Unclassified 911
302 nmdc:mga0rr50_168752_c1 3300050513 Unclassified 1781
303 Ga0495601_0033149 3300053077 Bacteria 3217
304 Ga0500650_0062443 3300053098 Bacteria 1740
305 Ga0265338_10220814
306 rootH2_10312934
307 rootH1_10006053
308 Ga0058861_11948312
309 Ga0058860_11677904
310 Ga0058860_12065078
311 Ga0058862_12669388
312 Ga0070690_100002269
313 Ga0070690_101082981
314 Ga0070670_101341961
315 Ga0068869_100064865
316 Ga0070680_100892450
317 Ga0070689_100043994
318 Ga0070689_100076160
319 Ga0070689_100836156
320 Ga0070691_10940078
321 Ga0070687_100236142
322 Ga0070675_100488546
323 Ga0070713_102312484
324 Ga0070711_100426773
325 Ga0070711_101664146
326 Ga0070681_10120082
327 Ga0070681_11567971
328 Ga0070685_10891982
329 Ga0068853_100203409
330 Ga0070686_100395037
331 Ga0068855_100066923
332 Ga0068855_100067268
333 Ga0068855_100343140
334 Ga0068857_100004877
335 Ga0068857_100338397
336 Ga0068856_100228615
337 Ga0068856_100964834
338 Ga0068856_101586602
339 Ga0068859_100014752
340 Ga0068859_102169916
341 Ga0068864_100018402
342 Ga0068864_101651466
343 Ga0068863_100307570
344 Ga0068858_100097939
345 Ga0075430_101269094
346 Ga0075434_100294058
347 Ga0075434_100341133
348 Ga0075434_100893852
349 Ga0097620_100014752
350 Ga0097620_102168966
351 Ga0099794_10229289
352 Ga0099795_10482801
353 Ga0105240_10016892
354 Ga0105240_10201216
355 Ga0105240_10694988
356 Ga0105245_12229430
357 Ga0105245_13105421
358 Ga0105241_10605089
359 Ga0105242_10305922
360 Ga0105237_11195014
361 Ga0105238_10025464
362 Ga0105238_10352770
363 Ga0099796_10289350
364 Ga0105239_10934744
365 Ga0105239_12356892
366 Ga0157373_10410600
367 Ga0157371_10718406
368 Ga0157369_10652317
369 Ga0157374_10105418
370 Ga0157374_10323427
371 Ga0157374_10479077
372 Ga0157378_11656907
373 Ga0157378_11774883
374 Ga0157378_11973068
375 Ga0157372_11134616
376 Ga0157375_10109491
377 Ga0163163_12757791
378 Ga0157377_11129084
379 Ga0157377_11324472
380 Ga0157379_10223732
381 Ga0157379_11842925
382 Ga0157376_11639417
383 Ga0157376_11639864
384 Ga0206356_11415624
385 Ga0206356_11778494
386 Ga0224712_10154975
387 Ga0207707_10079375
388 Ga0207695_10078265
389 Ga0207695_10097361
390 Ga0207663_10017930
391 Ga0207663_10301992
392 Ga0207694_10020188
393 Ga0207694_10047187
394 Ga0207650_11567020
395 Ga0207700_10270472
396 Ga0207644_10328568
397 Ga0207670_10016652
398 Ga0207670_10087668
399 Ga0207691_10665101
400 Ga0207661_10778008
401 Ga0207661_11077430
402 Ga0207667_10076826
403 Ga0207667_10185694
404 Ga0207667_10221253
405 Ga0207667_10241277
406 Ga0207667_10352812
407 Ga0207640_10797157
408 Ga0207677_10865158
409 Ga0207703_10077711
410 Ga0207702_10107008
411 Ga0207702_10479581
412 Ga0207702_11492687
413 Ga0207641_10168736
414 Ga0207641_10234293
415 Ga0207676_10469637
416 Ga0207674_10004014
417 Ga0207674_10207696
418 Ga0209588_1275102
419 Ga0265337_1000035
420 Ga0265337_1000699
421 Ga0265337_1027961
422 Ga0265337_1050764
423 Ga0265326_10056030
424 Ga0265326_10068577
425 Ga0265319_1000007
426 Ga0265319_1082068
427 Ga0265319_1122019
428 Ga0265319_1130442
429 Ga0265319_1130988
430 Ga0265319_1226678
431 Ga0265334_10039685
432 Ga0265318_10023872
433 Ga0265318_10079797
434 Ga0265318_10187969
435 Ga0265323_10000147
436 Ga0265323_10018853
437 Ga0265323_10131095
438 Ga0265322_10024410
439 Ga0265322_10044267
440 Ga0265322_10085985
441 Ga0265336_10000776
442 Ga0265338_10000138
443 Ga0265338_10000282
444 Ga0265338_10002629
445 Ga0265338_10003122
446 Ga0265338_10005911
447 Ga0265338_10008493
448 Ga0265338_10011605
449 Ga0265338_10012715
450 Ga0265338_10013727
451 Ga0265338_10023924
452 Ga0265338_10037876
453 Ga0265338_10038144
454 Ga0265338_10064382
455 Ga0265338_10101494
456 Ga0265338_10207105
457 Ga0265338_10584140
458 Ga0265338_10585355
459 Ga0265338_10733157
460 Ga0265324_10000455
461 Ga0265324_10006701
462 Ga0265324_10019213
463 Ga0265324_10149188
464 Ga0265324_10205603
465 Ga0265324_10243697
466 Ga0265777_108579
467 Ga0265760_10114542
468 Ga0265330_10314264
469 Ga0265332_10102127
470 Ga0265332_10175147
471 Ga0265320_10000893
472 Ga0265320_10006530
473 Ga0265320_10052105
474 Ga0265320_10058860
475 Ga0265320_10107032
476 Ga0265320_10141167
477 Ga0265320_10216369
478 Ga0265325_10006155
479 Ga0265340_10000224
480 Ga0265340_10044400
481 Ga0265340_10086547
482 Ga0265340_10130609
483 Ga0265340_10196359
484 Ga0265339_10260484
485 Ga0265339_10269719
486 Ga0265331_10285485
487 Ga0265327_10000215
488 Ga0265316_10004569
489 Ga0265316_10017786
490 Ga0265316_10062765
491 Ga0265316_10090898
492 Ga0265316_10251472
493 Ga0265316_10419216
494 Ga0265316_10690699
495 Ga0265313_10005765
496 Ga0265313_10010617
497 Ga0265313_10121184
498 Ga0265314_10012008
499 Ga0265314_10066722
500 Ga0265342_10015188
501 Ga0265342_10043146
502 Ga0265342_10070918
503 Ga0265342_10369349
504 Ga0373939_0105155
505 Ga0373945_0039559
506 Ga0373953_0036734
507 Ga0373953_0497358
508 Ga0373954_0016348
509 Ga0373956_0021055
510 Ga0373943_0451240
511 Ga0373946_0014183
512 Ga0373955_0034546
513 Ga0373931_0029429
514 Ga0373931_1178652
515 Ga0373935_0006031
516 Ga0373935_0947407
517 Ga0373927_0002826
518 Ga0373927_0003832
519 Ga0373927_0477436
520 Ga0373933_0140001
521 Ga0373947_0002100
522 Ga0373947_0454303
523 Ga0373937_0003432
524 Ga0373937_0951342
525 Ga0373925_0002801
526 Ga0373925_0008833
527 Ga0373925_0445635
528 Ga0373925_0561290
529 Ga0451577_0063907
530 Ga0451577_0534257
531 Ga0451577_1333190
532 Ga0451577_1458403
533 Ga0453684_0002261
534 Ga0453684_0002665
535 Ga0453684_0020899
536 Ga0451576_0022136
537 Ga0451576_0036226
538 Ga0451576_0059036
539 Ga0451576_0079906
540 Ga0451576_0141370
541 Ga0451576_0161203
542 Ga0451576_0191889
543 Ga0451576_0439576
544 Ga0451576_0646504
545 Ga0451576_2140962
546 Ga0495641_0052461
547 Ga0495651_0406332
548 Ga0495662_0165592
549 Ga0495594_0526459
550 Ga0495618_0004810
551 Ga0495628_0238121
552 Ga0495630_0000192
553 Ga0495630_0059642
554 Ga0495630_0060642
555 Ga0495630_0114988
556 Ga0495630_0266891
557 Ga0495666_0170783
558 Ga0495666_0403748
559 Ga0495652_0188949
560 Ga0495640_0026718
561 Ga0495640_0294816
562 Ga0495586_0000115
563 Ga0495586_0006510
564 Ga0495586_0165411
565 Ga0495586_0255161
566 Ga0495587_0225783
567 Ga0495645_0058924
568 Ga0495645_0241689
569 Ga0495667_0020401
570 Ga0495667_0258827
571 Ga0495667_0371968
572 Ga0495667_0434462
573 Ga0495667_0546012
574 Ga0495634_0000669
575 Ga0495634_0094261
576 Ga0495635_0223325
577 Ga0495599_0582215
578 Ga0495599_0868818
579 Ga0495647_0035531
580 Ga0495647_0039189
581 Ga0495658_0001939
582 Ga0495613_0012721
583 Ga0495613_0031885
584 Ga0495624_0085213
585 Ga0495624_0124865
586 Ga0495624_0712899
587 Ga0495600_0076162
588 Ga0495600_0244010
589 Ga0495581_0335740
590 Ga0495581_0578665
591 Ga0495674_0007208
592 Ga0495674_0495280
593 Ga0495676_0039408
594 Ga0495680_0043040
595 Ga0495680_0296246
596 Ga0495684_0118782
597 Ga0496115_0001109
598 Ga0501033_0060052
599 Ga0501034_0513312
600 Ga0501034_0514734
601 nmdc:mga0qj67_918282_c1
602 nmdc:mga0n895_289684_c1
603 nmdc:mga0n895_500665_c1
604 nmdc:mga0n895_833286_c1
605 nmdc:mga0rr50_168752_c1
606 Ga0495601_0033149
607 Ga0500650_0062443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

35

138

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3guf-assembly1.cif.gz_B crystal structure of the hspa from xanthomonas axonopodis 0.8834 27 121
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.8746 27 120
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.873 29 120
5zul-assembly1.cif.gz_A-2 small heat shock protein from mycobacterium marinum m : form-3 0.8715 27 120
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8601 31 120
ID Description Score Start End Superfamily
3glaB00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8978 27 123 2.60.40.790
af_Q208N7_181_285_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8934 27 122 2.60.40.790
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8895 26 125 2.60.40.790
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8796 27 121 2.60.40.790
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.873 29 120 2.60.40.790
ID Description Score Start End GO Terms
AF-Q22NE9-F1-model_v4 50S ribosome-binding GTPase 0.9125 23 127 GO:0005525
AF-A0A3M1NFY1-F1-model_v4 Hsp20/alpha crystallin family protein 0.9044 27 122
AF-A0A7V1JEQ8-F1-model_v4 Hsp20/alpha crystallin family protein 0.9019 27 120
AF-D2XIV5-F1-model_v4 Alpha-crystallin-type small heat shock protein 0.8999 27 117
AF-A0A6B3GKL8-F1-model_v4 Hsp20/alpha crystallin family protein 0.8888 28 111

Map