F396907

General Info

Members Datasets Scaffolds Average Seq Length
303 182 303 409

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100152716|Ga0070697_1001527161
Length 461
Sequence MRSAKITLSILGILACAAAPGVSAQTTSSNAQGAAQKRIVIAASIVLDGKGDVLHNTHIVVEGSKIVAIDPKVEPVDYDLRNLTVLPGWIDAHAHVTWIFGKDGKNAGQGGTTPDAIYAAASNVWLTLMAGFTTVQSIGSPADIPLRDAIAKGMLPGPRILTSAEPLVGRGAQTGTPDEIRAFIRKQKDAGADVIKIFASQSIRQGGGMTLSQEQLNAACDEAKKLGLRTLVHAYKDAVRAATLAGCTEIEHGTMATDDDLKLMATKGTYLDPQAGLVIENYLLNKEKYLGTPGYTEEGFAAMQRVLSLNHELVQRATKTPGLKVVFGTDAVAGAHGRNAEEFIDRVRDGGVDPMTAMVSANSLGAEALGMSDQIGSIAPGLQADIIALDGDPLKDITAVRRVVFVMKGGVVYKNVSRFHGASVTDGAVAPRARAFLSVNSLLRGGAEDRAELRDGLMPSK

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
87 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
161 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
162 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
163 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
164 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
165 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
166 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
167 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
168 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
169 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.62
Nodule 0
Rhizoplane 1.65
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 2.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000006 3300002074 Bacteria 212677
2 JGI24034J26672_10000002 3300002239 Bacteria 925353
3 JGI25406J46586_10000136 3300003203 Bacteria 31867
4 Ga0065712_10072937 3300005290 Bacteria 4553
5 Ga0065715_10031244 3300005293 Bacteria 1573
6 Ga0065715_10095378 3300005293 Unclassified 4098
7 Ga0065715_10111096 3300005293 Bacteria 2533
8 Ga0065715_10125413 3300005293 Bacteria 2131
9 Ga0070690_100032000 3300005330 Bacteria 3281
10 Ga0070670_100025928 3300005331 Bacteria 5044
11 Ga0068869_100016375 3300005334 Bacteria 4995
12 Ga0070680_100057872 3300005336 Bacteria 3170
13 Ga0070682_100024839 3300005337 Bacteria 3570
14 Ga0070689_100091350 3300005340 Unclassified 2400
15 Ga0070687_100070990 3300005343 Unclassified 1870
16 Ga0070675_100087236 3300005354 Bacteria 2609
17 Ga0070671_100030333 3300005355 Bacteria 4462
18 Ga0070671_100037324 3300005355 Bacteria 4029
19 Ga0070671_100091747 3300005355 Bacteria 2545
20 Ga0070674_100014181 3300005356 Bacteria 4949
21 Ga0070673_100029902 3300005364 Bacteria 4068
22 Ga0070703_10000218 3300005406 Bacteria 27553
23 Ga0070705_100000015 3300005440 Bacteria 93385
24 Ga0070705_100034038 3300005440 Unclassified 2845
25 Ga0070705_100052634 3300005440 Bacteria 2380
26 Ga0070694_100003403 3300005444 Bacteria 9535
27 Ga0070694_100052902 3300005444 Unclassified 2746
28 Ga0070694_100107132 3300005444 Bacteria 1986
29 Ga0070694_100127670 3300005444 Unclassified 1833
30 Ga0070678_100018166 3300005456 Bacteria 4553
31 Ga0070681_10000806 3300005458 Bacteria 26162
32 Ga0070681_10000976 3300005458 Bacteria 24193
33 Ga0070681_10059894 3300005458 Unclassified 3787
34 Ga0068867_100029847 3300005459 Bacteria 3930
35 Ga0068867_100068473 3300005459 Bacteria 2649
36 Ga0070685_10099512 3300005466 Bacteria 1773
37 Ga0070706_100000290 3300005467 Bacteria 60905
38 Ga0070706_100010514 3300005467 Bacteria 8590
39 Ga0070706_100010612 3300005467 Bacteria 8548
40 Ga0070706_100065329 3300005467 Bacteria 3364
41 Ga0070707_100014908 3300005468 Bacteria 7291
42 Ga0070707_100084903 3300005468 Bacteria 3059
43 Ga0070707_100258589 3300005468 Unclassified 1694
44 Ga0070698_100003659 3300005471 Bacteria 16886
45 Ga0070698_100054147 3300005471 Bacteria 4075
46 Ga0070698_100075906 3300005471 Bacteria 3364
47 Ga0070699_100000102 3300005518 Bacteria 80731
48 Ga0070699_100004169 3300005518 Bacteria 12782
49 Ga0070699_100016671 3300005518 Archaea 6306
50 Ga0070699_100042718 3300005518 Bacteria 3923
51 Ga0070699_100088211 3300005518 Unclassified 2709
52 Ga0070679_100000266 3300005530 Bacteria 43900
53 Ga0070697_100002506 3300005536 Bacteria 14122
54 Ga0070697_100040866 3300005536 Bacteria 3752
55 Ga0070697_100048763 3300005536 Bacteria 3435
56 Ga0070697_100152716 3300005536 Unclassified 1947
57 Ga0068853_100241745 3300005539 Bacteria 1655
58 Ga0070672_100052996 3300005543 Bacteria 3170
59 Ga0070686_100008047 3300005544 Bacteria 5889
60 Ga0070695_100028518 3300005545 Bacteria 3465
61 Ga0070696_100000006 3300005546 Bacteria 109170
62 Ga0070696_100011498 3300005546 Bacteria 5929
63 Ga0070696_100039969 3300005546 Unclassified 3238
64 Ga0070696_100050100 3300005546 Bacteria 2902
65 Ga0070693_100005826 3300005547 Bacteria 5952
66 Ga0070693_100115774 3300005547 Bacteria 1656
67 Ga0070704_100186469 3300005549 Bacteria 1664
68 Ga0070664_100061485 3300005564 Bacteria 3201
69 Ga0068854_100045955 3300005578 Bacteria 3107
70 Ga0068856_100006611 3300005614 Bacteria 11357
71 Ga0068859_100007366 3300005617 Bacteria 11164
72 Ga0068859_100008420 3300005617 Bacteria 10445
73 Ga0068859_100009941 3300005617 Bacteria 9598
74 Ga0068859_100099972 3300005617 Bacteria 2956
75 Ga0068864_100017929 3300005618 Bacteria 5906
76 Ga0068866_10010184 3300005718 Bacteria 4021
77 Ga0068861_100190152 3300005719 Bacteria 1715
78 Ga0068863_100089907 3300005841 Bacteria 2912
79 Ga0068863_100124965 3300005841 Bacteria 2454
80 Ga0068858_100000227 3300005842 Bacteria 60951
81 Ga0068858_100063820 3300005842 Bacteria 3408
82 Ga0068858_100105181 3300005842 Unclassified 2634
83 Ga0068858_100155701 3300005842 Bacteria 2150
84 Ga0068860_100023881 3300005843 Bacteria 5910
85 Ga0068860_100024361 3300005843 Bacteria 5848
86 Ga0068860_100095388 3300005843 Bacteria 2835
87 Ga0068860_100121522 3300005843 Bacteria 2501
88 Ga0068860_100218402 3300005843 Unclassified 1851
89 Ga0068862_100089379 3300005844 Bacteria 2681
90 Ga0081539_10000149 3300005985 Bacteria 161420
91 Ga0081539_10000508 3300005985 Bacteria 80945
92 Ga0075368_10018385 3300006042 Bacteria 2626
93 Ga0075364_10002667 3300006051 Bacteria 10017
94 Ga0075364_10004732 3300006051 Bacteria 7860
95 Ga0075364_10010771 3300006051 Bacteria 5531
96 Ga0070715_10000030 3300006163 Bacteria 88060
97 Ga0070716_100000002 3300006173 Bacteria 396037
98 Ga0070716_100001266 3300006173 Bacteria 11137
99 Ga0070716_100073243 3300006173 Bacteria 2020
100 Ga0075367_10005446 3300006178 Bacteria 6321
101 Ga0075366_10026068 3300006195 Bacteria 3421
102 Ga0097621_100005820 3300006237 Bacteria 8705
103 Ga0075370_10005613 3300006353 Bacteria 6258
104 Ga0068871_100010671 3300006358 Bacteria 6717
105 Ga0068871_100037165 3300006358 Bacteria 3882
106 Ga0075428_100291758 3300006844 Bacteria 1754
107 Ga0075431_100308810 3300006847 Bacteria 1597
108 Ga0075433_10078806 3300006852 Bacteria 2903
109 Ga0075433_10149969 3300006852 Bacteria 2074
110 Ga0075433_10157253 3300006852 Unclassified 2022
111 Ga0075434_100037503 3300006871 Bacteria 4798
112 Ga0075434_100170163 3300006871 Unclassified 2199
113 Ga0075434_100171105 3300006871 Unclassified 2192
114 Ga0075436_100000016 3300006914 Bacteria 167300
115 Ga0075436_100014232 3300006914 Bacteria 5446
116 Ga0075436_100055115 3300006914 Unclassified 2745
117 Ga0075436_100070906 3300006914 Bacteria 2409
118 Ga0097620_100007366 3300006931 Bacteria 11164
119 Ga0097620_100008420 3300006931 Bacteria 10445
120 Ga0097620_100009941 3300006931 Bacteria 9598
121 Ga0097620_100099980 3300006931 Bacteria 2956
122 Ga0075435_100000971 3300007076 Bacteria 18123
123 Ga0075435_100057774 3300007076 Bacteria 3139
124 Ga0075435_100086843 3300007076 Unclassified 2577
125 Ga0099794_10034616 3300007265 Unclassified 2381
126 Ga0111539_10038827 3300009094 Bacteria 5743
127 Ga0111539_10073027 3300009094 Bacteria 4045
128 Ga0111539_10115480 3300009094 Bacteria 3148
129 Ga0111539_10159038 3300009094 Bacteria 2643
130 Ga0105245_10186748 3300009098 Bacteria 1983
131 Ga0105245_10246967 3300009098 Unclassified 1732
132 Ga0105245_10298587 3300009098 Bacteria 1580
133 Ga0105247_10000001 3300009101 Bacteria 739726
134 Ga0114129_10049333 3300009147 Bacteria 5914
135 Ga0114129_10100411 3300009147 Bacteria 4004
136 Ga0114129_10213720 3300009147 Unclassified 2606
137 Ga0105243_10000022 3300009148 Bacteria 203002
138 Ga0105243_10011189 3300009148 Bacteria 6787
139 Ga0105243_10016003 3300009148 Bacteria 5673
140 Ga0105242_10000014 3300009176 Bacteria 129984
141 Ga0105242_10000344 3300009176 Bacteria 37518
142 Ga0105242_10031909 3300009176 Bacteria 4211
143 Ga0105242_10206916 3300009176 Bacteria 1746
144 Ga0105248_10003792 3300009177 Bacteria 16746
145 Ga0105237_10041701 3300009545 Unclassified 4628
146 Ga0105237_10151722 3300009545 Bacteria 2314
147 Ga0105238_10404004 3300009551 Bacteria 1359
148 Ga0105246_10022369 3300011119 Bacteria 4077
149 Ga0157374_10032781 3300013296 Bacteria 4734
150 Ga0157378_10000001 3300013297 Bacteria 352632
151 Ga0157378_10027424 3300013297 Bacteria 5027
152 Ga0157378_10058387 3300013297 Bacteria 3441
153 Ga0163162_10037685 3300013306 Bacteria 4826
154 Ga0163162_10076907 3300013306 Bacteria 3400
155 Ga0163162_10286123 3300013306 Unclassified 1780
156 Ga0157375_10015147 3300013308 Bacteria 6897
157 Ga0157375_10042026 3300013308 Unclassified 4421
158 Ga0163163_10046751 3300014325 Bacteria 4251
159 Ga0163163_10091905 3300014325 Bacteria 3049
160 Ga0163163_10125979 3300014325 Bacteria 2599
161 Ga0157380_10050225 3300014326 Bacteria 3293
162 Ga0157379_10027459 3300014968 Bacteria 5068
163 Ga0157376_10101494 3300014969 Bacteria 2515
164 Ga0163161_10008648 3300017792 Bacteria 7039
165 Ga0163161_10036438 3300017792 Bacteria 3522
166 Ga0213876_10000872 3300021384 Bacteria 20192
167 Ga0213876_10001402 3300021384 Bacteria 15016
168 Ga0228598_1001233 3300024227 Bacteria 5648
169 Ga0207672_1000363 3300025223 Bacteria 5949
170 Ga0207653_10000168 3300025885 Bacteria 46342
171 Ga0207710_10000003 3300025900 Bacteria 1071597
172 Ga0207647_10001597 3300025904 Bacteria 17404
173 Ga0207685_10000009 3300025905 Bacteria 242842
174 Ga0207645_10104808 3300025907 Bacteria 1826
175 Ga0207643_10125624 3300025908 Bacteria 1523
176 Ga0207684_10000073 3300025910 Bacteria 185361
177 Ga0207684_10000236 3300025910 Bacteria 83977
178 Ga0207684_10180040 3300025910 Bacteria 1822
179 Ga0207707_10000050 3300025912 Bacteria 117404
180 Ga0207707_10051926 3300025912 Bacteria 3570
181 Ga0207693_10003406 3300025915 Bacteria 13576
182 Ga0207660_10067357 3300025917 Bacteria 2593
183 Ga0207662_10007945 3300025918 Bacteria 5779
184 Ga0207662_10113520 3300025918 Bacteria 1692
185 Ga0207652_10000537 3300025921 Bacteria 38510
186 Ga0207646_10037882 3300025922 Unclassified 4346
187 Ga0207646_10040588 3300025922 Unclassified 4185
188 Ga0207646_10074391 3300025922 Bacteria 3035
189 Ga0207646_10227570 3300025922 Unclassified 1685
190 Ga0207650_10033563 3300025925 Bacteria 3718
191 Ga0207659_10040918 3300025926 Bacteria 3244
192 Ga0207700_10073351 3300025928 Bacteria 2643
193 Ga0207644_10000249 3300025931 Bacteria 36628
194 Ga0207644_10019146 3300025931 Bacteria 4641
195 Ga0207706_10107815 3300025933 Bacteria 2451
196 Ga0207686_10000002 3300025934 Bacteria 453961
197 Ga0207686_10000160 3300025934 Bacteria 51361
198 Ga0207686_10016982 3300025934 Bacteria 4092
199 Ga0207709_10000012 3300025935 Bacteria 552803
200 Ga0207665_10000007 3300025939 Bacteria 177869
201 Ga0207665_10000849 3300025939 Bacteria 20648
202 Ga0207665_10015983 3300025939 Bacteria 4928
203 Ga0207691_10050457 3300025940 Bacteria 3809
204 Ga0207711_10004950 3300025941 Bacteria 11309
205 Ga0207711_10177030 3300025941 Bacteria 1938
206 Ga0207689_10006392 3300025942 Bacteria 10431
207 Ga0207689_10013724 3300025942 Bacteria 6904
208 Ga0207689_10030277 3300025942 Bacteria 4511
209 Ga0207651_10021036 3300025960 Bacteria 3954
210 Ga0207651_10180362 3300025960 Bacteria 1675
211 Ga0207668_10169055 3300025972 Bacteria 1713
212 Ga0207640_10077332 3300025981 Bacteria 2262
213 Ga0207703_10000101 3300026035 Bacteria 101290
214 Ga0207703_10198120 3300026035 Bacteria 1783
215 Ga0207639_10165586 3300026041 Bacteria 1867
216 Ga0207708_10000126 3300026075 Bacteria 59505
217 Ga0207708_10003751 3300026075 Bacteria 11198
218 Ga0207708_10036909 3300026075 Bacteria 3722
219 Ga0207702_10014559 3300026078 Bacteria 6526
220 Ga0207641_10109565 3300026088 Bacteria 2446
221 Ga0207641_10120674 3300026088 Bacteria 2339
222 Ga0207648_10017199 3300026089 Bacteria 6589
223 Ga0207648_10026192 3300026089 Bacteria 5184
224 Ga0207676_10028220 3300026095 Bacteria 4190
225 Ga0207676_10120936 3300026095 Unclassified 2208
226 Ga0207675_100020793 3300026118 Bacteria 6118
227 Ga0207675_100063401 3300026118 Bacteria 3453
228 Ga0207683_10030250 3300026121 Bacteria 4691
229 Ga0209588_1019602 3300027671 Unclassified 2112
230 Ga0265338_10050546 3300028800 Unclassified 3757
231 Ga0265760_10004684 3300031090 Bacteria 3915
232 Ga0265332_10002097 3300031238 Bacteria 10350
233 Ga0307509_10050694 3300031507 Bacteria 4443
234 Ga0307408_100004179 3300031548 Bacteria 9841
235 Ga0307508_10123821 3300031616 Bacteria 2188
236 Ga0307405_10002374 3300031731 Bacteria 8290
237 Ga0307407_10049965 3300031903 Bacteria 2390
238 Ga0307412_10017334 3300031911 Unclassified 4310
239 Ga0307416_100184482 3300032002 Bacteria 1959
240 Ga0307411_10103303 3300032005 Bacteria 2021
241 Ga0373949_0000024 3300035090 Bacteria 54168
242 Ga0373941_0007630 3300035115 Bacteria 2654
243 Ga0373961_0000008 3300035241 Bacteria 139095
244 Ga0373927_0054398 3300035695 Bacteria 2589
245 Ga0395900_0069364 3300037418 Bacteria 3623
246 Ga0395898_0061343 3300037466 Bacteria 3653
247 Ga0395905_0001435 3300037471 Bacteria 28680
248 Ga0395901_0015369 3300038443 Bacteria 7791
249 Ga0242420_002316 3300038996 Unclassified 2702
250 Ga0436365_0305790 3300039437 Bacteria 16622
251 Ga0436365_1520753 3300039437 Bacteria 20232
252 Ga0451853_1820606 3300041512 Bacteria 1431
253 Ga0439458_0006403 3300042157 Unclassified 2626
254 Ga0466966_0129968 3300044684 Unclassified 1543
255 Ga0466964_0030718 3300044706 Bacteria 2127
256 Ga0466967_0133260 3300045976 Bacteria 2309
257 Ga0495580_0004225 3300046472 Bacteria 12078
258 Ga0495580_0030320 3300046472 Bacteria 3917
259 Ga0495634_0069084 3300046642 Bacteria 2332
260 Ga0495635_0127924 3300046663 Bacteria 1732
261 Ga0495659_0016848 3300046664 Bacteria 2415
262 Ga0496103_0121036 3300048906 Bacteria 1667
263 Ga0496104_0273255 3300048907 Bacteria 1603
264 Ga0496106_0003284 3300048909 Bacteria 12081
265 Ga0496109_0094599 3300048912 Bacteria 2766
266 Ga0496110_0379125 3300048913 Bacteria 1289
267 Ga0501202_001702 3300049652 Bacteria 3566
268 Ga0501207_001284 3300049654 Bacteria 3112
269 Ga0501209_006279 3300049656 Bacteria 2207
270 Ga0501214_001014 3300049659 Bacteria 2104
271 Ga0501216_000538 3300049660 Bacteria 4548
272 Ga0501217_000298 3300049661 Bacteria 7813
273 Ga0501223_004753 3300049663 Bacteria 2890
274 Ga0501227_000880 3300049665 Bacteria 6571
275 Ga0501233_001316 3300049668 Bacteria 4247
276 Ga0501229_001897 3300049706 Bacteria 2451
277 nmdc:mga00v17_104733_c1 3300050491 Bacteria 1789
278 nmdc:mga00v17_66931_c1 3300050491 Bacteria 2219
279 nmdc:mga0yw44_54748_c1 3300050492 Unclassified 2426
280 nmdc:mga0k408_8466_c1 3300050493 Bacteria 5524
281 nmdc:mga06z11_42005_c1 3300050494 Bacteria 2291
282 nmdc:mga07m45_56620_c1 3300050496 Bacteria 2216
283 nmdc:mga05p37_166690_c1 3300050507 Bacteria 2688
284 nmdc:mga06r32_423445_c1 3300050510 Bacteria 1312
285 nmdc:mga08y16_163479_c1 3300050511 Bacteria 2313
286 nmdc:mga08y16_194927_c1 3300050511 Bacteria 2100
287 nmdc:mga08y16_212699_c1 3300050511 Bacteria 2002
288 nmdc:mga08y16_42182_c1 3300050511 Bacteria 4779
289 nmdc:mga0n895_41139_c1 3300050512 Unclassified 4492
290 nmdc:mga0n895_58966_c1 3300050512 Unclassified 3787
291 nmdc:mga0rr50_1734_c1 3300050513 Bacteria 12032
292 nmdc:mga0rr50_440_c1 3300050513 Bacteria 22331
293 nmdc:mga0rr50_86501_c1 3300050513 Unclassified 2431
294 nmdc:mga08x19_107167_c1 3300050514 Bacteria 1860
295 nmdc:mga08x19_10902_c1 3300050514 Bacteria 5466
296 nmdc:mga08x19_21442_c1 3300050514 Unclassified 3988
297 nmdc:mga08x19_8_c1 3300050514 Bacteria 427794
298 nmdc:mga0a205_103624_c1 3300050515 Unclassified 2744
299 nmdc:mga0a205_132033_c1 3300050515 Unclassified 2398
300 nmdc:mga0a205_29616_c1 3300050515 Bacteria 5240
301 nmdc:mga0a205_33954_c1 3300050515 Unclassified 4893
302 nmdc:mga0a205_8494_c1 3300050515 Bacteria 9341
303 Ga0500597_007829 3300053120 Bacteria 3650

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025925 Ga0207650_10033563 Ga0207650_100335632 369
2 3300014325 Ga0163163_10046751 Ga0163163_100467513 371
3 3300005293 Ga0065715_10125413 Ga0065715_101254132 373
4 3300005440 Ga0070705_100052634 Ga0070705_1000526342 374
5 3300005843 Ga0068860_100095388 Ga0068860_1000953882 374
6 3300006237 Ga0097621_100005820 Ga0097621_1000058202 374
7 3300006358 Ga0068871_100010671 Ga0068871_1000106712 374
8 3300009094 Ga0111539_10073027 Ga0111539_100730273 374
9 3300009551 Ga0105238_10404004 Ga0105238_104040041 374
10 3300025904 Ga0207647_10001597 Ga0207647_100015972 374
11 3300026075 Ga0207708_10036909 Ga0207708_100369092 374
12 3300050511 nmdc:mga08y16_212699_c1 nmdc:mga08y16_212699_c1_329_1573 374
13 3300005337 Ga0070682_100024839 Ga0070682_1000248393 376
14 3300005842 Ga0068858_100155701 Ga0068858_1001557012 376
15 3300025928 Ga0207700_10073351 Ga0207700_100733513 376
16 3300026035 Ga0207703_10198120 Ga0207703_101981202 376
17 3300031507 Ga0307509_10050694 Ga0307509_100506942 376
18 3300014325 Ga0163163_10091905 Ga0163163_100919053 377
19 3300005545 Ga0070695_100028518 Ga0070695_1000285182 378
20 3300005617 Ga0068859_100007366 Ga0068859_1000073662 379
21 3300005842 Ga0068858_100105181 Ga0068858_1001051811 379
22 3300005843 Ga0068860_100121522 Ga0068860_1001215223 379
23 3300006931 Ga0097620_100007366 Ga0097620_1000073662 379
24 3300014326 Ga0157380_10050225 Ga0157380_100502252 379
25 3300026095 Ga0207676_10120936 Ga0207676_101209362 379
26 3300050513 nmdc:mga0rr50_1734_c1 nmdc:mga0rr50_1734_c1_81_1220 379
27 3300014968 Ga0157379_10027459 Ga0157379_100274594 380
28 3300005444 Ga0070694_100052902 Ga0070694_1000529022 381
29 3300006844 Ga0075428_100291758 Ga0075428_1002917581 382
30 3300005356 Ga0070674_100014181 Ga0070674_1000141814 383
31 3300025926 Ga0207659_10040918 Ga0207659_100409182 384
32 3300006914 Ga0075436_100000016 Ga0075436_10000001674 385
33 3300007076 Ga0075435_100000971 Ga0075435_10000097110 385
34 3300050507 nmdc:mga05p37_166690_c1 nmdc:mga05p37_166690_c1_1205_2443 385
35 3300050513 nmdc:mga0rr50_440_c1 nmdc:mga0rr50_440_c1_12568_13788 385
36 3300050514 nmdc:mga08x19_8_c1 nmdc:mga08x19_8_c1_177708_178928 385
37 3300006042 Ga0075368_10018385 Ga0075368_100183852 386
38 3300006051 Ga0075364_10002667 Ga0075364_100026676 386
39 3300006178 Ga0075367_10005446 Ga0075367_100054464 386
40 3300006353 Ga0075370_10005613 Ga0075370_100056133 386
41 3300050491 nmdc:mga00v17_66931_c1 nmdc:mga00v17_66931_c1_880_2115 386
42 3300050494 nmdc:mga06z11_42005_c1 nmdc:mga06z11_42005_c1_1015_2250 386
43 3300050496 nmdc:mga07m45_56620_c1 nmdc:mga07m45_56620_c1_390_1625 386
44 3300006163 Ga0070715_10000030 Ga0070715_1000003061 387
45 3300007076 Ga0075435_100086843 Ga0075435_1000868431 387
46 3300025905 Ga0207685_10000009 Ga0207685_1000000915 387
47 3300050514 nmdc:mga08x19_10902_c1 nmdc:mga08x19_10902_c1_2713_3894 387
48 3300005843 Ga0068860_100023881 Ga0068860_1000238814 388
49 3300005468 Ga0070707_100014908 Ga0070707_1000149084 389
50 3300025922 Ga0207646_10037882 Ga0207646_100378823 389
51 3300005844 Ga0068862_100089379 Ga0068862_1000893791 390
52 3300009147 Ga0114129_10213720 Ga0114129_102137201 390
53 3300009176 Ga0105242_10031909 Ga0105242_100319092 390
54 3300013308 Ga0157375_10015147 Ga0157375_100151472 390
55 3300025934 Ga0207686_10016982 Ga0207686_100169822 390
56 3300050515 nmdc:mga0a205_33954_c1 nmdc:mga0a205_33954_c1_121_1362 390
57 3300005518 Ga0070699_100088211 Ga0070699_1000882113 391
58 3300009094 Ga0111539_10159038 Ga0111539_101590382 391
59 3300014969 Ga0157376_10101494 Ga0157376_101014942 391
60 3300025922 Ga0207646_10040588 Ga0207646_100405882 391
61 3300050511 nmdc:mga08y16_163479_c1 nmdc:mga08y16_163479_c1_389_1630 391
62 3300005617 Ga0068859_100009941 Ga0068859_1000099418 392
63 3300006931 Ga0097620_100009941 Ga0097620_1000099418 392
64 3300026075 Ga0207708_10003751 Ga0207708_100037512 392
65 3300006914 Ga0075436_100014232 Ga0075436_1000142322 394
66 3300009098 Ga0105245_10246967 Ga0105245_102469671 394
67 3300009545 Ga0105237_10151722 Ga0105237_101517221 394
68 3300021384 Ga0213876_10000872 Ga0213876_100008722 394
69 3300039437 Ga0436365_1520753 Ga0436365_1520753_17880_19115 394
70 3300044684 Ga0466966_0129968 Ga0466966_0129968_283_1485 394
71 3300048906 Ga0496103_0121036 Ga0496103_0121036_295_1488 394
72 3300048907 Ga0496104_0273255 Ga0496104_0273255_143_1336 394
73 3300048913 Ga0496110_0379125 Ga0496110_0379125_35_1228 394
74 3300031238 Ga0265332_10002097 Ga0265332_100020973 395
75 3300009148 Ga0105243_10011189 Ga0105243_100111897 396
76 3300013297 Ga0157378_10000001 Ga0157378_10000001206 396
77 3300044706 Ga0466964_0030718 Ga0466964_0030718_876_2105 396
78 3300045976 Ga0466967_0133260 Ga0466967_0133260_568_1797 396
79 3300048909 Ga0496106_0003284 Ga0496106_0003284_2392_3624 396
80 3300005290 Ga0065712_10072937 Ga0065712_100729371 397
81 3300005293 Ga0065715_10031244 Ga0065715_100312441 397
82 3300005330 Ga0070690_100032000 Ga0070690_1000320001 397
83 3300005354 Ga0070675_100087236 Ga0070675_1000872362 397
84 3300005459 Ga0068867_100068473 Ga0068867_1000684731 397
85 3300005539 Ga0068853_100241745 Ga0068853_1002417452 397
86 3300005544 Ga0070686_100008047 Ga0070686_1000080474 397
87 3300005549 Ga0070704_100186469 Ga0070704_1001864691 397
88 3300009098 Ga0105245_10186748 Ga0105245_101867482 397
89 3300013296 Ga0157374_10032781 Ga0157374_100327813 397
90 3300013306 Ga0163162_10037685 Ga0163162_100376851 397
91 3300026089 Ga0207648_10026192 Ga0207648_100261922 397
92 3300050512 nmdc:mga0n895_41139_c1 nmdc:mga0n895_41139_c1_1934_3127 397
93 3300050515 nmdc:mga0a205_8494_c1 nmdc:mga0a205_8494_c1_365_1558 397
94 3300009101 Ga0105247_10000001 Ga0105247_1000000161 398
95 3300005343 Ga0070687_100070990 Ga0070687_1000709902 399
96 3300005468 Ga0070707_100084903 Ga0070707_1000849032 399
97 3300025922 Ga0207646_10074391 Ga0207646_100743913 399
98 3300041512 Ga0451853_1820606 Ga0451853_1820606_117_1343 399
99 3300006852 Ga0075433_10149969 Ga0075433_101499692 400
100 3300005444 Ga0070694_100127670 Ga0070694_1001276701 401
101 3300009094 Ga0111539_10038827 Ga0111539_100388277 401
102 3300025942 Ga0207689_10013724 Ga0207689_100137244 401
103 3300050511 nmdc:mga08y16_42182_c1 nmdc:mga08y16_42182_c1_2130_3350 401
104 3300005293 Ga0065715_10111096 Ga0065715_101110961 402
105 3300005518 Ga0070699_100042718 Ga0070699_1000427182 402
106 3300005536 Ga0070697_100040866 Ga0070697_1000408662 402
107 3300006051 Ga0075364_10004732 Ga0075364_100047324 402
108 3300006195 Ga0075366_10026068 Ga0075366_100260682 402
109 3300050493 nmdc:mga0k408_8466_c1 nmdc:mga0k408_8466_c1_2767_4002 402
110 3300005355 Ga0070671_100030333 Ga0070671_1000303334 403
111 3300005618 Ga0068864_100017929 Ga0068864_1000179294 403
112 3300005842 Ga0068858_100063820 Ga0068858_1000638202 403
113 3300013308 Ga0157375_10042026 Ga0157375_100420262 403
114 3300014325 Ga0163163_10125979 Ga0163163_101259791 403
115 3300026095 Ga0207676_10028220 Ga0207676_100282204 403
116 3300042157 Ga0439458_0006403 Ga0439458_0006403_257_1474 403
117 3300050492 nmdc:mga0yw44_54748_c1 nmdc:mga0yw44_54748_c1_15_1292 403
118 3300050510 nmdc:mga06r32_423445_c1 nmdc:mga06r32_423445_c1_10_1251 403
119 3300005364 Ga0070673_100029902 Ga0070673_1000299023 404
120 3300005843 Ga0068860_100218402 Ga0068860_1002184021 404
121 3300006051 Ga0075364_10010771 Ga0075364_100107712 404
122 3300009094 Ga0111539_10115480 Ga0111539_101154802 404
123 3300025960 Ga0207651_10021036 Ga0207651_100210363 404
124 3300050491 nmdc:mga00v17_104733_c1 nmdc:mga00v17_104733_c1_323_1564 404
125 3300050511 nmdc:mga08y16_194927_c1 nmdc:mga08y16_194927_c1_511_1803 404
126 3300005355 Ga0070671_100091747 Ga0070671_1000917471 405
127 3300005444 Ga0070694_100003403 Ga0070694_1000034037 405
128 3300005459 Ga0068867_100029847 Ga0068867_1000298473 405
129 3300005466 Ga0070685_10099512 Ga0070685_100995122 405
130 3300005543 Ga0070672_100052996 Ga0070672_1000529963 405
131 3300005546 Ga0070696_100050100 Ga0070696_1000501002 405
132 3300005578 Ga0068854_100045955 Ga0068854_1000459553 405
133 3300005617 Ga0068859_100099972 Ga0068859_1000999722 405
134 3300005718 Ga0068866_10010184 Ga0068866_100101843 405
135 3300005843 Ga0068860_100024361 Ga0068860_1000243614 405
136 3300006358 Ga0068871_100037165 Ga0068871_1000371652 405
137 3300006931 Ga0097620_100099980 Ga0097620_1000999803 405
138 3300009148 Ga0105243_10016003 Ga0105243_100160033 405
139 3300009176 Ga0105242_10206916 Ga0105242_102069162 405
140 3300011119 Ga0105246_10022369 Ga0105246_100223693 405
141 3300013297 Ga0157378_10027424 Ga0157378_100274241 405
142 3300017792 Ga0163161_10036438 Ga0163161_100364383 405
143 3300025907 Ga0207645_10104808 Ga0207645_101048081 405
144 3300025908 Ga0207643_10125624 Ga0207643_101256242 405
145 3300025918 Ga0207662_10007945 Ga0207662_100079455 405
146 3300025931 Ga0207644_10019146 Ga0207644_100191462 405
147 3300025940 Ga0207691_10050457 Ga0207691_100504573 405
148 3300025941 Ga0207711_10177030 Ga0207711_101770302 405
149 3300025942 Ga0207689_10006392 Ga0207689_100063927 405
150 3300025960 Ga0207651_10180362 Ga0207651_101803621 405
151 3300025981 Ga0207640_10077332 Ga0207640_100773322 405
152 3300026089 Ga0207648_10017199 Ga0207648_100171997 405
153 3300026118 Ga0207675_100063401 Ga0207675_1000634014 405
154 3300046642 Ga0495634_0069084 Ga0495634_0069084_358_1590 405
155 3300046663 Ga0495635_0127924 Ga0495635_0127924_135_1367 405
156 3300005331 Ga0070670_100025928 Ga0070670_1000259283 406
157 3300005336 Ga0070680_100057872 Ga0070680_1000578723 406
158 3300005444 Ga0070694_100107132 Ga0070694_1001071321 406
159 3300005458 Ga0070681_10000806 Ga0070681_1000080615 406
160 3300005458 Ga0070681_10059894 Ga0070681_100598942 406
161 3300005468 Ga0070707_100258589 Ga0070707_1002585892 406
162 3300005530 Ga0070679_100000266 Ga0070679_10000026622 406
163 3300005536 Ga0070697_100048763 Ga0070697_1000487631 406
164 3300005564 Ga0070664_100061485 Ga0070664_1000614852 406
165 3300005614 Ga0068856_100006611 Ga0068856_1000066111 406
166 3300005617 Ga0068859_100008420 Ga0068859_1000084206 406
167 3300005841 Ga0068863_100089907 Ga0068863_1000899072 406
168 3300006852 Ga0075433_10157253 Ga0075433_101572532 406
169 3300006871 Ga0075434_100171105 Ga0075434_1001711052 406
170 3300006931 Ga0097620_100008420 Ga0097620_1000084206 406
171 3300009176 Ga0105242_10000344 Ga0105242_1000034422 406
172 3300009177 Ga0105248_10003792 Ga0105248_100037926 406
173 3300013297 Ga0157378_10058387 Ga0157378_100583872 406
174 3300013306 Ga0163162_10076907 Ga0163162_100769072 406
175 3300017792 Ga0163161_10008648 Ga0163161_100086483 406
176 3300025912 Ga0207707_10000050 Ga0207707_1000005025 406
177 3300025917 Ga0207660_10067357 Ga0207660_100673573 406
178 3300025918 Ga0207662_10113520 Ga0207662_101135202 406
179 3300025921 Ga0207652_10000537 Ga0207652_100005375 406
180 3300025922 Ga0207646_10227570 Ga0207646_102275701 406
181 3300025934 Ga0207686_10000160 Ga0207686_1000016023 406
182 3300025941 Ga0207711_10004950 Ga0207711_100049506 406
183 3300026041 Ga0207639_10165586 Ga0207639_101655862 406
184 3300026075 Ga0207708_10000126 Ga0207708_100001264 406
185 3300026078 Ga0207702_10014559 Ga0207702_100145591 406
186 3300026088 Ga0207641_10120674 Ga0207641_101206742 406
187 3300031548 Ga0307408_100004179 Ga0307408_1000041795 406
188 3300031616 Ga0307508_10123821 Ga0307508_101238212 406
189 3300031731 Ga0307405_10002374 Ga0307405_100023744 406
190 3300031903 Ga0307407_10049965 Ga0307407_100499652 406
191 3300031911 Ga0307412_10017334 Ga0307412_100173344 406
192 3300032002 Ga0307416_100184482 Ga0307416_1001844822 406
193 3300032005 Ga0307411_10103303 Ga0307411_101033032 406
194 3300038996 Ga0242420_002316 Ga0242420_002316_589_1827 406
195 3300049652 Ga0501202_001702 Ga0501202_001702_1257_2498 406
196 3300049654 Ga0501207_001284 Ga0501207_001284_1310_2536 406
197 3300049656 Ga0501209_006279 Ga0501209_006279_130_1371 406
198 3300049659 Ga0501214_001014 Ga0501214_001014_90_1316 406
199 3300049660 Ga0501216_000538 Ga0501216_000538_1600_2841 406
200 3300049661 Ga0501217_000298 Ga0501217_000298_1514_2740 406
201 3300049663 Ga0501223_004753 Ga0501223_004753_109_1335 406
202 3300049665 Ga0501227_000880 Ga0501227_000880_429_1655 406
203 3300049668 Ga0501233_001316 Ga0501233_001316_1508_2749 406
204 3300049706 Ga0501229_001897 Ga0501229_001897_1074_2315 406
205 3300050513 nmdc:mga0rr50_86501_c1 nmdc:mga0rr50_86501_c1_952_2193 406
206 3300050515 nmdc:mga0a205_103624_c1 nmdc:mga0a205_103624_c1_814_2055 406
207 3300050515 nmdc:mga0a205_132033_c1 nmdc:mga0a205_132033_c1_422_1675 406
208 3300006847 Ga0075431_100308810 Ga0075431_1003088101 407
209 3300005293 Ga0065715_10095378 Ga0065715_100953782 408
210 3300005440 Ga0070705_100034038 Ga0070705_1000340382 408
211 3300005458 Ga0070681_10000976 Ga0070681_1000097617 408
212 3300005518 Ga0070699_100004169 Ga0070699_1000041695 408
213 3300005546 Ga0070696_100039969 Ga0070696_1000399693 408
214 3300005547 Ga0070693_100005826 Ga0070693_1000058264 408
215 3300005985 Ga0081539_10000508 Ga0081539_1000050854 408
216 3300006173 Ga0070716_100073243 Ga0070716_1000732432 408
217 3300006871 Ga0075434_100037503 Ga0075434_1000375035 408
218 3300006914 Ga0075436_100055115 Ga0075436_1000551152 408
219 3300007076 Ga0075435_100057774 Ga0075435_1000577743 408
220 3300009148 Ga0105243_10000022 Ga0105243_1000002257 408
221 3300009176 Ga0105242_10000014 Ga0105242_1000001447 408
222 3300009545 Ga0105237_10041701 Ga0105237_100417013 408
223 3300021384 Ga0213876_10001402 Ga0213876_1000140213 408
224 3300025912 Ga0207707_10051926 Ga0207707_100519261 408
225 3300025939 Ga0207665_10015983 Ga0207665_100159833 408
226 3300039437 Ga0436365_0305790 Ga0436365_0305790_14212_15456 408
227 3300050514 nmdc:mga08x19_21442_c1 nmdc:mga08x19_21442_c1_1284_2531 408
228 3300050515 nmdc:mga0a205_29616_c1 nmdc:mga0a205_29616_c1_2437_3684 408
229 3300005719 Ga0068861_100190152 Ga0068861_1001901522 409
230 3300006173 Ga0070716_100000002 Ga0070716_10000000255 409
231 3300009098 Ga0105245_10298587 Ga0105245_102985871 409
232 3300025939 Ga0207665_10000007 Ga0207665_10000007135 409
233 3300026118 Ga0207675_100020793 Ga0207675_1000207932 409
234 3300035115 Ga0373941_0007630 Ga0373941_0007630_1103_2398 409
235 3300035695 Ga0373927_0054398 Ga0373927_0054398_784_2055 409
236 3300046472 Ga0495580_0004225 Ga0495580_0004225_3556_4827 409
237 3300053120 Ga0500597_007829 Ga0500597_007829_174_1418 409
238 3300003203 JGI25406J46586_10000136 JGI25406J46586_100001369 410
239 3300005334 Ga0068869_100016375 Ga0068869_1000163752 410
240 3300005471 Ga0070698_100075906 Ga0070698_1000759063 410
241 3300005985 Ga0081539_10000149 Ga0081539_10000149106 410
242 3300025942 Ga0207689_10030277 Ga0207689_100302771 410
243 3300028800 Ga0265338_10050546 Ga0265338_100505462 410
244 3300035241 Ga0373961_0000008 Ga0373961_0000008_52893_54137 410
245 3300002074 JGI24748J21848_1000006 JGI24748J21848_1000006128 411
246 3300002239 JGI24034J26672_10000002 JGI24034J26672_10000002590 411
247 3300005340 Ga0070689_100091350 Ga0070689_1000913503 411
248 3300005355 Ga0070671_100037324 Ga0070671_1000373242 411
249 3300005406 Ga0070703_10000218 Ga0070703_100002183 411
250 3300005440 Ga0070705_100000015 Ga0070705_10000001547 411
251 3300005456 Ga0070678_100018166 Ga0070678_1000181666 411
252 3300005467 Ga0070706_100000290 Ga0070706_10000029011 411
253 3300005467 Ga0070706_100010514 Ga0070706_1000105144 411
254 3300005467 Ga0070706_100010612 Ga0070706_1000106123 411
255 3300005467 Ga0070706_100065329 Ga0070706_1000653293 411
256 3300005471 Ga0070698_100003659 Ga0070698_1000036596 411
257 3300005471 Ga0070698_100054147 Ga0070698_1000541472 411
258 3300005518 Ga0070699_100000102 Ga0070699_10000010223 411
259 3300005518 Ga0070699_100016671 Ga0070699_1000166712 411
260 3300005536 Ga0070697_100002506 Ga0070697_1000025069 411
261 3300005536 Ga0070697_100152716 Ga0070697_1001527161 411
262 3300005546 Ga0070696_100000006 Ga0070696_10000000665 411
263 3300005546 Ga0070696_100011498 Ga0070696_1000114985 411
264 3300005547 Ga0070693_100115774 Ga0070693_1001157742 411
265 3300005841 Ga0068863_100124965 Ga0068863_1001249651 411
266 3300005842 Ga0068858_100000227 Ga0068858_10000022742 411
267 3300006173 Ga0070716_100001266 Ga0070716_1000012665 411
268 3300006852 Ga0075433_10078806 Ga0075433_100788063 411
269 3300006871 Ga0075434_100170163 Ga0075434_1001701632 411
270 3300006914 Ga0075436_100070906 Ga0075436_1000709063 411
271 3300007265 Ga0099794_10034616 Ga0099794_100346162 411
272 3300009147 Ga0114129_10049333 Ga0114129_100493334 411
273 3300009147 Ga0114129_10100411 Ga0114129_101004112 411
274 3300013306 Ga0163162_10286123 Ga0163162_102861232 411
275 3300024227 Ga0228598_1001233 Ga0228598_10012334 411
276 3300025223 Ga0207672_1000363 Ga0207672_10003634 411
277 3300025885 Ga0207653_10000168 Ga0207653_1000016819 411
278 3300025900 Ga0207710_10000003 Ga0207710_10000003576 411
279 3300025910 Ga0207684_10000073 Ga0207684_10000073160 411
280 3300025910 Ga0207684_10000236 Ga0207684_1000023663 411
281 3300025910 Ga0207684_10180040 Ga0207684_101800401 411
282 3300025915 Ga0207693_10003406 Ga0207693_1000340613 411
283 3300025931 Ga0207644_10000249 Ga0207644_1000024915 411
284 3300025933 Ga0207706_10107815 Ga0207706_101078152 411
285 3300025934 Ga0207686_10000002 Ga0207686_10000002306 411
286 3300025935 Ga0207709_10000012 Ga0207709_10000012129 411
287 3300025939 Ga0207665_10000849 Ga0207665_100008495 411
288 3300025972 Ga0207668_10169055 Ga0207668_101690552 411
289 3300026035 Ga0207703_10000101 Ga0207703_1000010113 411
290 3300026088 Ga0207641_10109565 Ga0207641_101095652 411
291 3300026121 Ga0207683_10030250 Ga0207683_100302507 411
292 3300027671 Ga0209588_1019602 Ga0209588_10196022 411
293 3300031090 Ga0265760_10004684 Ga0265760_100046841 411
294 3300035090 Ga0373949_0000024 Ga0373949_0000024_22382_23623 411
295 3300037418 Ga0395900_0069364 Ga0395900_0069364_1693_2934 411
296 3300037466 Ga0395898_0061343 Ga0395898_0061343_2167_3408 411
297 3300037471 Ga0395905_0001435 Ga0395905_0001435_15676_16932 411
298 3300038443 Ga0395901_0015369 Ga0395901_0015369_394_1635 411
299 3300046472 Ga0495580_0030320 Ga0495580_0030320_1925_3199 411
300 3300046664 Ga0495659_0016848 Ga0495659_0016848_129_1370 411
301 3300048912 Ga0496109_0094599 Ga0496109_0094599_458_1732 411
302 3300050512 nmdc:mga0n895_58966_c1 nmdc:mga0n895_58966_c1_177_1412 411
303 3300050514 nmdc:mga08x19_107167_c1 nmdc:mga08x19_107167_c1_283_1584 411

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01979

Amidohydro_1

Amidohydrolase family

84

413

0.84

PF07969

Amidohydro_3

Amidohydrolase family

188

413

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3mtw-assembly1.cif.gz_A crystal structure of l-lysine, l-arginine carboxypeptidase cc2672 from caulobacter crescentus cb15 complexed with n-methyl phosphonate derivative of l-arginine 0.9011 30 408
8ihq-assembly1.cif.gz_D cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 0.8893 32 408
2qs8-assembly1.cif.gz_A crystal structure of a xaa-pro dipeptidase with bound methionine in the active site 0.8876 30 408
3feq-assembly2.cif.gz_P crystal structure of uncharacterized protein eah89906 0.8861 30 408
8ihs-assembly1.cif.gz_B cryo-em structure of ochratoxin a-detoxifying amidohydrolase adh3 in complex with ochratoxin a 0.8859 32 408
ID Description Score Start End Superfamily
3be7A01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9455 369 408 2.30.40.10
2p9bA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9435 371 406 2.30.40.10
4whbE01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.9167 369 406 2.30.40.10
2r8cA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8735 366 408 2.30.40.10
3gnhA01 Mainly Beta;Roll;Urease, subunit C; domain 1;Urease, subunit C, domain 1 0.8567 30 81 2.30.40.10
ID Description Score Start End GO Terms
AF-A0A2V7M297-F1-model_v4 Amidohydrolase 0.9833 250 411 GO:0016810
AF-A0A2V8H9B9-F1-model_v4 Amidohydrolase 0.9829 240 408 GO:0016810
AF-A0A7Y5QPC8-F1-model_v4 Amidohydrolase family protein 0.9794 215 408 GO:0016810
AF-A0A7Y5V489-F1-model_v4 VCBS repeat-containing protein 0.9682 25 408 GO:0016810
AF-A0A2V7KST1-F1-model_v4 Amidohydrolase 0.9675 21 409 GO:0016810

Feature Viewer

pLDDT pTM Quality
92.73 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map