F396907
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 182 | 303 | 409 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100152716|Ga0070697_1001527161 |
| Length | 461 |
| Sequence | MRSAKITLSILGILACAAAPGVSAQTTSSNAQGAAQKRIVIAASIVLDGKGDVLHNTHIVVEGSKIVAIDPKVEPVDYDLRNLTVLPGWIDAHAHVTWIFGKDGKNAGQGGTTPDAIYAAASNVWLTLMAGFTTVQSIGSPADIPLRDAIAKGMLPGPRILTSAEPLVGRGAQTGTPDEIRAFIRKQKDAGADVIKIFASQSIRQGGGMTLSQEQLNAACDEAKKLGLRTLVHAYKDAVRAATLAGCTEIEHGTMATDDDLKLMATKGTYLDPQAGLVIENYLLNKEKYLGTPGYTEEGFAAMQRVLSLNHELVQRATKTPGLKVVFGTDAVAGAHGRNAEEFIDRVRDGGVDPMTAMVSANSLGAEALGMSDQIGSIAPGLQADIIALDGDPLKDITAVRRVVFVMKGGVVYKNVSRFHGASVTDGAVAPRARAFLSVNSLLRGGAEDRAELRDGLMPSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 50 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 65 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 66 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 87 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 128 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 133 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 136 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 137 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 138 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 139 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 140 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 141 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 142 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 143 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 144 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 145 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 146 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 147 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 148 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 149 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 156 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 157 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 158 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 159 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 160 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 161 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 162 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 163 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 164 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 165 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 166 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 167 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 168 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 170 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 171 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 172 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 173 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 174 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.67 |
| Metatranscriptomes | 0.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.62 |
| Nodule | 0 |
| Rhizoplane | 1.65 |
| Rhizosphere | 91.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000006 | 3300002074 | Bacteria | 212677 |
| 2 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 3 | JGI25406J46586_10000136 | 3300003203 | Bacteria | 31867 |
| 4 | Ga0065712_10072937 | 3300005290 | Bacteria | 4553 |
| 5 | Ga0065715_10031244 | 3300005293 | Bacteria | 1573 |
| 6 | Ga0065715_10095378 | 3300005293 | Unclassified | 4098 |
| 7 | Ga0065715_10111096 | 3300005293 | Bacteria | 2533 |
| 8 | Ga0065715_10125413 | 3300005293 | Bacteria | 2131 |
| 9 | Ga0070690_100032000 | 3300005330 | Bacteria | 3281 |
| 10 | Ga0070670_100025928 | 3300005331 | Bacteria | 5044 |
| 11 | Ga0068869_100016375 | 3300005334 | Bacteria | 4995 |
| 12 | Ga0070680_100057872 | 3300005336 | Bacteria | 3170 |
| 13 | Ga0070682_100024839 | 3300005337 | Bacteria | 3570 |
| 14 | Ga0070689_100091350 | 3300005340 | Unclassified | 2400 |
| 15 | Ga0070687_100070990 | 3300005343 | Unclassified | 1870 |
| 16 | Ga0070675_100087236 | 3300005354 | Bacteria | 2609 |
| 17 | Ga0070671_100030333 | 3300005355 | Bacteria | 4462 |
| 18 | Ga0070671_100037324 | 3300005355 | Bacteria | 4029 |
| 19 | Ga0070671_100091747 | 3300005355 | Bacteria | 2545 |
| 20 | Ga0070674_100014181 | 3300005356 | Bacteria | 4949 |
| 21 | Ga0070673_100029902 | 3300005364 | Bacteria | 4068 |
| 22 | Ga0070703_10000218 | 3300005406 | Bacteria | 27553 |
| 23 | Ga0070705_100000015 | 3300005440 | Bacteria | 93385 |
| 24 | Ga0070705_100034038 | 3300005440 | Unclassified | 2845 |
| 25 | Ga0070705_100052634 | 3300005440 | Bacteria | 2380 |
| 26 | Ga0070694_100003403 | 3300005444 | Bacteria | 9535 |
| 27 | Ga0070694_100052902 | 3300005444 | Unclassified | 2746 |
| 28 | Ga0070694_100107132 | 3300005444 | Bacteria | 1986 |
| 29 | Ga0070694_100127670 | 3300005444 | Unclassified | 1833 |
| 30 | Ga0070678_100018166 | 3300005456 | Bacteria | 4553 |
| 31 | Ga0070681_10000806 | 3300005458 | Bacteria | 26162 |
| 32 | Ga0070681_10000976 | 3300005458 | Bacteria | 24193 |
| 33 | Ga0070681_10059894 | 3300005458 | Unclassified | 3787 |
| 34 | Ga0068867_100029847 | 3300005459 | Bacteria | 3930 |
| 35 | Ga0068867_100068473 | 3300005459 | Bacteria | 2649 |
| 36 | Ga0070685_10099512 | 3300005466 | Bacteria | 1773 |
| 37 | Ga0070706_100000290 | 3300005467 | Bacteria | 60905 |
| 38 | Ga0070706_100010514 | 3300005467 | Bacteria | 8590 |
| 39 | Ga0070706_100010612 | 3300005467 | Bacteria | 8548 |
| 40 | Ga0070706_100065329 | 3300005467 | Bacteria | 3364 |
| 41 | Ga0070707_100014908 | 3300005468 | Bacteria | 7291 |
| 42 | Ga0070707_100084903 | 3300005468 | Bacteria | 3059 |
| 43 | Ga0070707_100258589 | 3300005468 | Unclassified | 1694 |
| 44 | Ga0070698_100003659 | 3300005471 | Bacteria | 16886 |
| 45 | Ga0070698_100054147 | 3300005471 | Bacteria | 4075 |
| 46 | Ga0070698_100075906 | 3300005471 | Bacteria | 3364 |
| 47 | Ga0070699_100000102 | 3300005518 | Bacteria | 80731 |
| 48 | Ga0070699_100004169 | 3300005518 | Bacteria | 12782 |
| 49 | Ga0070699_100016671 | 3300005518 | Archaea | 6306 |
| 50 | Ga0070699_100042718 | 3300005518 | Bacteria | 3923 |
| 51 | Ga0070699_100088211 | 3300005518 | Unclassified | 2709 |
| 52 | Ga0070679_100000266 | 3300005530 | Bacteria | 43900 |
| 53 | Ga0070697_100002506 | 3300005536 | Bacteria | 14122 |
| 54 | Ga0070697_100040866 | 3300005536 | Bacteria | 3752 |
| 55 | Ga0070697_100048763 | 3300005536 | Bacteria | 3435 |
| 56 | Ga0070697_100152716 | 3300005536 | Unclassified | 1947 |
| 57 | Ga0068853_100241745 | 3300005539 | Bacteria | 1655 |
| 58 | Ga0070672_100052996 | 3300005543 | Bacteria | 3170 |
| 59 | Ga0070686_100008047 | 3300005544 | Bacteria | 5889 |
| 60 | Ga0070695_100028518 | 3300005545 | Bacteria | 3465 |
| 61 | Ga0070696_100000006 | 3300005546 | Bacteria | 109170 |
| 62 | Ga0070696_100011498 | 3300005546 | Bacteria | 5929 |
| 63 | Ga0070696_100039969 | 3300005546 | Unclassified | 3238 |
| 64 | Ga0070696_100050100 | 3300005546 | Bacteria | 2902 |
| 65 | Ga0070693_100005826 | 3300005547 | Bacteria | 5952 |
| 66 | Ga0070693_100115774 | 3300005547 | Bacteria | 1656 |
| 67 | Ga0070704_100186469 | 3300005549 | Bacteria | 1664 |
| 68 | Ga0070664_100061485 | 3300005564 | Bacteria | 3201 |
| 69 | Ga0068854_100045955 | 3300005578 | Bacteria | 3107 |
| 70 | Ga0068856_100006611 | 3300005614 | Bacteria | 11357 |
| 71 | Ga0068859_100007366 | 3300005617 | Bacteria | 11164 |
| 72 | Ga0068859_100008420 | 3300005617 | Bacteria | 10445 |
| 73 | Ga0068859_100009941 | 3300005617 | Bacteria | 9598 |
| 74 | Ga0068859_100099972 | 3300005617 | Bacteria | 2956 |
| 75 | Ga0068864_100017929 | 3300005618 | Bacteria | 5906 |
| 76 | Ga0068866_10010184 | 3300005718 | Bacteria | 4021 |
| 77 | Ga0068861_100190152 | 3300005719 | Bacteria | 1715 |
| 78 | Ga0068863_100089907 | 3300005841 | Bacteria | 2912 |
| 79 | Ga0068863_100124965 | 3300005841 | Bacteria | 2454 |
| 80 | Ga0068858_100000227 | 3300005842 | Bacteria | 60951 |
| 81 | Ga0068858_100063820 | 3300005842 | Bacteria | 3408 |
| 82 | Ga0068858_100105181 | 3300005842 | Unclassified | 2634 |
| 83 | Ga0068858_100155701 | 3300005842 | Bacteria | 2150 |
| 84 | Ga0068860_100023881 | 3300005843 | Bacteria | 5910 |
| 85 | Ga0068860_100024361 | 3300005843 | Bacteria | 5848 |
| 86 | Ga0068860_100095388 | 3300005843 | Bacteria | 2835 |
| 87 | Ga0068860_100121522 | 3300005843 | Bacteria | 2501 |
| 88 | Ga0068860_100218402 | 3300005843 | Unclassified | 1851 |
| 89 | Ga0068862_100089379 | 3300005844 | Bacteria | 2681 |
| 90 | Ga0081539_10000149 | 3300005985 | Bacteria | 161420 |
| 91 | Ga0081539_10000508 | 3300005985 | Bacteria | 80945 |
| 92 | Ga0075368_10018385 | 3300006042 | Bacteria | 2626 |
| 93 | Ga0075364_10002667 | 3300006051 | Bacteria | 10017 |
| 94 | Ga0075364_10004732 | 3300006051 | Bacteria | 7860 |
| 95 | Ga0075364_10010771 | 3300006051 | Bacteria | 5531 |
| 96 | Ga0070715_10000030 | 3300006163 | Bacteria | 88060 |
| 97 | Ga0070716_100000002 | 3300006173 | Bacteria | 396037 |
| 98 | Ga0070716_100001266 | 3300006173 | Bacteria | 11137 |
| 99 | Ga0070716_100073243 | 3300006173 | Bacteria | 2020 |
| 100 | Ga0075367_10005446 | 3300006178 | Bacteria | 6321 |
| 101 | Ga0075366_10026068 | 3300006195 | Bacteria | 3421 |
| 102 | Ga0097621_100005820 | 3300006237 | Bacteria | 8705 |
| 103 | Ga0075370_10005613 | 3300006353 | Bacteria | 6258 |
| 104 | Ga0068871_100010671 | 3300006358 | Bacteria | 6717 |
| 105 | Ga0068871_100037165 | 3300006358 | Bacteria | 3882 |
| 106 | Ga0075428_100291758 | 3300006844 | Bacteria | 1754 |
| 107 | Ga0075431_100308810 | 3300006847 | Bacteria | 1597 |
| 108 | Ga0075433_10078806 | 3300006852 | Bacteria | 2903 |
| 109 | Ga0075433_10149969 | 3300006852 | Bacteria | 2074 |
| 110 | Ga0075433_10157253 | 3300006852 | Unclassified | 2022 |
| 111 | Ga0075434_100037503 | 3300006871 | Bacteria | 4798 |
| 112 | Ga0075434_100170163 | 3300006871 | Unclassified | 2199 |
| 113 | Ga0075434_100171105 | 3300006871 | Unclassified | 2192 |
| 114 | Ga0075436_100000016 | 3300006914 | Bacteria | 167300 |
| 115 | Ga0075436_100014232 | 3300006914 | Bacteria | 5446 |
| 116 | Ga0075436_100055115 | 3300006914 | Unclassified | 2745 |
| 117 | Ga0075436_100070906 | 3300006914 | Bacteria | 2409 |
| 118 | Ga0097620_100007366 | 3300006931 | Bacteria | 11164 |
| 119 | Ga0097620_100008420 | 3300006931 | Bacteria | 10445 |
| 120 | Ga0097620_100009941 | 3300006931 | Bacteria | 9598 |
| 121 | Ga0097620_100099980 | 3300006931 | Bacteria | 2956 |
| 122 | Ga0075435_100000971 | 3300007076 | Bacteria | 18123 |
| 123 | Ga0075435_100057774 | 3300007076 | Bacteria | 3139 |
| 124 | Ga0075435_100086843 | 3300007076 | Unclassified | 2577 |
| 125 | Ga0099794_10034616 | 3300007265 | Unclassified | 2381 |
| 126 | Ga0111539_10038827 | 3300009094 | Bacteria | 5743 |
| 127 | Ga0111539_10073027 | 3300009094 | Bacteria | 4045 |
| 128 | Ga0111539_10115480 | 3300009094 | Bacteria | 3148 |
| 129 | Ga0111539_10159038 | 3300009094 | Bacteria | 2643 |
| 130 | Ga0105245_10186748 | 3300009098 | Bacteria | 1983 |
| 131 | Ga0105245_10246967 | 3300009098 | Unclassified | 1732 |
| 132 | Ga0105245_10298587 | 3300009098 | Bacteria | 1580 |
| 133 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 134 | Ga0114129_10049333 | 3300009147 | Bacteria | 5914 |
| 135 | Ga0114129_10100411 | 3300009147 | Bacteria | 4004 |
| 136 | Ga0114129_10213720 | 3300009147 | Unclassified | 2606 |
| 137 | Ga0105243_10000022 | 3300009148 | Bacteria | 203002 |
| 138 | Ga0105243_10011189 | 3300009148 | Bacteria | 6787 |
| 139 | Ga0105243_10016003 | 3300009148 | Bacteria | 5673 |
| 140 | Ga0105242_10000014 | 3300009176 | Bacteria | 129984 |
| 141 | Ga0105242_10000344 | 3300009176 | Bacteria | 37518 |
| 142 | Ga0105242_10031909 | 3300009176 | Bacteria | 4211 |
| 143 | Ga0105242_10206916 | 3300009176 | Bacteria | 1746 |
| 144 | Ga0105248_10003792 | 3300009177 | Bacteria | 16746 |
| 145 | Ga0105237_10041701 | 3300009545 | Unclassified | 4628 |
| 146 | Ga0105237_10151722 | 3300009545 | Bacteria | 2314 |
| 147 | Ga0105238_10404004 | 3300009551 | Bacteria | 1359 |
| 148 | Ga0105246_10022369 | 3300011119 | Bacteria | 4077 |
| 149 | Ga0157374_10032781 | 3300013296 | Bacteria | 4734 |
| 150 | Ga0157378_10000001 | 3300013297 | Bacteria | 352632 |
| 151 | Ga0157378_10027424 | 3300013297 | Bacteria | 5027 |
| 152 | Ga0157378_10058387 | 3300013297 | Bacteria | 3441 |
| 153 | Ga0163162_10037685 | 3300013306 | Bacteria | 4826 |
| 154 | Ga0163162_10076907 | 3300013306 | Bacteria | 3400 |
| 155 | Ga0163162_10286123 | 3300013306 | Unclassified | 1780 |
| 156 | Ga0157375_10015147 | 3300013308 | Bacteria | 6897 |
| 157 | Ga0157375_10042026 | 3300013308 | Unclassified | 4421 |
| 158 | Ga0163163_10046751 | 3300014325 | Bacteria | 4251 |
| 159 | Ga0163163_10091905 | 3300014325 | Bacteria | 3049 |
| 160 | Ga0163163_10125979 | 3300014325 | Bacteria | 2599 |
| 161 | Ga0157380_10050225 | 3300014326 | Bacteria | 3293 |
| 162 | Ga0157379_10027459 | 3300014968 | Bacteria | 5068 |
| 163 | Ga0157376_10101494 | 3300014969 | Bacteria | 2515 |
| 164 | Ga0163161_10008648 | 3300017792 | Bacteria | 7039 |
| 165 | Ga0163161_10036438 | 3300017792 | Bacteria | 3522 |
| 166 | Ga0213876_10000872 | 3300021384 | Bacteria | 20192 |
| 167 | Ga0213876_10001402 | 3300021384 | Bacteria | 15016 |
| 168 | Ga0228598_1001233 | 3300024227 | Bacteria | 5648 |
| 169 | Ga0207672_1000363 | 3300025223 | Bacteria | 5949 |
| 170 | Ga0207653_10000168 | 3300025885 | Bacteria | 46342 |
| 171 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 172 | Ga0207647_10001597 | 3300025904 | Bacteria | 17404 |
| 173 | Ga0207685_10000009 | 3300025905 | Bacteria | 242842 |
| 174 | Ga0207645_10104808 | 3300025907 | Bacteria | 1826 |
| 175 | Ga0207643_10125624 | 3300025908 | Bacteria | 1523 |
| 176 | Ga0207684_10000073 | 3300025910 | Bacteria | 185361 |
| 177 | Ga0207684_10000236 | 3300025910 | Bacteria | 83977 |
| 178 | Ga0207684_10180040 | 3300025910 | Bacteria | 1822 |
| 179 | Ga0207707_10000050 | 3300025912 | Bacteria | 117404 |
| 180 | Ga0207707_10051926 | 3300025912 | Bacteria | 3570 |
| 181 | Ga0207693_10003406 | 3300025915 | Bacteria | 13576 |
| 182 | Ga0207660_10067357 | 3300025917 | Bacteria | 2593 |
| 183 | Ga0207662_10007945 | 3300025918 | Bacteria | 5779 |
| 184 | Ga0207662_10113520 | 3300025918 | Bacteria | 1692 |
| 185 | Ga0207652_10000537 | 3300025921 | Bacteria | 38510 |
| 186 | Ga0207646_10037882 | 3300025922 | Unclassified | 4346 |
| 187 | Ga0207646_10040588 | 3300025922 | Unclassified | 4185 |
| 188 | Ga0207646_10074391 | 3300025922 | Bacteria | 3035 |
| 189 | Ga0207646_10227570 | 3300025922 | Unclassified | 1685 |
| 190 | Ga0207650_10033563 | 3300025925 | Bacteria | 3718 |
| 191 | Ga0207659_10040918 | 3300025926 | Bacteria | 3244 |
| 192 | Ga0207700_10073351 | 3300025928 | Bacteria | 2643 |
| 193 | Ga0207644_10000249 | 3300025931 | Bacteria | 36628 |
| 194 | Ga0207644_10019146 | 3300025931 | Bacteria | 4641 |
| 195 | Ga0207706_10107815 | 3300025933 | Bacteria | 2451 |
| 196 | Ga0207686_10000002 | 3300025934 | Bacteria | 453961 |
| 197 | Ga0207686_10000160 | 3300025934 | Bacteria | 51361 |
| 198 | Ga0207686_10016982 | 3300025934 | Bacteria | 4092 |
| 199 | Ga0207709_10000012 | 3300025935 | Bacteria | 552803 |
| 200 | Ga0207665_10000007 | 3300025939 | Bacteria | 177869 |
| 201 | Ga0207665_10000849 | 3300025939 | Bacteria | 20648 |
| 202 | Ga0207665_10015983 | 3300025939 | Bacteria | 4928 |
| 203 | Ga0207691_10050457 | 3300025940 | Bacteria | 3809 |
| 204 | Ga0207711_10004950 | 3300025941 | Bacteria | 11309 |
| 205 | Ga0207711_10177030 | 3300025941 | Bacteria | 1938 |
| 206 | Ga0207689_10006392 | 3300025942 | Bacteria | 10431 |
| 207 | Ga0207689_10013724 | 3300025942 | Bacteria | 6904 |
| 208 | Ga0207689_10030277 | 3300025942 | Bacteria | 4511 |
| 209 | Ga0207651_10021036 | 3300025960 | Bacteria | 3954 |
| 210 | Ga0207651_10180362 | 3300025960 | Bacteria | 1675 |
| 211 | Ga0207668_10169055 | 3300025972 | Bacteria | 1713 |
| 212 | Ga0207640_10077332 | 3300025981 | Bacteria | 2262 |
| 213 | Ga0207703_10000101 | 3300026035 | Bacteria | 101290 |
| 214 | Ga0207703_10198120 | 3300026035 | Bacteria | 1783 |
| 215 | Ga0207639_10165586 | 3300026041 | Bacteria | 1867 |
| 216 | Ga0207708_10000126 | 3300026075 | Bacteria | 59505 |
| 217 | Ga0207708_10003751 | 3300026075 | Bacteria | 11198 |
| 218 | Ga0207708_10036909 | 3300026075 | Bacteria | 3722 |
| 219 | Ga0207702_10014559 | 3300026078 | Bacteria | 6526 |
| 220 | Ga0207641_10109565 | 3300026088 | Bacteria | 2446 |
| 221 | Ga0207641_10120674 | 3300026088 | Bacteria | 2339 |
| 222 | Ga0207648_10017199 | 3300026089 | Bacteria | 6589 |
| 223 | Ga0207648_10026192 | 3300026089 | Bacteria | 5184 |
| 224 | Ga0207676_10028220 | 3300026095 | Bacteria | 4190 |
| 225 | Ga0207676_10120936 | 3300026095 | Unclassified | 2208 |
| 226 | Ga0207675_100020793 | 3300026118 | Bacteria | 6118 |
| 227 | Ga0207675_100063401 | 3300026118 | Bacteria | 3453 |
| 228 | Ga0207683_10030250 | 3300026121 | Bacteria | 4691 |
| 229 | Ga0209588_1019602 | 3300027671 | Unclassified | 2112 |
| 230 | Ga0265338_10050546 | 3300028800 | Unclassified | 3757 |
| 231 | Ga0265760_10004684 | 3300031090 | Bacteria | 3915 |
| 232 | Ga0265332_10002097 | 3300031238 | Bacteria | 10350 |
| 233 | Ga0307509_10050694 | 3300031507 | Bacteria | 4443 |
| 234 | Ga0307408_100004179 | 3300031548 | Bacteria | 9841 |
| 235 | Ga0307508_10123821 | 3300031616 | Bacteria | 2188 |
| 236 | Ga0307405_10002374 | 3300031731 | Bacteria | 8290 |
| 237 | Ga0307407_10049965 | 3300031903 | Bacteria | 2390 |
| 238 | Ga0307412_10017334 | 3300031911 | Unclassified | 4310 |
| 239 | Ga0307416_100184482 | 3300032002 | Bacteria | 1959 |
| 240 | Ga0307411_10103303 | 3300032005 | Bacteria | 2021 |
| 241 | Ga0373949_0000024 | 3300035090 | Bacteria | 54168 |
| 242 | Ga0373941_0007630 | 3300035115 | Bacteria | 2654 |
| 243 | Ga0373961_0000008 | 3300035241 | Bacteria | 139095 |
| 244 | Ga0373927_0054398 | 3300035695 | Bacteria | 2589 |
| 245 | Ga0395900_0069364 | 3300037418 | Bacteria | 3623 |
| 246 | Ga0395898_0061343 | 3300037466 | Bacteria | 3653 |
| 247 | Ga0395905_0001435 | 3300037471 | Bacteria | 28680 |
| 248 | Ga0395901_0015369 | 3300038443 | Bacteria | 7791 |
| 249 | Ga0242420_002316 | 3300038996 | Unclassified | 2702 |
| 250 | Ga0436365_0305790 | 3300039437 | Bacteria | 16622 |
| 251 | Ga0436365_1520753 | 3300039437 | Bacteria | 20232 |
| 252 | Ga0451853_1820606 | 3300041512 | Bacteria | 1431 |
| 253 | Ga0439458_0006403 | 3300042157 | Unclassified | 2626 |
| 254 | Ga0466966_0129968 | 3300044684 | Unclassified | 1543 |
| 255 | Ga0466964_0030718 | 3300044706 | Bacteria | 2127 |
| 256 | Ga0466967_0133260 | 3300045976 | Bacteria | 2309 |
| 257 | Ga0495580_0004225 | 3300046472 | Bacteria | 12078 |
| 258 | Ga0495580_0030320 | 3300046472 | Bacteria | 3917 |
| 259 | Ga0495634_0069084 | 3300046642 | Bacteria | 2332 |
| 260 | Ga0495635_0127924 | 3300046663 | Bacteria | 1732 |
| 261 | Ga0495659_0016848 | 3300046664 | Bacteria | 2415 |
| 262 | Ga0496103_0121036 | 3300048906 | Bacteria | 1667 |
| 263 | Ga0496104_0273255 | 3300048907 | Bacteria | 1603 |
| 264 | Ga0496106_0003284 | 3300048909 | Bacteria | 12081 |
| 265 | Ga0496109_0094599 | 3300048912 | Bacteria | 2766 |
| 266 | Ga0496110_0379125 | 3300048913 | Bacteria | 1289 |
| 267 | Ga0501202_001702 | 3300049652 | Bacteria | 3566 |
| 268 | Ga0501207_001284 | 3300049654 | Bacteria | 3112 |
| 269 | Ga0501209_006279 | 3300049656 | Bacteria | 2207 |
| 270 | Ga0501214_001014 | 3300049659 | Bacteria | 2104 |
| 271 | Ga0501216_000538 | 3300049660 | Bacteria | 4548 |
| 272 | Ga0501217_000298 | 3300049661 | Bacteria | 7813 |
| 273 | Ga0501223_004753 | 3300049663 | Bacteria | 2890 |
| 274 | Ga0501227_000880 | 3300049665 | Bacteria | 6571 |
| 275 | Ga0501233_001316 | 3300049668 | Bacteria | 4247 |
| 276 | Ga0501229_001897 | 3300049706 | Bacteria | 2451 |
| 277 | nmdc:mga00v17_104733_c1 | 3300050491 | Bacteria | 1789 |
| 278 | nmdc:mga00v17_66931_c1 | 3300050491 | Bacteria | 2219 |
| 279 | nmdc:mga0yw44_54748_c1 | 3300050492 | Unclassified | 2426 |
| 280 | nmdc:mga0k408_8466_c1 | 3300050493 | Bacteria | 5524 |
| 281 | nmdc:mga06z11_42005_c1 | 3300050494 | Bacteria | 2291 |
| 282 | nmdc:mga07m45_56620_c1 | 3300050496 | Bacteria | 2216 |
| 283 | nmdc:mga05p37_166690_c1 | 3300050507 | Bacteria | 2688 |
| 284 | nmdc:mga06r32_423445_c1 | 3300050510 | Bacteria | 1312 |
| 285 | nmdc:mga08y16_163479_c1 | 3300050511 | Bacteria | 2313 |
| 286 | nmdc:mga08y16_194927_c1 | 3300050511 | Bacteria | 2100 |
| 287 | nmdc:mga08y16_212699_c1 | 3300050511 | Bacteria | 2002 |
| 288 | nmdc:mga08y16_42182_c1 | 3300050511 | Bacteria | 4779 |
| 289 | nmdc:mga0n895_41139_c1 | 3300050512 | Unclassified | 4492 |
| 290 | nmdc:mga0n895_58966_c1 | 3300050512 | Unclassified | 3787 |
| 291 | nmdc:mga0rr50_1734_c1 | 3300050513 | Bacteria | 12032 |
| 292 | nmdc:mga0rr50_440_c1 | 3300050513 | Bacteria | 22331 |
| 293 | nmdc:mga0rr50_86501_c1 | 3300050513 | Unclassified | 2431 |
| 294 | nmdc:mga08x19_107167_c1 | 3300050514 | Bacteria | 1860 |
| 295 | nmdc:mga08x19_10902_c1 | 3300050514 | Bacteria | 5466 |
| 296 | nmdc:mga08x19_21442_c1 | 3300050514 | Unclassified | 3988 |
| 297 | nmdc:mga08x19_8_c1 | 3300050514 | Bacteria | 427794 |
| 298 | nmdc:mga0a205_103624_c1 | 3300050515 | Unclassified | 2744 |
| 299 | nmdc:mga0a205_132033_c1 | 3300050515 | Unclassified | 2398 |
| 300 | nmdc:mga0a205_29616_c1 | 3300050515 | Bacteria | 5240 |
| 301 | nmdc:mga0a205_33954_c1 | 3300050515 | Unclassified | 4893 |
| 302 | nmdc:mga0a205_8494_c1 | 3300050515 | Bacteria | 9341 |
| 303 | Ga0500597_007829 | 3300053120 | Bacteria | 3650 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025925 | Ga0207650_10033563 | Ga0207650_100335632 | 369 |
| 2 | 3300014325 | Ga0163163_10046751 | Ga0163163_100467513 | 371 |
| 3 | 3300005293 | Ga0065715_10125413 | Ga0065715_101254132 | 373 |
| 4 | 3300005440 | Ga0070705_100052634 | Ga0070705_1000526342 | 374 |
| 5 | 3300005843 | Ga0068860_100095388 | Ga0068860_1000953882 | 374 |
| 6 | 3300006237 | Ga0097621_100005820 | Ga0097621_1000058202 | 374 |
| 7 | 3300006358 | Ga0068871_100010671 | Ga0068871_1000106712 | 374 |
| 8 | 3300009094 | Ga0111539_10073027 | Ga0111539_100730273 | 374 |
| 9 | 3300009551 | Ga0105238_10404004 | Ga0105238_104040041 | 374 |
| 10 | 3300025904 | Ga0207647_10001597 | Ga0207647_100015972 | 374 |
| 11 | 3300026075 | Ga0207708_10036909 | Ga0207708_100369092 | 374 |
| 12 | 3300050511 | nmdc:mga08y16_212699_c1 | nmdc:mga08y16_212699_c1_329_1573 | 374 |
| 13 | 3300005337 | Ga0070682_100024839 | Ga0070682_1000248393 | 376 |
| 14 | 3300005842 | Ga0068858_100155701 | Ga0068858_1001557012 | 376 |
| 15 | 3300025928 | Ga0207700_10073351 | Ga0207700_100733513 | 376 |
| 16 | 3300026035 | Ga0207703_10198120 | Ga0207703_101981202 | 376 |
| 17 | 3300031507 | Ga0307509_10050694 | Ga0307509_100506942 | 376 |
| 18 | 3300014325 | Ga0163163_10091905 | Ga0163163_100919053 | 377 |
| 19 | 3300005545 | Ga0070695_100028518 | Ga0070695_1000285182 | 378 |
| 20 | 3300005617 | Ga0068859_100007366 | Ga0068859_1000073662 | 379 |
| 21 | 3300005842 | Ga0068858_100105181 | Ga0068858_1001051811 | 379 |
| 22 | 3300005843 | Ga0068860_100121522 | Ga0068860_1001215223 | 379 |
| 23 | 3300006931 | Ga0097620_100007366 | Ga0097620_1000073662 | 379 |
| 24 | 3300014326 | Ga0157380_10050225 | Ga0157380_100502252 | 379 |
| 25 | 3300026095 | Ga0207676_10120936 | Ga0207676_101209362 | 379 |
| 26 | 3300050513 | nmdc:mga0rr50_1734_c1 | nmdc:mga0rr50_1734_c1_81_1220 | 379 |
| 27 | 3300014968 | Ga0157379_10027459 | Ga0157379_100274594 | 380 |
| 28 | 3300005444 | Ga0070694_100052902 | Ga0070694_1000529022 | 381 |
| 29 | 3300006844 | Ga0075428_100291758 | Ga0075428_1002917581 | 382 |
| 30 | 3300005356 | Ga0070674_100014181 | Ga0070674_1000141814 | 383 |
| 31 | 3300025926 | Ga0207659_10040918 | Ga0207659_100409182 | 384 |
| 32 | 3300006914 | Ga0075436_100000016 | Ga0075436_10000001674 | 385 |
| 33 | 3300007076 | Ga0075435_100000971 | Ga0075435_10000097110 | 385 |
| 34 | 3300050507 | nmdc:mga05p37_166690_c1 | nmdc:mga05p37_166690_c1_1205_2443 | 385 |
| 35 | 3300050513 | nmdc:mga0rr50_440_c1 | nmdc:mga0rr50_440_c1_12568_13788 | 385 |
| 36 | 3300050514 | nmdc:mga08x19_8_c1 | nmdc:mga08x19_8_c1_177708_178928 | 385 |
| 37 | 3300006042 | Ga0075368_10018385 | Ga0075368_100183852 | 386 |
| 38 | 3300006051 | Ga0075364_10002667 | Ga0075364_100026676 | 386 |
| 39 | 3300006178 | Ga0075367_10005446 | Ga0075367_100054464 | 386 |
| 40 | 3300006353 | Ga0075370_10005613 | Ga0075370_100056133 | 386 |
| 41 | 3300050491 | nmdc:mga00v17_66931_c1 | nmdc:mga00v17_66931_c1_880_2115 | 386 |
| 42 | 3300050494 | nmdc:mga06z11_42005_c1 | nmdc:mga06z11_42005_c1_1015_2250 | 386 |
| 43 | 3300050496 | nmdc:mga07m45_56620_c1 | nmdc:mga07m45_56620_c1_390_1625 | 386 |
| 44 | 3300006163 | Ga0070715_10000030 | Ga0070715_1000003061 | 387 |
| 45 | 3300007076 | Ga0075435_100086843 | Ga0075435_1000868431 | 387 |
| 46 | 3300025905 | Ga0207685_10000009 | Ga0207685_1000000915 | 387 |
| 47 | 3300050514 | nmdc:mga08x19_10902_c1 | nmdc:mga08x19_10902_c1_2713_3894 | 387 |
| 48 | 3300005843 | Ga0068860_100023881 | Ga0068860_1000238814 | 388 |
| 49 | 3300005468 | Ga0070707_100014908 | Ga0070707_1000149084 | 389 |
| 50 | 3300025922 | Ga0207646_10037882 | Ga0207646_100378823 | 389 |
| 51 | 3300005844 | Ga0068862_100089379 | Ga0068862_1000893791 | 390 |
| 52 | 3300009147 | Ga0114129_10213720 | Ga0114129_102137201 | 390 |
| 53 | 3300009176 | Ga0105242_10031909 | Ga0105242_100319092 | 390 |
| 54 | 3300013308 | Ga0157375_10015147 | Ga0157375_100151472 | 390 |
| 55 | 3300025934 | Ga0207686_10016982 | Ga0207686_100169822 | 390 |
| 56 | 3300050515 | nmdc:mga0a205_33954_c1 | nmdc:mga0a205_33954_c1_121_1362 | 390 |
| 57 | 3300005518 | Ga0070699_100088211 | Ga0070699_1000882113 | 391 |
| 58 | 3300009094 | Ga0111539_10159038 | Ga0111539_101590382 | 391 |
| 59 | 3300014969 | Ga0157376_10101494 | Ga0157376_101014942 | 391 |
| 60 | 3300025922 | Ga0207646_10040588 | Ga0207646_100405882 | 391 |
| 61 | 3300050511 | nmdc:mga08y16_163479_c1 | nmdc:mga08y16_163479_c1_389_1630 | 391 |
| 62 | 3300005617 | Ga0068859_100009941 | Ga0068859_1000099418 | 392 |
| 63 | 3300006931 | Ga0097620_100009941 | Ga0097620_1000099418 | 392 |
| 64 | 3300026075 | Ga0207708_10003751 | Ga0207708_100037512 | 392 |
| 65 | 3300006914 | Ga0075436_100014232 | Ga0075436_1000142322 | 394 |
| 66 | 3300009098 | Ga0105245_10246967 | Ga0105245_102469671 | 394 |
| 67 | 3300009545 | Ga0105237_10151722 | Ga0105237_101517221 | 394 |
| 68 | 3300021384 | Ga0213876_10000872 | Ga0213876_100008722 | 394 |
| 69 | 3300039437 | Ga0436365_1520753 | Ga0436365_1520753_17880_19115 | 394 |
| 70 | 3300044684 | Ga0466966_0129968 | Ga0466966_0129968_283_1485 | 394 |
| 71 | 3300048906 | Ga0496103_0121036 | Ga0496103_0121036_295_1488 | 394 |
| 72 | 3300048907 | Ga0496104_0273255 | Ga0496104_0273255_143_1336 | 394 |
| 73 | 3300048913 | Ga0496110_0379125 | Ga0496110_0379125_35_1228 | 394 |
| 74 | 3300031238 | Ga0265332_10002097 | Ga0265332_100020973 | 395 |
| 75 | 3300009148 | Ga0105243_10011189 | Ga0105243_100111897 | 396 |
| 76 | 3300013297 | Ga0157378_10000001 | Ga0157378_10000001206 | 396 |
| 77 | 3300044706 | Ga0466964_0030718 | Ga0466964_0030718_876_2105 | 396 |
| 78 | 3300045976 | Ga0466967_0133260 | Ga0466967_0133260_568_1797 | 396 |
| 79 | 3300048909 | Ga0496106_0003284 | Ga0496106_0003284_2392_3624 | 396 |
| 80 | 3300005290 | Ga0065712_10072937 | Ga0065712_100729371 | 397 |
| 81 | 3300005293 | Ga0065715_10031244 | Ga0065715_100312441 | 397 |
| 82 | 3300005330 | Ga0070690_100032000 | Ga0070690_1000320001 | 397 |
| 83 | 3300005354 | Ga0070675_100087236 | Ga0070675_1000872362 | 397 |
| 84 | 3300005459 | Ga0068867_100068473 | Ga0068867_1000684731 | 397 |
| 85 | 3300005539 | Ga0068853_100241745 | Ga0068853_1002417452 | 397 |
| 86 | 3300005544 | Ga0070686_100008047 | Ga0070686_1000080474 | 397 |
| 87 | 3300005549 | Ga0070704_100186469 | Ga0070704_1001864691 | 397 |
| 88 | 3300009098 | Ga0105245_10186748 | Ga0105245_101867482 | 397 |
| 89 | 3300013296 | Ga0157374_10032781 | Ga0157374_100327813 | 397 |
| 90 | 3300013306 | Ga0163162_10037685 | Ga0163162_100376851 | 397 |
| 91 | 3300026089 | Ga0207648_10026192 | Ga0207648_100261922 | 397 |
| 92 | 3300050512 | nmdc:mga0n895_41139_c1 | nmdc:mga0n895_41139_c1_1934_3127 | 397 |
| 93 | 3300050515 | nmdc:mga0a205_8494_c1 | nmdc:mga0a205_8494_c1_365_1558 | 397 |
| 94 | 3300009101 | Ga0105247_10000001 | Ga0105247_1000000161 | 398 |
| 95 | 3300005343 | Ga0070687_100070990 | Ga0070687_1000709902 | 399 |
| 96 | 3300005468 | Ga0070707_100084903 | Ga0070707_1000849032 | 399 |
| 97 | 3300025922 | Ga0207646_10074391 | Ga0207646_100743913 | 399 |
| 98 | 3300041512 | Ga0451853_1820606 | Ga0451853_1820606_117_1343 | 399 |
| 99 | 3300006852 | Ga0075433_10149969 | Ga0075433_101499692 | 400 |
| 100 | 3300005444 | Ga0070694_100127670 | Ga0070694_1001276701 | 401 |
| 101 | 3300009094 | Ga0111539_10038827 | Ga0111539_100388277 | 401 |
| 102 | 3300025942 | Ga0207689_10013724 | Ga0207689_100137244 | 401 |
| 103 | 3300050511 | nmdc:mga08y16_42182_c1 | nmdc:mga08y16_42182_c1_2130_3350 | 401 |
| 104 | 3300005293 | Ga0065715_10111096 | Ga0065715_101110961 | 402 |
| 105 | 3300005518 | Ga0070699_100042718 | Ga0070699_1000427182 | 402 |
| 106 | 3300005536 | Ga0070697_100040866 | Ga0070697_1000408662 | 402 |
| 107 | 3300006051 | Ga0075364_10004732 | Ga0075364_100047324 | 402 |
| 108 | 3300006195 | Ga0075366_10026068 | Ga0075366_100260682 | 402 |
| 109 | 3300050493 | nmdc:mga0k408_8466_c1 | nmdc:mga0k408_8466_c1_2767_4002 | 402 |
| 110 | 3300005355 | Ga0070671_100030333 | Ga0070671_1000303334 | 403 |
| 111 | 3300005618 | Ga0068864_100017929 | Ga0068864_1000179294 | 403 |
| 112 | 3300005842 | Ga0068858_100063820 | Ga0068858_1000638202 | 403 |
| 113 | 3300013308 | Ga0157375_10042026 | Ga0157375_100420262 | 403 |
| 114 | 3300014325 | Ga0163163_10125979 | Ga0163163_101259791 | 403 |
| 115 | 3300026095 | Ga0207676_10028220 | Ga0207676_100282204 | 403 |
| 116 | 3300042157 | Ga0439458_0006403 | Ga0439458_0006403_257_1474 | 403 |
| 117 | 3300050492 | nmdc:mga0yw44_54748_c1 | nmdc:mga0yw44_54748_c1_15_1292 | 403 |
| 118 | 3300050510 | nmdc:mga06r32_423445_c1 | nmdc:mga06r32_423445_c1_10_1251 | 403 |
| 119 | 3300005364 | Ga0070673_100029902 | Ga0070673_1000299023 | 404 |
| 120 | 3300005843 | Ga0068860_100218402 | Ga0068860_1002184021 | 404 |
| 121 | 3300006051 | Ga0075364_10010771 | Ga0075364_100107712 | 404 |
| 122 | 3300009094 | Ga0111539_10115480 | Ga0111539_101154802 | 404 |
| 123 | 3300025960 | Ga0207651_10021036 | Ga0207651_100210363 | 404 |
| 124 | 3300050491 | nmdc:mga00v17_104733_c1 | nmdc:mga00v17_104733_c1_323_1564 | 404 |
| 125 | 3300050511 | nmdc:mga08y16_194927_c1 | nmdc:mga08y16_194927_c1_511_1803 | 404 |
| 126 | 3300005355 | Ga0070671_100091747 | Ga0070671_1000917471 | 405 |
| 127 | 3300005444 | Ga0070694_100003403 | Ga0070694_1000034037 | 405 |
| 128 | 3300005459 | Ga0068867_100029847 | Ga0068867_1000298473 | 405 |
| 129 | 3300005466 | Ga0070685_10099512 | Ga0070685_100995122 | 405 |
| 130 | 3300005543 | Ga0070672_100052996 | Ga0070672_1000529963 | 405 |
| 131 | 3300005546 | Ga0070696_100050100 | Ga0070696_1000501002 | 405 |
| 132 | 3300005578 | Ga0068854_100045955 | Ga0068854_1000459553 | 405 |
| 133 | 3300005617 | Ga0068859_100099972 | Ga0068859_1000999722 | 405 |
| 134 | 3300005718 | Ga0068866_10010184 | Ga0068866_100101843 | 405 |
| 135 | 3300005843 | Ga0068860_100024361 | Ga0068860_1000243614 | 405 |
| 136 | 3300006358 | Ga0068871_100037165 | Ga0068871_1000371652 | 405 |
| 137 | 3300006931 | Ga0097620_100099980 | Ga0097620_1000999803 | 405 |
| 138 | 3300009148 | Ga0105243_10016003 | Ga0105243_100160033 | 405 |
| 139 | 3300009176 | Ga0105242_10206916 | Ga0105242_102069162 | 405 |
| 140 | 3300011119 | Ga0105246_10022369 | Ga0105246_100223693 | 405 |
| 141 | 3300013297 | Ga0157378_10027424 | Ga0157378_100274241 | 405 |
| 142 | 3300017792 | Ga0163161_10036438 | Ga0163161_100364383 | 405 |
| 143 | 3300025907 | Ga0207645_10104808 | Ga0207645_101048081 | 405 |
| 144 | 3300025908 | Ga0207643_10125624 | Ga0207643_101256242 | 405 |
| 145 | 3300025918 | Ga0207662_10007945 | Ga0207662_100079455 | 405 |
| 146 | 3300025931 | Ga0207644_10019146 | Ga0207644_100191462 | 405 |
| 147 | 3300025940 | Ga0207691_10050457 | Ga0207691_100504573 | 405 |
| 148 | 3300025941 | Ga0207711_10177030 | Ga0207711_101770302 | 405 |
| 149 | 3300025942 | Ga0207689_10006392 | Ga0207689_100063927 | 405 |
| 150 | 3300025960 | Ga0207651_10180362 | Ga0207651_101803621 | 405 |
| 151 | 3300025981 | Ga0207640_10077332 | Ga0207640_100773322 | 405 |
| 152 | 3300026089 | Ga0207648_10017199 | Ga0207648_100171997 | 405 |
| 153 | 3300026118 | Ga0207675_100063401 | Ga0207675_1000634014 | 405 |
| 154 | 3300046642 | Ga0495634_0069084 | Ga0495634_0069084_358_1590 | 405 |
| 155 | 3300046663 | Ga0495635_0127924 | Ga0495635_0127924_135_1367 | 405 |
| 156 | 3300005331 | Ga0070670_100025928 | Ga0070670_1000259283 | 406 |
| 157 | 3300005336 | Ga0070680_100057872 | Ga0070680_1000578723 | 406 |
| 158 | 3300005444 | Ga0070694_100107132 | Ga0070694_1001071321 | 406 |
| 159 | 3300005458 | Ga0070681_10000806 | Ga0070681_1000080615 | 406 |
| 160 | 3300005458 | Ga0070681_10059894 | Ga0070681_100598942 | 406 |
| 161 | 3300005468 | Ga0070707_100258589 | Ga0070707_1002585892 | 406 |
| 162 | 3300005530 | Ga0070679_100000266 | Ga0070679_10000026622 | 406 |
| 163 | 3300005536 | Ga0070697_100048763 | Ga0070697_1000487631 | 406 |
| 164 | 3300005564 | Ga0070664_100061485 | Ga0070664_1000614852 | 406 |
| 165 | 3300005614 | Ga0068856_100006611 | Ga0068856_1000066111 | 406 |
| 166 | 3300005617 | Ga0068859_100008420 | Ga0068859_1000084206 | 406 |
| 167 | 3300005841 | Ga0068863_100089907 | Ga0068863_1000899072 | 406 |
| 168 | 3300006852 | Ga0075433_10157253 | Ga0075433_101572532 | 406 |
| 169 | 3300006871 | Ga0075434_100171105 | Ga0075434_1001711052 | 406 |
| 170 | 3300006931 | Ga0097620_100008420 | Ga0097620_1000084206 | 406 |
| 171 | 3300009176 | Ga0105242_10000344 | Ga0105242_1000034422 | 406 |
| 172 | 3300009177 | Ga0105248_10003792 | Ga0105248_100037926 | 406 |
| 173 | 3300013297 | Ga0157378_10058387 | Ga0157378_100583872 | 406 |
| 174 | 3300013306 | Ga0163162_10076907 | Ga0163162_100769072 | 406 |
| 175 | 3300017792 | Ga0163161_10008648 | Ga0163161_100086483 | 406 |
| 176 | 3300025912 | Ga0207707_10000050 | Ga0207707_1000005025 | 406 |
| 177 | 3300025917 | Ga0207660_10067357 | Ga0207660_100673573 | 406 |
| 178 | 3300025918 | Ga0207662_10113520 | Ga0207662_101135202 | 406 |
| 179 | 3300025921 | Ga0207652_10000537 | Ga0207652_100005375 | 406 |
| 180 | 3300025922 | Ga0207646_10227570 | Ga0207646_102275701 | 406 |
| 181 | 3300025934 | Ga0207686_10000160 | Ga0207686_1000016023 | 406 |
| 182 | 3300025941 | Ga0207711_10004950 | Ga0207711_100049506 | 406 |
| 183 | 3300026041 | Ga0207639_10165586 | Ga0207639_101655862 | 406 |
| 184 | 3300026075 | Ga0207708_10000126 | Ga0207708_100001264 | 406 |
| 185 | 3300026078 | Ga0207702_10014559 | Ga0207702_100145591 | 406 |
| 186 | 3300026088 | Ga0207641_10120674 | Ga0207641_101206742 | 406 |
| 187 | 3300031548 | Ga0307408_100004179 | Ga0307408_1000041795 | 406 |
| 188 | 3300031616 | Ga0307508_10123821 | Ga0307508_101238212 | 406 |
| 189 | 3300031731 | Ga0307405_10002374 | Ga0307405_100023744 | 406 |
| 190 | 3300031903 | Ga0307407_10049965 | Ga0307407_100499652 | 406 |
| 191 | 3300031911 | Ga0307412_10017334 | Ga0307412_100173344 | 406 |
| 192 | 3300032002 | Ga0307416_100184482 | Ga0307416_1001844822 | 406 |
| 193 | 3300032005 | Ga0307411_10103303 | Ga0307411_101033032 | 406 |
| 194 | 3300038996 | Ga0242420_002316 | Ga0242420_002316_589_1827 | 406 |
| 195 | 3300049652 | Ga0501202_001702 | Ga0501202_001702_1257_2498 | 406 |
| 196 | 3300049654 | Ga0501207_001284 | Ga0501207_001284_1310_2536 | 406 |
| 197 | 3300049656 | Ga0501209_006279 | Ga0501209_006279_130_1371 | 406 |
| 198 | 3300049659 | Ga0501214_001014 | Ga0501214_001014_90_1316 | 406 |
| 199 | 3300049660 | Ga0501216_000538 | Ga0501216_000538_1600_2841 | 406 |
| 200 | 3300049661 | Ga0501217_000298 | Ga0501217_000298_1514_2740 | 406 |
| 201 | 3300049663 | Ga0501223_004753 | Ga0501223_004753_109_1335 | 406 |
| 202 | 3300049665 | Ga0501227_000880 | Ga0501227_000880_429_1655 | 406 |
| 203 | 3300049668 | Ga0501233_001316 | Ga0501233_001316_1508_2749 | 406 |
| 204 | 3300049706 | Ga0501229_001897 | Ga0501229_001897_1074_2315 | 406 |
| 205 | 3300050513 | nmdc:mga0rr50_86501_c1 | nmdc:mga0rr50_86501_c1_952_2193 | 406 |
| 206 | 3300050515 | nmdc:mga0a205_103624_c1 | nmdc:mga0a205_103624_c1_814_2055 | 406 |
| 207 | 3300050515 | nmdc:mga0a205_132033_c1 | nmdc:mga0a205_132033_c1_422_1675 | 406 |
| 208 | 3300006847 | Ga0075431_100308810 | Ga0075431_1003088101 | 407 |
| 209 | 3300005293 | Ga0065715_10095378 | Ga0065715_100953782 | 408 |
| 210 | 3300005440 | Ga0070705_100034038 | Ga0070705_1000340382 | 408 |
| 211 | 3300005458 | Ga0070681_10000976 | Ga0070681_1000097617 | 408 |
| 212 | 3300005518 | Ga0070699_100004169 | Ga0070699_1000041695 | 408 |
| 213 | 3300005546 | Ga0070696_100039969 | Ga0070696_1000399693 | 408 |
| 214 | 3300005547 | Ga0070693_100005826 | Ga0070693_1000058264 | 408 |
| 215 | 3300005985 | Ga0081539_10000508 | Ga0081539_1000050854 | 408 |
| 216 | 3300006173 | Ga0070716_100073243 | Ga0070716_1000732432 | 408 |
| 217 | 3300006871 | Ga0075434_100037503 | Ga0075434_1000375035 | 408 |
| 218 | 3300006914 | Ga0075436_100055115 | Ga0075436_1000551152 | 408 |
| 219 | 3300007076 | Ga0075435_100057774 | Ga0075435_1000577743 | 408 |
| 220 | 3300009148 | Ga0105243_10000022 | Ga0105243_1000002257 | 408 |
| 221 | 3300009176 | Ga0105242_10000014 | Ga0105242_1000001447 | 408 |
| 222 | 3300009545 | Ga0105237_10041701 | Ga0105237_100417013 | 408 |
| 223 | 3300021384 | Ga0213876_10001402 | Ga0213876_1000140213 | 408 |
| 224 | 3300025912 | Ga0207707_10051926 | Ga0207707_100519261 | 408 |
| 225 | 3300025939 | Ga0207665_10015983 | Ga0207665_100159833 | 408 |
| 226 | 3300039437 | Ga0436365_0305790 | Ga0436365_0305790_14212_15456 | 408 |
| 227 | 3300050514 | nmdc:mga08x19_21442_c1 | nmdc:mga08x19_21442_c1_1284_2531 | 408 |
| 228 | 3300050515 | nmdc:mga0a205_29616_c1 | nmdc:mga0a205_29616_c1_2437_3684 | 408 |
| 229 | 3300005719 | Ga0068861_100190152 | Ga0068861_1001901522 | 409 |
| 230 | 3300006173 | Ga0070716_100000002 | Ga0070716_10000000255 | 409 |
| 231 | 3300009098 | Ga0105245_10298587 | Ga0105245_102985871 | 409 |
| 232 | 3300025939 | Ga0207665_10000007 | Ga0207665_10000007135 | 409 |
| 233 | 3300026118 | Ga0207675_100020793 | Ga0207675_1000207932 | 409 |
| 234 | 3300035115 | Ga0373941_0007630 | Ga0373941_0007630_1103_2398 | 409 |
| 235 | 3300035695 | Ga0373927_0054398 | Ga0373927_0054398_784_2055 | 409 |
| 236 | 3300046472 | Ga0495580_0004225 | Ga0495580_0004225_3556_4827 | 409 |
| 237 | 3300053120 | Ga0500597_007829 | Ga0500597_007829_174_1418 | 409 |
| 238 | 3300003203 | JGI25406J46586_10000136 | JGI25406J46586_100001369 | 410 |
| 239 | 3300005334 | Ga0068869_100016375 | Ga0068869_1000163752 | 410 |
| 240 | 3300005471 | Ga0070698_100075906 | Ga0070698_1000759063 | 410 |
| 241 | 3300005985 | Ga0081539_10000149 | Ga0081539_10000149106 | 410 |
| 242 | 3300025942 | Ga0207689_10030277 | Ga0207689_100302771 | 410 |
| 243 | 3300028800 | Ga0265338_10050546 | Ga0265338_100505462 | 410 |
| 244 | 3300035241 | Ga0373961_0000008 | Ga0373961_0000008_52893_54137 | 410 |
| 245 | 3300002074 | JGI24748J21848_1000006 | JGI24748J21848_1000006128 | 411 |
| 246 | 3300002239 | JGI24034J26672_10000002 | JGI24034J26672_10000002590 | 411 |
| 247 | 3300005340 | Ga0070689_100091350 | Ga0070689_1000913503 | 411 |
| 248 | 3300005355 | Ga0070671_100037324 | Ga0070671_1000373242 | 411 |
| 249 | 3300005406 | Ga0070703_10000218 | Ga0070703_100002183 | 411 |
| 250 | 3300005440 | Ga0070705_100000015 | Ga0070705_10000001547 | 411 |
| 251 | 3300005456 | Ga0070678_100018166 | Ga0070678_1000181666 | 411 |
| 252 | 3300005467 | Ga0070706_100000290 | Ga0070706_10000029011 | 411 |
| 253 | 3300005467 | Ga0070706_100010514 | Ga0070706_1000105144 | 411 |
| 254 | 3300005467 | Ga0070706_100010612 | Ga0070706_1000106123 | 411 |
| 255 | 3300005467 | Ga0070706_100065329 | Ga0070706_1000653293 | 411 |
| 256 | 3300005471 | Ga0070698_100003659 | Ga0070698_1000036596 | 411 |
| 257 | 3300005471 | Ga0070698_100054147 | Ga0070698_1000541472 | 411 |
| 258 | 3300005518 | Ga0070699_100000102 | Ga0070699_10000010223 | 411 |
| 259 | 3300005518 | Ga0070699_100016671 | Ga0070699_1000166712 | 411 |
| 260 | 3300005536 | Ga0070697_100002506 | Ga0070697_1000025069 | 411 |
| 261 | 3300005536 | Ga0070697_100152716 | Ga0070697_1001527161 | 411 |
| 262 | 3300005546 | Ga0070696_100000006 | Ga0070696_10000000665 | 411 |
| 263 | 3300005546 | Ga0070696_100011498 | Ga0070696_1000114985 | 411 |
| 264 | 3300005547 | Ga0070693_100115774 | Ga0070693_1001157742 | 411 |
| 265 | 3300005841 | Ga0068863_100124965 | Ga0068863_1001249651 | 411 |
| 266 | 3300005842 | Ga0068858_100000227 | Ga0068858_10000022742 | 411 |
| 267 | 3300006173 | Ga0070716_100001266 | Ga0070716_1000012665 | 411 |
| 268 | 3300006852 | Ga0075433_10078806 | Ga0075433_100788063 | 411 |
| 269 | 3300006871 | Ga0075434_100170163 | Ga0075434_1001701632 | 411 |
| 270 | 3300006914 | Ga0075436_100070906 | Ga0075436_1000709063 | 411 |
| 271 | 3300007265 | Ga0099794_10034616 | Ga0099794_100346162 | 411 |
| 272 | 3300009147 | Ga0114129_10049333 | Ga0114129_100493334 | 411 |
| 273 | 3300009147 | Ga0114129_10100411 | Ga0114129_101004112 | 411 |
| 274 | 3300013306 | Ga0163162_10286123 | Ga0163162_102861232 | 411 |
| 275 | 3300024227 | Ga0228598_1001233 | Ga0228598_10012334 | 411 |
| 276 | 3300025223 | Ga0207672_1000363 | Ga0207672_10003634 | 411 |
| 277 | 3300025885 | Ga0207653_10000168 | Ga0207653_1000016819 | 411 |
| 278 | 3300025900 | Ga0207710_10000003 | Ga0207710_10000003576 | 411 |
| 279 | 3300025910 | Ga0207684_10000073 | Ga0207684_10000073160 | 411 |
| 280 | 3300025910 | Ga0207684_10000236 | Ga0207684_1000023663 | 411 |
| 281 | 3300025910 | Ga0207684_10180040 | Ga0207684_101800401 | 411 |
| 282 | 3300025915 | Ga0207693_10003406 | Ga0207693_1000340613 | 411 |
| 283 | 3300025931 | Ga0207644_10000249 | Ga0207644_1000024915 | 411 |
| 284 | 3300025933 | Ga0207706_10107815 | Ga0207706_101078152 | 411 |
| 285 | 3300025934 | Ga0207686_10000002 | Ga0207686_10000002306 | 411 |
| 286 | 3300025935 | Ga0207709_10000012 | Ga0207709_10000012129 | 411 |
| 287 | 3300025939 | Ga0207665_10000849 | Ga0207665_100008495 | 411 |
| 288 | 3300025972 | Ga0207668_10169055 | Ga0207668_101690552 | 411 |
| 289 | 3300026035 | Ga0207703_10000101 | Ga0207703_1000010113 | 411 |
| 290 | 3300026088 | Ga0207641_10109565 | Ga0207641_101095652 | 411 |
| 291 | 3300026121 | Ga0207683_10030250 | Ga0207683_100302507 | 411 |
| 292 | 3300027671 | Ga0209588_1019602 | Ga0209588_10196022 | 411 |
| 293 | 3300031090 | Ga0265760_10004684 | Ga0265760_100046841 | 411 |
| 294 | 3300035090 | Ga0373949_0000024 | Ga0373949_0000024_22382_23623 | 411 |
| 295 | 3300037418 | Ga0395900_0069364 | Ga0395900_0069364_1693_2934 | 411 |
| 296 | 3300037466 | Ga0395898_0061343 | Ga0395898_0061343_2167_3408 | 411 |
| 297 | 3300037471 | Ga0395905_0001435 | Ga0395905_0001435_15676_16932 | 411 |
| 298 | 3300038443 | Ga0395901_0015369 | Ga0395901_0015369_394_1635 | 411 |
| 299 | 3300046472 | Ga0495580_0030320 | Ga0495580_0030320_1925_3199 | 411 |
| 300 | 3300046664 | Ga0495659_0016848 | Ga0495659_0016848_129_1370 | 411 |
| 301 | 3300048912 | Ga0496109_0094599 | Ga0496109_0094599_458_1732 | 411 |
| 302 | 3300050512 | nmdc:mga0n895_58966_c1 | nmdc:mga0n895_58966_c1_177_1412 | 411 |
| 303 | 3300050514 | nmdc:mga08x19_107167_c1 | nmdc:mga08x19_107167_c1_283_1584 | 411 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3mtw-assembly1.cif.gz_A | crystal structure of l-lysine, l-arginine carboxypeptidase cc2672 from caulobacter crescentus cb15 complexed with n-methyl phosphonate derivative of l-arginine | 0.9011 | 30 | 408 |
| 8ihq-assembly1.cif.gz_D | cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 | 0.8893 | 32 | 408 |
| 2qs8-assembly1.cif.gz_A | crystal structure of a xaa-pro dipeptidase with bound methionine in the active site | 0.8876 | 30 | 408 |
| 3feq-assembly2.cif.gz_P | crystal structure of uncharacterized protein eah89906 | 0.8861 | 30 | 408 |
| 8ihs-assembly1.cif.gz_B | cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 in complex with ochratoxin a | 0.8859 | 32 | 408 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3be7A01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9455 | 369 | 408 | 2.30.40.10 |
| 2p9bA01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9435 | 371 | 406 | 2.30.40.10 |
| 4whbE01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.9167 | 369 | 406 | 2.30.40.10 |
| 2r8cA01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.8735 | 366 | 408 | 2.30.40.10 |
| 3gnhA01 | Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 | 0.8567 | 30 | 81 | 2.30.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7M297-F1-model_v4 | Amidohydrolase | 0.9833 | 250 | 411 |
GO:0016810
|
| AF-A0A2V8H9B9-F1-model_v4 | Amidohydrolase | 0.9829 | 240 | 408 |
GO:0016810
|
| AF-A0A7Y5QPC8-F1-model_v4 | Amidohydrolase family protein | 0.9794 | 215 | 408 |
GO:0016810
|
| AF-A0A7Y5V489-F1-model_v4 | VCBS repeat-containing protein | 0.9682 | 25 | 408 |
GO:0016810
|
| AF-A0A2V7KST1-F1-model_v4 | Amidohydrolase | 0.9675 | 21 | 409 |
GO:0016810
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar