F396930

General Info

Members Datasets Scaffolds Average Seq Length
303 172 606 330

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10116515|Ga0081538_101165152
Length 375
Sequence MAVDDTASRRLATTRLRPGANGAPAAPIALPAPRGATTEALLAALREPPHRLPPIALPEAPDPLADEDLQLALYCCYELHYRGLPGVDERWEWSPSLLALRAALEQRFEAALRRAVNAVGPPPPAGEMDVALRAIEDADDGPSLSGYVERDATLTQVLEFLVHRSAYQLKEADPHSWAIPRLSGPPKAALVEIQADEYGGGRPERVHAQLFADAMEAAGLDPRYGAYVDVLPAATLATVNLMSLCGLHRRLRGAIVGHLALFEMTSSIPNRRYASGLRRLGLEAATPFFDEHVEADAVHEAIAAVDLAGGLVRQQPDLCGDVLWGARALVELDARWAAHLLGAWEEGRSSLRTSRPWTCWGASHEEIGERIEQRR

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
93 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
94 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
95 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
99 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
103 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
112 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
113 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
114 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
120 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
121 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
126 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
127 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
154 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
159 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
160 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
163 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
164 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 16.5
Rhizosphere 80.86
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10116515 3300005981 Bacteria 1296
2 Ga0070683_100000855 3300005329 Bacteria 22514
3 Ga0070683_100003217 3300005329 Bacteria 13185
4 Ga0070680_100175017 3300005336 Bacteria 1807
5 Ga0070682_100010387 3300005337 Bacteria 5283
6 Ga0070682_100084055 3300005337 Bacteria 2067
7 Ga0070682_100235765 3300005337 Bacteria 1311
8 Ga0068868_100002823 3300005338 Bacteria 12032
9 Ga0070660_100000900 3300005339 Bacteria 19874
10 Ga0070687_100072215 3300005343 Bacteria 1857
11 Ga0070692_10010569 3300005345 Bacteria 4209
12 Ga0070692_10193028 3300005345 Bacteria 1188
13 Ga0070669_100076985 3300005353 Bacteria 2477
14 Ga0070669_100158629 3300005353 Bacteria 1756
15 Ga0070675_100238454 3300005354 Bacteria 1588
16 Ga0070688_100046271 3300005365 Bacteria 2693
17 Ga0070659_100020010 3300005366 Bacteria 5081
18 Ga0070659_100056922 3300005366 Bacteria 3082
19 Ga0070710_10189345 3300005437 Bacteria 1293
20 Ga0070705_100025754 3300005440 Bacteria 3192
21 Ga0070694_100050111 3300005444 Bacteria 2814
22 Ga0070678_100195802 3300005456 Bacteria 1664
23 Ga0070662_100014711 3300005457 Bacteria 5230
24 Ga0070681_10008971 3300005458 Bacteria 9833
25 Ga0070681_10140973 3300005458 Bacteria 2340
26 Ga0070681_10417583 3300005458 Bacteria 1253
27 Ga0068867_100094589 3300005459 Bacteria 2272
28 Ga0070684_100001691 3300005535 Bacteria 16050
29 Ga0070684_100038115 3300005535 Bacteria 4128
30 Ga0070695_100009471 3300005545 Bacteria 5801
31 Ga0070696_100041811 3300005546 Bacteria 3168
32 Ga0070696_100187817 3300005546 Bacteria 1537
33 Ga0070693_100016637 3300005547 Bacteria 3810
34 Ga0070693_100040503 3300005547 Bacteria 2615
35 Ga0070704_100013520 3300005549 Bacteria 5067
36 Ga0068855_100001724 3300005563 Bacteria 27331
37 Ga0068855_100064894 3300005563 Bacteria 4258
38 Ga0070664_100257797 3300005564 Bacteria 1569
39 Ga0068857_100009291 3300005577 Bacteria 8531
40 Ga0068856_100161266 3300005614 Bacteria 2253
41 Ga0070702_100161738 3300005615 Bacteria 1448
42 Ga0068870_10038300 3300005840 Bacteria 2475
43 Ga0068860_100003168 3300005843 Bacteria 16980
44 Ga0068860_100083463 3300005843 Bacteria 3039
45 Ga0081538_10009339 3300005981 Bacteria 8199
46 Ga0081538_10033297 3300005981 Bacteria 3433
47 Ga0070717_10000017 3300006028 Bacteria 205340
48 Ga0075365_10026497 3300006038 Bacteria 3681
49 Ga0075428_100266733 3300006844 Bacteria 1843
50 Ga0075433_10146640 3300006852 Bacteria 2098
51 Ga0075434_100000028 3300006871 Bacteria 65415
52 Ga0075434_100022318 3300006871 Bacteria 6166
53 Ga0075434_100136365 3300006871 Bacteria 2473
54 Ga0075434_100211148 3300006871 Unclassified 1961
55 Ga0075436_100028141 3300006914 Bacteria 3867
56 Ga0075436_100062110 3300006914 Bacteria 2582
57 Ga0075435_100000531 3300007076 Bacteria 23339
58 Ga0075435_100000694 3300007076 Bacteria 20903
59 Ga0075435_100086891 3300007076 Bacteria 2576
60 Ga0105240_10208053 3300009093 Bacteria 2288
61 Ga0105240_10316277 3300009093 Bacteria 1781
62 Ga0111539_10003548 3300009094 Bacteria 20566
63 Ga0111539_10351614 3300009094 Bacteria 1715
64 Ga0105245_10001393 3300009098 Bacteria 21901
65 Ga0105245_10052190 3300009098 Bacteria 3667
66 Ga0105245_10056970 3300009098 Bacteria 3514
67 Ga0105245_10109848 3300009098 Bacteria 2563
68 Ga0105241_10016398 3300009174 Bacteria 5433
69 Ga0105242_10164028 3300009176 Bacteria 1947
70 Ga0105238_10006844 3300009551 Bacteria 11382
71 Ga0105238_10043288 3300009551 Bacteria 4556
72 Ga0105238_10049603 3300009551 Bacteria 4226
73 Ga0105249_10593258 3300009553 Bacteria 1162
74 Ga0105239_10010700 3300010375 Bacteria 10251
75 Ga0105239_10459857 3300010375 Bacteria 1444
76 Ga0105246_10000355 3300011119 Bacteria 24648
77 Ga0105246_10063595 3300011119 Bacteria 2574
78 Ga0105246_10081790 3300011119 Bacteria 2303
79 Ga0157369_10022511 3300013105 Bacteria 7029
80 Ga0157369_10229883 3300013105 Bacteria 1939
81 Ga0157369_10484965 3300013105 Bacteria 1279
82 Ga0157374_10000856 3300013296 Bacteria 26627
83 Ga0157378_10008013 3300013297 Bacteria 9222
84 Ga0157378_10109355 3300013297 Bacteria 2532
85 Ga0163162_10133046 3300013306 Bacteria 2597
86 Ga0157372_10011745 3300013307 Bacteria 9326
87 Ga0157372_10208811 3300013307 Bacteria 2263
88 Ga0157375_10021087 3300013308 Bacteria 5968
89 Ga0157375_10177458 3300013308 Bacteria 2281
90 Ga0163163_10007683 3300014325 Bacteria 9527
91 Ga0157380_10290563 3300014326 Bacteria 1501
92 Ga0157376_10160205 3300014969 Bacteria 2039
93 Ga0206356_10673044 3300020070 Bacteria 1688
94 Ga0206356_11641727 3300020070 Bacteria 2676
95 Ga0206354_10937821 3300020081 Bacteria 2092
96 Ga0213876_10001709 3300021384 Bacteria 13342
97 Ga0207426_1053473 3300025302 Bacteria 1192
98 Ga0207692_10056317 3300025898 Bacteria 2016
99 Ga0207688_10014914 3300025901 Bacteria 4216
100 Ga0207707_10056385 3300025912 Bacteria 3418
101 Ga0207707_10092219 3300025912 Bacteria 2647
102 Ga0207695_10065493 3300025913 Bacteria 3736
103 Ga0207663_10127471 3300025916 Bacteria 1753
104 Ga0207660_10170090 3300025917 Bacteria 1686
105 Ga0207657_10001487 3300025919 Bacteria 25086
106 Ga0207657_10230198 3300025919 Bacteria 1482
107 Ga0207649_10159234 3300025920 Bacteria 1563
108 Ga0207694_10023937 3300025924 Bacteria 4638
109 Ga0207659_10061540 3300025926 Bacteria 2706
110 Ga0207687_10000244 3300025927 Bacteria 36941
111 Ga0207687_10017972 3300025927 Bacteria 4665
112 Ga0207687_10074490 3300025927 Bacteria 2433
113 Ga0207700_10229820 3300025928 Bacteria 1576
114 Ga0207644_10286781 3300025931 Bacteria 1323
115 Ga0207690_10006263 3300025932 Bacteria 7047
116 Ga0207690_10063302 3300025932 Bacteria 2521
117 Ga0207706_10026675 3300025933 Bacteria 5171
118 Ga0207709_10310987 3300025935 Bacteria 1175
119 Ga0207661_10003352 3300025944 Bacteria 11118
120 Ga0207667_10003262 3300025949 Bacteria 20028
121 Ga0207667_10574340 3300025949 Bacteria 1139
122 Ga0207640_10145020 3300025981 Bacteria 1736
123 Ga0207677_10006129 3300026023 Bacteria 6567
124 Ga0207677_10012390 3300026023 Bacteria 4899
125 Ga0207639_10331441 3300026041 Bacteria 1354
126 Ga0207708_10028525 3300026075 Bacteria 4227
127 Ga0207702_10154730 3300026078 Bacteria 2089
128 Ga0207702_10399598 3300026078 Bacteria 1325
129 Ga0207648_10159716 3300026089 Bacteria 1991
130 Ga0207428_10061785 3300027907 Bacteria 2964
131 Ga0268264_10007906 3300028381 Bacteria 8848
132 Ga0265338_10001078 3300028800 Bacteria 45253
133 Ga0265338_10116029 3300028800 Bacteria 2146
134 Ga0265325_10002173 3300031241 Bacteria 13365
135 Ga0265339_10003815 3300031249 Bacteria 10476
136 Ga0265316_10088845 3300031344 Bacteria 2359
137 Ga0265313_10001304 3300031595 Bacteria 23526
138 Ga0316579_10022391 3300031691 Bacteria 2826
139 Ga0265314_10030134 3300031711 Bacteria 4021
140 Ga0316576_10005188 3300031727 Bacteria 7917
141 Ga0316578_10003475 3300031728 Bacteria 7216
142 Ga0307410_10312468 3300031852 Bacteria 1244
143 Ga0307406_10022951 3300031901 Bacteria 3707
144 Ga0307406_10229757 3300031901 Bacteria 1385
145 Ga0307407_10005059 3300031903 Bacteria 5685
146 Ga0307407_10148286 3300031903 Bacteria 1521
147 Ga0307407_10285753 3300031903 Bacteria 1144
148 Ga0307412_10032928 3300031911 Bacteria 3289
149 Ga0307409_100005063 3300031995 Bacteria 7514
150 Ga0307409_100044756 3300031995 Bacteria 3336
151 Ga0307416_100491306 3300032002 Bacteria 1290
152 Ga0307415_100272275 3300032126 Bacteria 1388
153 Ga0316574_0009404 3300035398 Bacteria 5475
154 Ga0316574_0201209 3300035398 Bacteria 1279
155 Ga0316582_0082877 3300036647 Bacteria 2097
156 Ga0316584_0008804 3300036712 Bacteria 6972
157 Ga0316584_0024724 3300036712 Bacteria 4399
158 Ga0395898_0045922 3300037466 Bacteria 4292
159 Ga0395898_0293761 3300037466 Bacteria 1550
160 Ga0436364_1007934 3300037853 Bacteria 1862
161 Ga0395901_0047335 3300038443 Bacteria 4465
162 Ga0436365_0201791 3300039437 Bacteria 8707
163 Ga0436365_0202901 3300039437 Bacteria 32522
164 Ga0436365_1295517 3300039437 Bacteria 7891
165 Ga0451853_1898478 3300041512 Bacteria 1738
166 Ga0439463_017455 3300042016 Bacteria 1780
167 Ga0450902_005651 3300042137 Bacteria 1898
168 Ga0450905_002415 3300042142 Bacteria 2398
169 Ga0466969_0026842 3300044656 Bacteria 2952
170 Ga0466969_0039302 3300044656 Bacteria 2377
171 Ga0466965_0058522 3300044683 Bacteria 1922
172 Ga0466966_0020004 3300044684 Bacteria 4404
173 Ga0466961_0011924 3300044693 Bacteria 5556
174 Ga0466961_0081514 3300044693 Bacteria 2047
175 Ga0466961_0152804 3300044693 Bacteria 1441
176 Ga0466963_0004968 3300044694 Bacteria 7759
177 Ga0466963_0006478 3300044694 Bacteria 6927
178 Ga0466963_0008877 3300044694 Bacteria 6032
179 Ga0466963_0012958 3300044694 Bacteria 5111
180 Ga0466963_0066825 3300044694 Bacteria 2412
181 Ga0466963_0090410 3300044694 Bacteria 2084
182 Ga0466963_0104199 3300044694 Bacteria 1943
183 Ga0466963_0152492 3300044694 Bacteria 1605
184 Ga0466970_0091746 3300044765 Bacteria 1649
185 Ga0466957_0049233 3300044842 Bacteria 2562
186 Ga0466957_0058215 3300044842 Bacteria 2367
187 Ga0466957_0088236 3300044842 Bacteria 1941
188 Ga0466957_0113810 3300044842 Bacteria 1718
189 Ga0466957_0151955 3300044842 Bacteria 1498
190 Ga0466957_0168279 3300044842 Bacteria 1426
191 Ga0466960_0044094 3300044901 Bacteria 2125
192 Ga0466960_0059503 3300044901 Bacteria 1869
193 Ga0466959_0011855 3300045049 Bacteria 6277
194 Ga0466959_0029134 3300045049 Bacteria 4091
195 Ga0466958_0002170 3300045836 Bacteria 9782
196 Ga0466958_0045292 3300045836 Bacteria 2653
197 Ga0466958_0123507 3300045836 Bacteria 1622
198 Ga0466958_0146392 3300045836 Bacteria 1489
199 Ga0466967_0001054 3300045976 Bacteria 15181
200 Ga0466967_0003645 3300045976 Bacteria 10125
201 Ga0466967_0023041 3300045976 Bacteria 5096
202 Ga0466967_0030996 3300045976 Bacteria 4495
203 Ga0466967_0036436 3300045976 Bacteria 4199
204 Ga0466967_0043342 3300045976 Bacteria 3895
205 Ga0466967_0049316 3300045976 Bacteria 3681
206 Ga0466967_0110353 3300045976 Bacteria 2526
207 Ga0466967_0119028 3300045976 Bacteria 2437
208 Ga0466967_0171203 3300045976 Bacteria 2043
209 Ga0466967_0180816 3300045976 Bacteria 1989
210 Ga0466967_0206526 3300045976 Bacteria 1862
211 Ga0466967_0559412 3300045976 Bacteria 1126
212 Ga0466967_0655762 3300045976 Bacteria 1038
213 Ga0495599_0152087 3300046678 Bacteria 1433
214 Ga0495676_0145317 3300047321 Bacteria 1695
215 Ga0495602_0092666 3300048088 Bacteria 2502
216 Ga0496100_0000509 3300048903 Bacteria 18717
217 Ga0496100_0027407 3300048903 Bacteria 3504
218 Ga0496100_0030359 3300048903 Bacteria 3352
219 Ga0496100_0043548 3300048903 Bacteria 2871
220 Ga0496100_0097282 3300048903 Bacteria 2021
221 Ga0496100_0101587 3300048903 Bacteria 1983
222 Ga0496101_0025877 3300048904 Bacteria 4075
223 Ga0496101_0031288 3300048904 Bacteria 3739
224 Ga0496101_0092862 3300048904 Bacteria 2248
225 Ga0496102_0002072 3300048905 Bacteria 17274
226 Ga0496102_0048009 3300048905 Bacteria 3881
227 Ga0496102_0126082 3300048905 Bacteria 2393
228 Ga0496102_0204384 3300048905 Bacteria 1862
229 Ga0496103_0002422 3300048906 Bacteria 11738
230 Ga0496103_0216414 3300048906 Bacteria 1232
231 Ga0496104_0002193 3300048907 Bacteria 16902
232 Ga0496104_0020790 3300048907 Bacteria 6019
233 Ga0496104_0303313 3300048907 Bacteria 1509
234 Ga0496105_0010569 3300048908 Bacteria 7260
235 Ga0496105_0028894 3300048908 Bacteria 4537
236 Ga0496106_0000792 3300048909 Bacteria 22878
237 Ga0496106_0011551 3300048909 Bacteria 6528
238 Ga0496106_0057659 3300048909 Bacteria 2937
239 Ga0496107_0000332 3300048910 Bacteria 25556
240 Ga0496107_0134863 3300048910 Bacteria 1824
241 Ga0496108_0002019 3300048911 Bacteria 16253
242 Ga0496108_0003423 3300048911 Bacteria 12731
243 Ga0496108_0012150 3300048911 Bacteria 7003
244 Ga0496108_0089611 3300048911 Bacteria 2614
245 Ga0496109_0004288 3300048912 Bacteria 11911
246 Ga0496109_0005160 3300048912 Bacteria 10899
247 Ga0496109_0035427 3300048912 Bacteria 4502
248 Ga0496109_0106160 3300048912 Bacteria 2608
249 Ga0496109_0139359 3300048912 Bacteria 2268
250 Ga0496110_0000639 3300048913 Bacteria 24002
251 Ga0496110_0042042 3300048913 Bacteria 3989
252 Ga0496110_0052413 3300048913 Bacteria 3585
253 Ga0496110_0303697 3300048913 Bacteria 1454
254 Ga0496111_0000120 3300048914 Bacteria 34087
255 Ga0496111_0008137 3300048914 Bacteria 6929
256 Ga0496112_0000514 3300048915 Bacteria 26280
257 Ga0496112_0030045 3300048915 Bacteria 5258
258 Ga0496112_0135599 3300048915 Bacteria 2432
259 Ga0496113_0010288 3300048916 Bacteria 6181
260 Ga0496113_0048448 3300048916 Bacteria 3161
261 Ga0496114_0015251 3300048917 Bacteria 6178
262 Ga0496114_0048592 3300048917 Bacteria 3529
263 Ga0496115_0003321 3300048918 Bacteria 11553
264 Ga0496115_0007786 3300048918 Bacteria 7899
265 Ga0496115_0011475 3300048918 Bacteria 6644
266 Ga0501031_0010879 3300049568 Bacteria 5928
267 Ga0501032_0029019 3300049569 Bacteria 3799
268 Ga0501034_0056454 3300049571 Bacteria 3951
269 Ga0501036_0078136 3300049572 Bacteria 2799
270 Ga0501037_0005444 3300049573 Bacteria 9275
271 Ga0501038_0006372 3300049574 Bacteria 10922
272 Ga0501043_0026253 3300049579 Bacteria 4569
273 Ga0501046_0054381 3300049580 Bacteria 3149
274 Ga0501048_0069133 3300049582 Bacteria 2494
275 Ga0501067_0068345 3300049583 Bacteria 1967
276 Ga0501067_0102923 3300049583 Bacteria 1586
277 Ga0501068_0021356 3300049584 Bacteria 3780
278 Ga0501069_0009000 3300049585 Bacteria 5269
279 Ga0501069_0055406 3300049585 Bacteria 2209
280 Ga0501069_0079619 3300049585 Bacteria 1844
281 Ga0501069_0124763 3300049585 Bacteria 1472
282 Ga0501071_0138156 3300049587 Bacteria 1814
283 Ga0501072_0012496 3300049588 Bacteria 6491
284 Ga0501073_0045308 3300049589 Bacteria 3097
285 Ga0501074_0099130 3300049590 Bacteria 2085
286 Ga0501079_0212272 3300049741 Bacteria 1512
287 Ga0501080_0044604 3300049742 Bacteria 4128
288 Ga0501080_0084072 3300049742 Bacteria 2957
289 Ga0501081_0153414 3300049743 Bacteria 1656
290 Ga0501083_0084734 3300049744 Bacteria 2098
291 Ga0501035_0007310 3300049822 Bacteria 10327
292 Ga0501044_0023313 3300049823 Bacteria 6584
293 nmdc:mga08y16_82252_c1 3300050511 Bacteria 3357
294 nmdc:mga0n895_133559_c1 3300050512 Bacteria 2508
295 nmdc:mga0n895_19792_c1 3300050512 Bacteria 6263
296 nmdc:mga0n895_563453_c1 3300050512 Unclassified 1144
297 nmdc:mga0rr50_229598_c1 3300050513 Bacteria 1535
298 nmdc:mga0rr50_57169_c1 3300050513 Bacteria 2917
299 nmdc:mga08x19_14241_c1 3300050514 Bacteria 4821
300 Ga0495612_0001491 3300053078 Bacteria 9648
301 Ga0501082_0150019 3300060353 Bacteria 2024
302 Ga0466962_0020593 3300061719 Bacteria 3168
303 Ga0466962_0021699 3300061719 Bacteria 3082
304 Ga0081538_10116515
305 Ga0070683_100000855
306 Ga0070683_100003217
307 Ga0070680_100175017
308 Ga0070682_100010387
309 Ga0070682_100084055
310 Ga0070682_100235765
311 Ga0068868_100002823
312 Ga0070660_100000900
313 Ga0070687_100072215
314 Ga0070692_10010569
315 Ga0070692_10193028
316 Ga0070669_100076985
317 Ga0070669_100158629
318 Ga0070675_100238454
319 Ga0070688_100046271
320 Ga0070659_100020010
321 Ga0070659_100056922
322 Ga0070710_10189345
323 Ga0070705_100025754
324 Ga0070694_100050111
325 Ga0070678_100195802
326 Ga0070662_100014711
327 Ga0070681_10008971
328 Ga0070681_10140973
329 Ga0070681_10417583
330 Ga0068867_100094589
331 Ga0070684_100001691
332 Ga0070684_100038115
333 Ga0070695_100009471
334 Ga0070696_100041811
335 Ga0070696_100187817
336 Ga0070693_100016637
337 Ga0070693_100040503
338 Ga0070704_100013520
339 Ga0068855_100001724
340 Ga0068855_100064894
341 Ga0070664_100257797
342 Ga0068857_100009291
343 Ga0068856_100161266
344 Ga0070702_100161738
345 Ga0068870_10038300
346 Ga0068860_100003168
347 Ga0068860_100083463
348 Ga0081538_10009339
349 Ga0081538_10033297
350 Ga0070717_10000017
351 Ga0075365_10026497
352 Ga0075428_100266733
353 Ga0075433_10146640
354 Ga0075434_100000028
355 Ga0075434_100022318
356 Ga0075434_100136365
357 Ga0075434_100211148
358 Ga0075436_100028141
359 Ga0075436_100062110
360 Ga0075435_100000531
361 Ga0075435_100000694
362 Ga0075435_100086891
363 Ga0105240_10208053
364 Ga0105240_10316277
365 Ga0111539_10003548
366 Ga0111539_10351614
367 Ga0105245_10001393
368 Ga0105245_10052190
369 Ga0105245_10056970
370 Ga0105245_10109848
371 Ga0105241_10016398
372 Ga0105242_10164028
373 Ga0105238_10006844
374 Ga0105238_10043288
375 Ga0105238_10049603
376 Ga0105249_10593258
377 Ga0105239_10010700
378 Ga0105239_10459857
379 Ga0105246_10000355
380 Ga0105246_10063595
381 Ga0105246_10081790
382 Ga0157369_10022511
383 Ga0157369_10229883
384 Ga0157369_10484965
385 Ga0157374_10000856
386 Ga0157378_10008013
387 Ga0157378_10109355
388 Ga0163162_10133046
389 Ga0157372_10011745
390 Ga0157372_10208811
391 Ga0157375_10021087
392 Ga0157375_10177458
393 Ga0163163_10007683
394 Ga0157380_10290563
395 Ga0157376_10160205
396 Ga0206356_10673044
397 Ga0206356_11641727
398 Ga0206354_10937821
399 Ga0213876_10001709
400 Ga0207426_1053473
401 Ga0207692_10056317
402 Ga0207688_10014914
403 Ga0207707_10056385
404 Ga0207707_10092219
405 Ga0207695_10065493
406 Ga0207663_10127471
407 Ga0207660_10170090
408 Ga0207657_10001487
409 Ga0207657_10230198
410 Ga0207649_10159234
411 Ga0207694_10023937
412 Ga0207659_10061540
413 Ga0207687_10000244
414 Ga0207687_10017972
415 Ga0207687_10074490
416 Ga0207700_10229820
417 Ga0207644_10286781
418 Ga0207690_10006263
419 Ga0207690_10063302
420 Ga0207706_10026675
421 Ga0207709_10310987
422 Ga0207661_10003352
423 Ga0207667_10003262
424 Ga0207667_10574340
425 Ga0207640_10145020
426 Ga0207677_10006129
427 Ga0207677_10012390
428 Ga0207639_10331441
429 Ga0207708_10028525
430 Ga0207702_10154730
431 Ga0207702_10399598
432 Ga0207648_10159716
433 Ga0207428_10061785
434 Ga0268264_10007906
435 Ga0265338_10001078
436 Ga0265338_10116029
437 Ga0265325_10002173
438 Ga0265339_10003815
439 Ga0265316_10088845
440 Ga0265313_10001304
441 Ga0316579_10022391
442 Ga0265314_10030134
443 Ga0316576_10005188
444 Ga0316578_10003475
445 Ga0307410_10312468
446 Ga0307406_10022951
447 Ga0307406_10229757
448 Ga0307407_10005059
449 Ga0307407_10148286
450 Ga0307407_10285753
451 Ga0307412_10032928
452 Ga0307409_100005063
453 Ga0307409_100044756
454 Ga0307416_100491306
455 Ga0307415_100272275
456 Ga0316574_0009404
457 Ga0316574_0201209
458 Ga0316582_0082877
459 Ga0316584_0008804
460 Ga0316584_0024724
461 Ga0395898_0045922
462 Ga0395898_0293761
463 Ga0436364_1007934
464 Ga0395901_0047335
465 Ga0436365_0201791
466 Ga0436365_0202901
467 Ga0436365_1295517
468 Ga0451853_1898478
469 Ga0439463_017455
470 Ga0450902_005651
471 Ga0450905_002415
472 Ga0466969_0026842
473 Ga0466969_0039302
474 Ga0466965_0058522
475 Ga0466966_0020004
476 Ga0466961_0011924
477 Ga0466961_0081514
478 Ga0466961_0152804
479 Ga0466963_0004968
480 Ga0466963_0006478
481 Ga0466963_0008877
482 Ga0466963_0012958
483 Ga0466963_0066825
484 Ga0466963_0090410
485 Ga0466963_0104199
486 Ga0466963_0152492
487 Ga0466970_0091746
488 Ga0466957_0049233
489 Ga0466957_0058215
490 Ga0466957_0088236
491 Ga0466957_0113810
492 Ga0466957_0151955
493 Ga0466957_0168279
494 Ga0466960_0044094
495 Ga0466960_0059503
496 Ga0466959_0011855
497 Ga0466959_0029134
498 Ga0466958_0002170
499 Ga0466958_0045292
500 Ga0466958_0123507
501 Ga0466958_0146392
502 Ga0466967_0001054
503 Ga0466967_0003645
504 Ga0466967_0023041
505 Ga0466967_0030996
506 Ga0466967_0036436
507 Ga0466967_0043342
508 Ga0466967_0049316
509 Ga0466967_0110353
510 Ga0466967_0119028
511 Ga0466967_0171203
512 Ga0466967_0180816
513 Ga0466967_0206526
514 Ga0466967_0559412
515 Ga0466967_0655762
516 Ga0495599_0152087
517 Ga0495676_0145317
518 Ga0495602_0092666
519 Ga0496100_0000509
520 Ga0496100_0027407
521 Ga0496100_0030359
522 Ga0496100_0043548
523 Ga0496100_0097282
524 Ga0496100_0101587
525 Ga0496101_0025877
526 Ga0496101_0031288
527 Ga0496101_0092862
528 Ga0496102_0002072
529 Ga0496102_0048009
530 Ga0496102_0126082
531 Ga0496102_0204384
532 Ga0496103_0002422
533 Ga0496103_0216414
534 Ga0496104_0002193
535 Ga0496104_0020790
536 Ga0496104_0303313
537 Ga0496105_0010569
538 Ga0496105_0028894
539 Ga0496106_0000792
540 Ga0496106_0011551
541 Ga0496106_0057659
542 Ga0496107_0000332
543 Ga0496107_0134863
544 Ga0496108_0002019
545 Ga0496108_0003423
546 Ga0496108_0012150
547 Ga0496108_0089611
548 Ga0496109_0004288
549 Ga0496109_0005160
550 Ga0496109_0035427
551 Ga0496109_0106160
552 Ga0496109_0139359
553 Ga0496110_0000639
554 Ga0496110_0042042
555 Ga0496110_0052413
556 Ga0496110_0303697
557 Ga0496111_0000120
558 Ga0496111_0008137
559 Ga0496112_0000514
560 Ga0496112_0030045
561 Ga0496112_0135599
562 Ga0496113_0010288
563 Ga0496113_0048448
564 Ga0496114_0015251
565 Ga0496114_0048592
566 Ga0496115_0003321
567 Ga0496115_0007786
568 Ga0496115_0011475
569 Ga0501031_0010879
570 Ga0501032_0029019
571 Ga0501034_0056454
572 Ga0501036_0078136
573 Ga0501037_0005444
574 Ga0501038_0006372
575 Ga0501043_0026253
576 Ga0501046_0054381
577 Ga0501048_0069133
578 Ga0501067_0068345
579 Ga0501067_0102923
580 Ga0501068_0021356
581 Ga0501069_0009000
582 Ga0501069_0055406
583 Ga0501069_0079619
584 Ga0501069_0124763
585 Ga0501071_0138156
586 Ga0501072_0012496
587 Ga0501073_0045308
588 Ga0501074_0099130
589 Ga0501079_0212272
590 Ga0501080_0044604
591 Ga0501080_0084072
592 Ga0501081_0153414
593 Ga0501083_0084734
594 Ga0501035_0007310
595 Ga0501044_0023313
596 nmdc:mga08y16_82252_c1
597 nmdc:mga0n895_133559_c1
598 nmdc:mga0n895_19792_c1
599 nmdc:mga0n895_563453_c1
600 nmdc:mga0rr50_229598_c1
601 nmdc:mga0rr50_57169_c1
602 nmdc:mga08x19_14241_c1
603 Ga0495612_0001491
604 Ga0501082_0150019
605 Ga0466962_0020593
606 Ga0466962_0021699

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14518

Haem_oxygenas_2

Iron-containing redox enzyme

158

334

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.8245 110 319
6m9s-assembly1.cif.gz_A crystal structure of semet sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8059 33 325
6vzy-assembly1.cif.gz_A crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.8056 32 325
6xcv-assembly1.cif.gz_A crystal structure of apo sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 0.8049 32 325
1rcw-assembly2.cif.gz_C-2 crystal structure of ct610 from chlamydia trachomatis 0.8 110 319
ID Description Score Start End Superfamily
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8641 98 324 1.20.910.10
3bjdA02 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.8568 98 324 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7933 110 319 1.20.910.10
1rcwC00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.7696 110 319 1.20.910.10
3ibxD00 Mainly Alpha;Up-down Bundle;Heme Oxygenase; Chain A;Heme oxygenase-like 0.6746 105 322 1.20.910.10
ID Description Score Start End GO Terms
AF-A0A7J9XX92-F1-model_v4 Iron-containing redox enzyme family protein 0.9908 125 304
AF-A0A1B1K6T9-F1-model_v4 Iron-containing redox enzyme family protein 0.9888 153 333
AF-A0A2S8MFG0-F1-model_v4 deleted 0.9865 142 335
AF-A0A6G2UQ11-F1-model_v4 Iron-containing redox enzyme family protein 0.9853 130 336
AF-A0A2S8MFG0-F1-model_v4 deleted 0.9815 142 335

Map