F396851
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 303 | 176 | 301 | 347 |
Family's Representative Sequence
| Representative Sequence | 3300005344|Ga0070661_100112599|Ga0070661_1001125993 |
| Length | 326 |
| Sequence | MIQGSFIDTLLYAPSYGWKDQSDRLIVPSSKQLWSEAFSRINIFRSRKNWISFVSFAAVVIYSMAVMGTHGTIWFHRYCTHKSYGFSHPIWRIVTQNIVIKTIPEEIYVVSHHVHHCKSDEPGDPYNSQAGFLYCMLAEYNHQRVSPYLEEDAYKKALHFMEHTGVKMNTYKQYRKWGSLSSPAYTIAVWMINWAFWFAVFFLIGGAALACAIFTAALLWFTFVRAFNYTGHGRGQKKHREGIDFDRSNLSINQARPGLLAGEWHNNHHLFPGSARAGFLPGQLDLAWVYIYTLRRLRMVSWYKDSKKEFLKKYVAAAPSSKRSTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 126 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 127 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 130 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 142 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 143 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 144 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 145 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 146 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 147 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 148 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 149 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 150 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 151 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 152 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 153 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 154 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 155 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 156 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 157 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 158 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 159 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 160 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 161 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 162 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 163 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 164 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 165 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 167 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 168 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 172 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 173 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 174 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 175 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 176 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0 |
| Isolates | 0.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.64 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 94.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10073230 | 3300003316 | Unclassified | 1981 |
| 2 | rootH2_10024039 | 3300003320 | Bacteria | 38953 |
| 3 | rootL2_10009364 | 3300003322 | Bacteria | 1909 |
| 4 | rootL2_10255980 | 3300003322 | Bacteria | 1589 |
| 5 | rootH1_10001036 | 3300003323 | Bacteria | 30037 |
| 6 | rootH1_10022472 | 3300003323 | Bacteria | 6084 |
| 7 | Ga0065707_10009281 | 3300005295 | Bacteria | 2933 |
| 8 | Ga0070676_10014069 | 3300005328 | Bacteria | 4391 |
| 9 | Ga0070676_10119447 | 3300005328 | Bacteria | 1652 |
| 10 | Ga0070683_100005655 | 3300005329 | Bacteria | 10442 |
| 11 | Ga0070690_100095524 | 3300005330 | Bacteria | 1963 |
| 12 | Ga0070690_100141270 | 3300005330 | Bacteria | 1635 |
| 13 | Ga0070670_100007852 | 3300005331 | Bacteria | 9077 |
| 14 | Ga0070670_100084464 | 3300005331 | Bacteria | 2727 |
| 15 | Ga0070677_10002782 | 3300005333 | Bacteria | 5603 |
| 16 | Ga0068869_100012073 | 3300005334 | Bacteria | 5694 |
| 17 | Ga0068869_100056008 | 3300005334 | Bacteria | 2874 |
| 18 | Ga0068869_100072933 | 3300005334 | Bacteria | 2545 |
| 19 | Ga0070666_10003784 | 3300005335 | Bacteria | 9172 |
| 20 | Ga0070666_10073776 | 3300005335 | Bacteria | 2324 |
| 21 | Ga0068868_100005347 | 3300005338 | Bacteria | 9014 |
| 22 | Ga0068868_100179410 | 3300005338 | Bacteria | 1756 |
| 23 | Ga0068868_100362989 | 3300005338 | Unclassified | 1243 |
| 24 | Ga0070689_100120673 | 3300005340 | Bacteria | 2093 |
| 25 | Ga0070661_100071690 | 3300005344 | Unclassified | 2550 |
| 26 | Ga0070661_100112599 | 3300005344 | Bacteria | 2033 |
| 27 | Ga0070669_100006436 | 3300005353 | Bacteria | 8455 |
| 28 | Ga0070669_100047747 | 3300005353 | Bacteria | 3123 |
| 29 | Ga0070675_100176140 | 3300005354 | Bacteria | 1847 |
| 30 | Ga0070671_100005053 | 3300005355 | Bacteria | 10519 |
| 31 | Ga0070671_100064959 | 3300005355 | Unclassified | 3039 |
| 32 | Ga0070674_100041867 | 3300005356 | Bacteria | 3108 |
| 33 | Ga0070673_100065868 | 3300005364 | Bacteria | 2892 |
| 34 | Ga0070673_100340363 | 3300005364 | Bacteria | 1329 |
| 35 | Ga0070659_100046372 | 3300005366 | Bacteria | 3407 |
| 36 | Ga0070667_100009708 | 3300005367 | Bacteria | 7977 |
| 37 | Ga0070667_100060795 | 3300005367 | Bacteria | 3197 |
| 38 | Ga0070678_100027979 | 3300005456 | Bacteria | 3837 |
| 39 | Ga0070678_100048244 | 3300005456 | Bacteria | 3065 |
| 40 | Ga0070678_100110529 | 3300005456 | Bacteria | 2149 |
| 41 | Ga0070662_100052557 | 3300005457 | Bacteria | 2946 |
| 42 | Ga0070681_10010876 | 3300005458 | Bacteria | 8995 |
| 43 | Ga0068867_100016567 | 3300005459 | Bacteria | 5234 |
| 44 | Ga0068867_100017783 | 3300005459 | Bacteria | 5047 |
| 45 | Ga0068867_100108878 | 3300005459 | Bacteria | 2126 |
| 46 | Ga0070685_10012675 | 3300005466 | Bacteria | 4434 |
| 47 | Ga0070698_100002200 | 3300005471 | Bacteria | 21650 |
| 48 | Ga0070684_100029718 | 3300005535 | Bacteria | 4634 |
| 49 | Ga0070684_100099272 | 3300005535 | Unclassified | 2598 |
| 50 | Ga0068853_100108111 | 3300005539 | Bacteria | 2467 |
| 51 | Ga0068853_100130738 | 3300005539 | Bacteria | 2247 |
| 52 | Ga0068853_100220261 | 3300005539 | Bacteria | 1733 |
| 53 | Ga0070672_100042689 | 3300005543 | Bacteria | 3493 |
| 54 | Ga0070686_100036032 | 3300005544 | Bacteria | 3060 |
| 55 | Ga0070693_100072702 | 3300005547 | Bacteria | 2029 |
| 56 | Ga0070665_100006860 | 3300005548 | Bacteria | 11579 |
| 57 | Ga0070664_100039993 | 3300005564 | Bacteria | 3953 |
| 58 | Ga0070664_100112002 | 3300005564 | Bacteria | 2383 |
| 59 | Ga0070664_100125770 | 3300005564 | Bacteria | 2249 |
| 60 | Ga0068857_100000945 | 3300005577 | Bacteria | 22138 |
| 61 | Ga0068857_100162730 | 3300005577 | Bacteria | 2025 |
| 62 | Ga0068854_100095833 | 3300005578 | Bacteria | 2216 |
| 63 | Ga0068856_100023985 | 3300005614 | Bacteria | 5933 |
| 64 | Ga0070702_100032308 | 3300005615 | Bacteria | 2871 |
| 65 | Ga0070702_100191166 | 3300005615 | Bacteria | 1347 |
| 66 | Ga0068852_100006922 | 3300005616 | Bacteria | 8246 |
| 67 | Ga0068852_100007004 | 3300005616 | Bacteria | 8207 |
| 68 | Ga0068852_100227690 | 3300005616 | Bacteria | 1776 |
| 69 | Ga0068852_100262069 | 3300005616 | Unclassified | 1660 |
| 70 | Ga0068859_100013424 | 3300005617 | Bacteria | 8214 |
| 71 | Ga0068859_100160341 | 3300005617 | Bacteria | 2328 |
| 72 | Ga0068859_100266860 | 3300005617 | Bacteria | 1804 |
| 73 | Ga0068864_100026400 | 3300005618 | Bacteria | 4900 |
| 74 | Ga0068864_100204248 | 3300005618 | Bacteria | 1816 |
| 75 | Ga0068866_10011577 | 3300005718 | Bacteria | 3821 |
| 76 | Ga0068861_100060276 | 3300005719 | Bacteria | 2908 |
| 77 | Ga0068861_100186782 | 3300005719 | Bacteria | 1729 |
| 78 | Ga0068851_10037634 | 3300005834 | Bacteria | 2426 |
| 79 | Ga0068863_100013765 | 3300005841 | Bacteria | 7796 |
| 80 | Ga0068863_100274968 | 3300005841 | Unclassified | 1631 |
| 81 | Ga0068860_100032031 | 3300005843 | Bacteria | 5055 |
| 82 | Ga0068862_100049546 | 3300005844 | Bacteria | 3588 |
| 83 | Ga0075366_10142809 | 3300006195 | Bacteria | 1448 |
| 84 | Ga0097621_100000260 | 3300006237 | Bacteria | 35593 |
| 85 | Ga0097621_100039947 | 3300006237 | Bacteria | 3770 |
| 86 | Ga0097621_100119348 | 3300006237 | Bacteria | 2235 |
| 87 | Ga0097621_100139089 | 3300006237 | Bacteria | 2074 |
| 88 | Ga0068871_100000078 | 3300006358 | Bacteria | 54385 |
| 89 | Ga0068871_100003644 | 3300006358 | Bacteria | 10581 |
| 90 | Ga0068871_100037335 | 3300006358 | Bacteria | 3874 |
| 91 | Ga0075428_100017123 | 3300006844 | Bacteria | 8006 |
| 92 | Ga0075428_100125996 | 3300006844 | Bacteria | 2787 |
| 93 | Ga0075430_100027876 | 3300006846 | Bacteria | 4797 |
| 94 | Ga0075431_100007656 | 3300006847 | Bacteria | 10754 |
| 95 | Ga0075429_100223437 | 3300006880 | Bacteria | 1649 |
| 96 | Ga0068865_100018464 | 3300006881 | Bacteria | 4500 |
| 97 | Ga0097620_100013424 | 3300006931 | Bacteria | 8214 |
| 98 | Ga0097620_100160339 | 3300006931 | Bacteria | 2328 |
| 99 | Ga0097620_100266859 | 3300006931 | Bacteria | 1804 |
| 100 | Ga0105240_10000054 | 3300009093 | Bacteria | 225529 |
| 101 | Ga0114129_10097906 | 3300009147 | Bacteria | 4061 |
| 102 | Ga0105241_10004091 | 3300009174 | Bacteria | 10780 |
| 103 | Ga0105241_10054449 | 3300009174 | Bacteria | 3062 |
| 104 | Ga0105241_10148315 | 3300009174 | Bacteria | 1916 |
| 105 | Ga0105242_10079815 | 3300009176 | Bacteria | 2733 |
| 106 | Ga0105248_10576845 | 3300009177 | Bacteria | 1269 |
| 107 | Ga0105237_10003018 | 3300009545 | Bacteria | 20308 |
| 108 | Ga0105237_10013778 | 3300009545 | Bacteria | 8467 |
| 109 | Ga0105237_10042546 | 3300009545 | Bacteria | 4580 |
| 110 | Ga0105238_10013713 | 3300009551 | Bacteria | 8188 |
| 111 | Ga0105249_10019958 | 3300009553 | Bacteria | 5984 |
| 112 | Ga0105249_10067183 | 3300009553 | Unclassified | 3302 |
| 113 | Ga0105249_10234165 | 3300009553 | Bacteria | 1812 |
| 114 | Ga0105239_10000533 | 3300010375 | Bacteria | 55092 |
| 115 | Ga0105239_10043867 | 3300010375 | Bacteria | 4904 |
| 116 | Ga0105239_10084527 | 3300010375 | Bacteria | 3495 |
| 117 | Ga0105246_10004465 | 3300011119 | Bacteria | 8510 |
| 118 | Ga0105246_10047860 | 3300011119 | Unclassified | 2922 |
| 119 | Ga0105246_10272872 | 3300011119 | Bacteria | 1353 |
| 120 | Ga0157373_10177931 | 3300013100 | Bacteria | 1498 |
| 121 | Ga0157370_10128454 | 3300013104 | Bacteria | 2365 |
| 122 | Ga0157369_10119806 | 3300013105 | Bacteria | 2793 |
| 123 | Ga0157374_10003134 | 3300013296 | Bacteria | 13893 |
| 124 | Ga0157374_10052924 | 3300013296 | Unclassified | 3783 |
| 125 | Ga0157374_10095296 | 3300013296 | Bacteria | 2846 |
| 126 | Ga0157378_10004812 | 3300013297 | Bacteria | 11831 |
| 127 | Ga0163162_10000241 | 3300013306 | Bacteria | 49773 |
| 128 | Ga0163162_10021543 | 3300013306 | Bacteria | 6349 |
| 129 | Ga0163162_10029288 | 3300013306 | Bacteria | 5448 |
| 130 | Ga0163162_10059729 | 3300013306 | Bacteria | 3845 |
| 131 | Ga0163162_10132769 | 3300013306 | Unclassified | 2599 |
| 132 | Ga0163162_10360024 | 3300013306 | Bacteria | 1588 |
| 133 | Ga0157372_10000739 | 3300013307 | Bacteria | 35631 |
| 134 | Ga0157372_10006065 | 3300013307 | Bacteria | 12840 |
| 135 | Ga0157372_10220840 | 3300013307 | Unclassified | 2197 |
| 136 | Ga0157372_10249460 | 3300013307 | Bacteria | 2060 |
| 137 | Ga0157372_10336088 | 3300013307 | Bacteria | 1759 |
| 138 | Ga0157375_10020249 | 3300013308 | Bacteria | 6073 |
| 139 | Ga0157375_10032325 | 3300013308 | Bacteria | 4961 |
| 140 | Ga0157375_10053050 | 3300013308 | Bacteria | 3988 |
| 141 | Ga0157375_10069973 | 3300013308 | Bacteria | 3517 |
| 142 | Ga0157375_10485054 | 3300013308 | Bacteria | 1401 |
| 143 | Ga0163163_10005697 | 3300014325 | Bacteria | 10804 |
| 144 | Ga0163163_10009922 | 3300014325 | Bacteria | 8539 |
| 145 | Ga0163163_10055751 | 3300014325 | Bacteria | 3906 |
| 146 | Ga0157380_10045770 | 3300014326 | Bacteria | 3435 |
| 147 | Ga0157377_10009363 | 3300014745 | Bacteria | 4801 |
| 148 | Ga0157377_10106907 | 3300014745 | Bacteria | 1676 |
| 149 | Ga0157379_10105511 | 3300014968 | Bacteria | 2529 |
| 150 | Ga0157379_10148241 | 3300014968 | Bacteria | 2116 |
| 151 | Ga0157376_10005100 | 3300014969 | Bacteria | 9153 |
| 152 | Ga0157376_10043719 | 3300014969 | Unclassified | 3677 |
| 153 | Ga0163161_10009771 | 3300017792 | Bacteria | 6649 |
| 154 | Ga0163161_10045425 | 3300017792 | Bacteria | 3168 |
| 155 | Ga0163161_10046267 | 3300017792 | Bacteria | 3139 |
| 156 | Ga0207642_10006007 | 3300025899 | Bacteria | 4008 |
| 157 | Ga0207688_10053612 | 3300025901 | Bacteria | 2262 |
| 158 | Ga0207688_10225527 | 3300025901 | Unclassified | 1130 |
| 159 | Ga0207647_10000208 | 3300025904 | Bacteria | 47976 |
| 160 | Ga0207647_10011128 | 3300025904 | Bacteria | 6321 |
| 161 | Ga0207647_10021694 | 3300025904 | Bacteria | 4282 |
| 162 | Ga0207647_10109905 | 3300025904 | Bacteria | 1630 |
| 163 | Ga0207645_10000619 | 3300025907 | Bacteria | 29435 |
| 164 | Ga0207645_10025856 | 3300025907 | Bacteria | 3796 |
| 165 | Ga0207654_10001107 | 3300025911 | Bacteria | 14574 |
| 166 | Ga0207654_10056761 | 3300025911 | Bacteria | 2272 |
| 167 | Ga0207695_10000043 | 3300025913 | Bacteria | 444585 |
| 168 | Ga0207695_10000128 | 3300025913 | Bacteria | 226098 |
| 169 | Ga0207695_10000546 | 3300025913 | Bacteria | 78237 |
| 170 | Ga0207695_10000673 | 3300025913 | Bacteria | 67322 |
| 171 | Ga0207695_10052936 | 3300025913 | Bacteria | 4249 |
| 172 | Ga0207695_10076068 | 3300025913 | Bacteria | 3414 |
| 173 | Ga0207671_10004529 | 3300025914 | Bacteria | 13206 |
| 174 | Ga0207671_10007678 | 3300025914 | Bacteria | 9313 |
| 175 | Ga0207671_10009248 | 3300025914 | Bacteria | 8256 |
| 176 | Ga0207671_10016465 | 3300025914 | Bacteria | 5744 |
| 177 | Ga0207649_10067783 | 3300025920 | Bacteria | 2267 |
| 178 | Ga0207681_10012646 | 3300025923 | Bacteria | 5211 |
| 179 | Ga0207650_10005431 | 3300025925 | Bacteria | 8700 |
| 180 | Ga0207650_10044024 | 3300025925 | Bacteria | 3279 |
| 181 | Ga0207659_10126803 | 3300025926 | Bacteria | 1964 |
| 182 | Ga0207659_10273241 | 3300025926 | Bacteria | 1379 |
| 183 | Ga0207644_10003775 | 3300025931 | Bacteria | 9813 |
| 184 | Ga0207644_10211071 | 3300025931 | Bacteria | 1535 |
| 185 | Ga0207706_10043006 | 3300025933 | Bacteria | 4004 |
| 186 | Ga0207706_10055864 | 3300025933 | Bacteria | 3481 |
| 187 | Ga0207686_10235349 | 3300025934 | Bacteria | 1330 |
| 188 | Ga0207670_10005390 | 3300025936 | Bacteria | 7018 |
| 189 | Ga0207670_10149029 | 3300025936 | Bacteria | 1734 |
| 190 | Ga0207669_10008389 | 3300025937 | Bacteria | 4848 |
| 191 | Ga0207669_10063215 | 3300025937 | Bacteria | 2284 |
| 192 | Ga0207704_10007516 | 3300025938 | Bacteria | 5154 |
| 193 | Ga0207691_10014698 | 3300025940 | Bacteria | 7462 |
| 194 | Ga0207691_10164663 | 3300025940 | Bacteria | 1944 |
| 195 | Ga0207711_10131569 | 3300025941 | Bacteria | 2244 |
| 196 | Ga0207689_10024708 | 3300025942 | Bacteria | 5037 |
| 197 | Ga0207689_10028570 | 3300025942 | Unclassified | 4664 |
| 198 | Ga0207689_10035170 | 3300025942 | Bacteria | 4162 |
| 199 | Ga0207689_10037201 | 3300025942 | Bacteria | 4038 |
| 200 | Ga0207689_10046289 | 3300025942 | Bacteria | 3595 |
| 201 | Ga0207689_10058028 | 3300025942 | Bacteria | 3183 |
| 202 | Ga0207661_10031430 | 3300025944 | Bacteria | 4101 |
| 203 | Ga0207661_10078768 | 3300025944 | Unclassified | 2714 |
| 204 | Ga0207667_10000351 | 3300025949 | Bacteria | 62752 |
| 205 | Ga0207667_10025930 | 3300025949 | Bacteria | 6411 |
| 206 | Ga0207651_10047924 | 3300025960 | Unclassified | 2885 |
| 207 | Ga0207651_10242009 | 3300025960 | Unclassified | 1471 |
| 208 | Ga0207712_10033129 | 3300025961 | Bacteria | 3491 |
| 209 | Ga0207712_10085700 | 3300025961 | Bacteria | 2306 |
| 210 | Ga0207668_10096967 | 3300025972 | Bacteria | 2181 |
| 211 | Ga0207640_10046751 | 3300025981 | Bacteria | 2787 |
| 212 | Ga0207658_10023483 | 3300025986 | Bacteria | 4305 |
| 213 | Ga0207658_10068844 | 3300025986 | Bacteria | 2672 |
| 214 | Ga0207677_10002112 | 3300026023 | Bacteria | 10435 |
| 215 | Ga0207677_10019574 | 3300026023 | Bacteria | 4092 |
| 216 | Ga0207703_10316752 | 3300026035 | Bacteria | 1427 |
| 217 | Ga0207639_10098760 | 3300026041 | Bacteria | 2354 |
| 218 | Ga0207702_10247716 | 3300026078 | Bacteria | 1672 |
| 219 | Ga0207641_10016242 | 3300026088 | Bacteria | 6097 |
| 220 | Ga0207641_10253592 | 3300026088 | Unclassified | 1644 |
| 221 | Ga0207648_10001518 | 3300026089 | Bacteria | 25557 |
| 222 | Ga0207648_10007762 | 3300026089 | Bacteria | 10479 |
| 223 | Ga0207648_10026397 | 3300026089 | Bacteria | 5161 |
| 224 | Ga0207648_10038179 | 3300026089 | Bacteria | 4227 |
| 225 | Ga0207648_10112110 | 3300026089 | Bacteria | 2395 |
| 226 | Ga0207648_10389481 | 3300026089 | Bacteria | 1261 |
| 227 | Ga0207676_10354862 | 3300026095 | Bacteria | 1357 |
| 228 | Ga0207674_10001234 | 3300026116 | Bacteria | 33386 |
| 229 | Ga0207674_10012295 | 3300026116 | Bacteria | 9571 |
| 230 | Ga0207675_100042605 | 3300026118 | Bacteria | 4238 |
| 231 | Ga0207675_100059745 | 3300026118 | Bacteria | 3558 |
| 232 | Ga0207683_10018030 | 3300026121 | Bacteria | 6020 |
| 233 | Ga0207683_10027013 | 3300026121 | Bacteria | 4961 |
| 234 | Ga0207683_10063029 | 3300026121 | Bacteria | 3266 |
| 235 | Ga0207683_10109438 | 3300026121 | Bacteria | 2473 |
| 236 | Ga0207698_10007814 | 3300026142 | Bacteria | 6725 |
| 237 | Ga0207698_10053919 | 3300026142 | Bacteria | 3090 |
| 238 | Ga0207698_10144658 | 3300026142 | Unclassified | 2054 |
| 239 | Ga0207698_10236245 | 3300026142 | Bacteria | 1663 |
| 240 | Ga0268266_10360155 | 3300028379 | Bacteria | 1368 |
| 241 | Ga0268265_10084674 | 3300028380 | Bacteria | 2514 |
| 242 | Ga0268264_10027079 | 3300028381 | Bacteria | 4683 |
| 243 | Ga0268264_10148951 | 3300028381 | Bacteria | 2096 |
| 244 | Ga0268264_10353376 | 3300028381 | Unclassified | 1400 |
| 245 | Ga0307508_10002269 | 3300031616 | Bacteria | 20511 |
| 246 | Ga0373957_0059412 | 3300035120 | Bacteria | 1479 |
| 247 | Ga0373933_0025695 | 3300035724 | Bacteria | 3379 |
| 248 | Ga0373937_0089216 | 3300036401 | Bacteria | 2855 |
| 249 | Ga0373937_0164033 | 3300036401 | Bacteria | 2083 |
| 250 | Ga0466957_0000543 | 3300044842 | Bacteria | 19067 |
| 251 | Ga0495580_0155950 | 3300046472 | Bacteria | 1581 |
| 252 | Ga0495582_0055410 | 3300046473 | Bacteria | 2186 |
| 253 | Ga0495664_0074186 | 3300046477 | Bacteria | 2035 |
| 254 | Ga0495628_0156897 | 3300046516 | Unclassified | 1731 |
| 255 | Ga0495630_0008093 | 3300046517 | Bacteria | 7557 |
| 256 | Ga0495587_0069172 | 3300046536 | Unclassified | 2056 |
| 257 | Ga0495645_0037831 | 3300046543 | Bacteria | 3518 |
| 258 | Ga0495633_0164848 | 3300046558 | Bacteria | 1022 |
| 259 | Ga0495670_0033602 | 3300046691 | Bacteria | 2552 |
| 260 | Ga0495672_0032785 | 3300047320 | Bacteria | 3226 |
| 261 | Ga0495684_0042657 | 3300047471 | Unclassified | 3474 |
| 262 | Ga0501292_001626 | 3300049515 | Bacteria | 2794 |
| 263 | Ga0501298_000838 | 3300049521 | Bacteria | 4337 |
| 264 | Ga0501299_001596 | 3300049522 | Bacteria | 2966 |
| 265 | Ga0501034_0000410 | 3300049571 | Bacteria | 72148 |
| 266 | Ga0501198_008335 | 3300049649 | Bacteria | 1503 |
| 267 | Ga0501202_001268 | 3300049652 | Bacteria | 3990 |
| 268 | Ga0501207_000267 | 3300049654 | Bacteria | 5422 |
| 269 | Ga0501217_000029 | 3300049661 | Bacteria | 15673 |
| 270 | Ga0501223_003533 | 3300049663 | Bacteria | 3388 |
| 271 | Ga0501224_001017 | 3300049664 | Bacteria | 3637 |
| 272 | Ga0501233_001210 | 3300049668 | Bacteria | 4395 |
| 273 | Ga0501236_006808 | 3300049670 | Bacteria | 1413 |
| 274 | Ga0501243_000550 | 3300049675 | Bacteria | 5032 |
| 275 | Ga0501252_000110 | 3300049682 | Bacteria | 4716 |
| 276 | Ga0501253_002158 | 3300049683 | Bacteria | 2170 |
| 277 | Ga0501259_000683 | 3300049688 | Bacteria | 5457 |
| 278 | Ga0501261_001062 | 3300049690 | Bacteria | 3363 |
| 279 | Ga0501221_002165 | 3300049704 | Bacteria | 3260 |
| 280 | Ga0501225_0000741 | 3300049705 | Bacteria | 10213 |
| 281 | Ga0501225_0001972 | 3300049705 | Bacteria | 6409 |
| 282 | Ga0501234_003744 | 3300049707 | Bacteria | 2390 |
| 283 | Ga0501234_010584 | 3300049707 | Bacteria | 1439 |
| 284 | Ga0501245_000551 | 3300049708 | Bacteria | 4567 |
| 285 | Ga0501241_012837 | 3300049758 | Bacteria | 1523 |
| 286 | Ga0501268_013809 | 3300049765 | Bacteria | 1308 |
| 287 | Ga0501271_004175 | 3300049768 | Bacteria | 1360 |
| 288 | Ga0501044_0216777 | 3300049823 | Bacteria | 1866 |
| 289 | Ga0501212_003411 | 3300049851 | Bacteria | 1993 |
| 290 | nmdc:mga0k408_152953_c1 | 3300050493 | Bacteria | 1374 |
| 291 | nmdc:mga0qj67_34230_c1 | 3300050509 | Bacteria | 3968 |
| 292 | nmdc:mga06r32_16055_c1 | 3300050510 | Bacteria | 6817 |
| 293 | nmdc:mga06r32_394954_c1 | 3300050510 | Unclassified | 1365 |
| 294 | nmdc:mga08y16_558965_c1 | 3300050511 | Bacteria | 1157 |
| 295 | Ga0500646_0017980 | 3300053090 | Bacteria | 1859 |
| 296 | Ga0500583_0000044 | 3300053092 | Bacteria | 81138 |
| 297 | Ga0500583_0000246 | 3300053092 | Bacteria | 19362 |
| 298 | Ga0500650_0063155 | 3300053098 | Bacteria | 1730 |
| 299 | Ga0500568_0000555 | 3300053139 | Bacteria | 27491 |
| 300 | Ga0500611_019274 | 3300053727 | Unclassified | 1271 |
| 301 | Ga0466962_0007346 | 3300061719 | Bacteria | 5288 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005614 | Ga0068856_100023985 | Ga0068856_1000239855 | 292 |
| 2 | 3300003323 | rootH1_10022472 | rootH1_100224724 | 323 |
| 3 | 3300026078 | Ga0207702_10247716 | Ga0207702_102477161 | 323 |
| 4 | 3300005539 | Ga0068853_100130738 | Ga0068853_1001307382 | 324 |
| 5 | 3300005577 | Ga0068857_100000945 | Ga0068857_10000094511 | 324 |
| 6 | 3300005616 | Ga0068852_100007004 | Ga0068852_1000070048 | 324 |
| 7 | 3300009174 | Ga0105241_10148315 | Ga0105241_101483153 | 324 |
| 8 | 3300013100 | Ga0157373_10177931 | Ga0157373_101779313 | 324 |
| 9 | 3300013307 | Ga0157372_10000739 | Ga0157372_100007398 | 324 |
| 10 | 3300025904 | Ga0207647_10011128 | Ga0207647_100111288 | 324 |
| 11 | 3300025911 | Ga0207654_10056761 | Ga0207654_100567613 | 324 |
| 12 | 3300025913 | Ga0207695_10052936 | Ga0207695_100529367 | 324 |
| 13 | 3300025949 | Ga0207667_10000351 | Ga0207667_1000035132 | 324 |
| 14 | 3300025981 | Ga0207640_10046751 | Ga0207640_100467512 | 324 |
| 15 | 3300026041 | Ga0207639_10098760 | Ga0207639_100987603 | 324 |
| 16 | 3300026116 | Ga0207674_10001234 | Ga0207674_100012346 | 324 |
| 17 | 3300026142 | Ga0207698_10007814 | Ga0207698_100078148 | 324 |
| 18 | 3300010375 | Ga0105239_10043867 | Ga0105239_100438675 | 325 |
| 19 | 3300046558 | Ga0495633_0164848 | Ga0495633_0164848_25_1005 | 325 |
| 20 | 3300005344 | Ga0070661_100112599 | Ga0070661_1001125993 | 326 |
| 21 | 3300025920 | Ga0207649_10067783 | Ga0207649_100677833 | 326 |
| 22 | 3300009553 | Ga0105249_10067183 | Ga0105249_100671832 | 330 |
| 23 | 3300011119 | Ga0105246_10272872 | Ga0105246_102728721 | 330 |
| 24 | 3300025907 | Ga0207645_10025856 | Ga0207645_100258563 | 331 |
| 25 | iso_pu_bacteria | 2911138879 | 2911141902 | 334 |
| 26 | 3300014968 | Ga0157379_10148241 | Ga0157379_101482412 | 336 |
| 27 | 3300005328 | Ga0070676_10119447 | Ga0070676_101194471 | 337 |
| 28 | 3300005330 | Ga0070690_100141270 | Ga0070690_1001412701 | 337 |
| 29 | 3300005334 | Ga0068869_100012073 | Ga0068869_1000120734 | 337 |
| 30 | 3300005335 | Ga0070666_10073776 | Ga0070666_100737762 | 337 |
| 31 | 3300005338 | Ga0068868_100005347 | Ga0068868_1000053475 | 337 |
| 32 | 3300005354 | Ga0070675_100176140 | Ga0070675_1001761402 | 337 |
| 33 | 3300005355 | Ga0070671_100064959 | Ga0070671_1000649591 | 337 |
| 34 | 3300005367 | Ga0070667_100060795 | Ga0070667_1000607955 | 337 |
| 35 | 3300005456 | Ga0070678_100110529 | Ga0070678_1001105294 | 337 |
| 36 | 3300005457 | Ga0070662_100052557 | Ga0070662_1000525572 | 337 |
| 37 | 3300005459 | Ga0068867_100017783 | Ga0068867_1000177832 | 337 |
| 38 | 3300005459 | Ga0068867_100108878 | Ga0068867_1001088781 | 337 |
| 39 | 3300005539 | Ga0068853_100108111 | Ga0068853_1001081112 | 337 |
| 40 | 3300005564 | Ga0070664_100125770 | Ga0070664_1001257703 | 337 |
| 41 | 3300005578 | Ga0068854_100095833 | Ga0068854_1000958333 | 337 |
| 42 | 3300005615 | Ga0070702_100032308 | Ga0070702_1000323085 | 337 |
| 43 | 3300005615 | Ga0070702_100191166 | Ga0070702_1001911662 | 337 |
| 44 | 3300005719 | Ga0068861_100186782 | Ga0068861_1001867823 | 337 |
| 45 | 3300006237 | Ga0097621_100119348 | Ga0097621_1001193483 | 337 |
| 46 | 3300009177 | Ga0105248_10576845 | Ga0105248_105768451 | 337 |
| 47 | 3300011119 | Ga0105246_10047860 | Ga0105246_100478603 | 337 |
| 48 | 3300013296 | Ga0157374_10003134 | Ga0157374_1000313413 | 337 |
| 49 | 3300013306 | Ga0163162_10029288 | Ga0163162_100292883 | 337 |
| 50 | 3300013306 | Ga0163162_10059729 | Ga0163162_100597292 | 337 |
| 51 | 3300013307 | Ga0157372_10249460 | Ga0157372_102494601 | 337 |
| 52 | 3300013308 | Ga0157375_10020249 | Ga0157375_100202492 | 337 |
| 53 | 3300014745 | Ga0157377_10106907 | Ga0157377_101069072 | 337 |
| 54 | 3300014968 | Ga0157379_10105511 | Ga0157379_101055113 | 337 |
| 55 | 3300017792 | Ga0163161_10009771 | Ga0163161_100097714 | 337 |
| 56 | 3300017792 | Ga0163161_10045425 | Ga0163161_100454253 | 337 |
| 57 | 3300025926 | Ga0207659_10126803 | Ga0207659_101268032 | 337 |
| 58 | 3300025933 | Ga0207706_10043006 | Ga0207706_100430062 | 337 |
| 59 | 3300025934 | Ga0207686_10235349 | Ga0207686_102353491 | 337 |
| 60 | 3300025942 | Ga0207689_10024708 | Ga0207689_100247082 | 337 |
| 61 | 3300025942 | Ga0207689_10035170 | Ga0207689_100351703 | 337 |
| 62 | 3300025960 | Ga0207651_10047924 | Ga0207651_100479242 | 337 |
| 63 | 3300025986 | Ga0207658_10068844 | Ga0207658_100688441 | 337 |
| 64 | 3300026023 | Ga0207677_10002112 | Ga0207677_100021125 | 337 |
| 65 | 3300026035 | Ga0207703_10316752 | Ga0207703_103167521 | 337 |
| 66 | 3300026089 | Ga0207648_10038179 | Ga0207648_100381792 | 337 |
| 67 | 3300026089 | Ga0207648_10112110 | Ga0207648_101121102 | 337 |
| 68 | 3300026121 | Ga0207683_10027013 | Ga0207683_100270133 | 337 |
| 69 | 3300053139 | Ga0500568_0000555 | Ga0500568_0000555_25953_27035 | 337 |
| 70 | 3300003322 | rootL2_10009364 | rootL2_100093642 | 338 |
| 71 | 3300003323 | rootH1_10001036 | rootH1_1000103623 | 338 |
| 72 | 3300005331 | Ga0070670_100084464 | Ga0070670_1000844641 | 338 |
| 73 | 3300005335 | Ga0070666_10003784 | Ga0070666_100037843 | 338 |
| 74 | 3300005338 | Ga0068868_100179410 | Ga0068868_1001794101 | 338 |
| 75 | 3300005353 | Ga0070669_100006436 | Ga0070669_1000064362 | 338 |
| 76 | 3300006237 | Ga0097621_100139089 | Ga0097621_1001390891 | 338 |
| 77 | 3300009553 | Ga0105249_10234165 | Ga0105249_102341652 | 338 |
| 78 | 3300013296 | Ga0157374_10095296 | Ga0157374_100952961 | 338 |
| 79 | 3300013306 | Ga0163162_10000241 | Ga0163162_1000024145 | 338 |
| 80 | 3300025899 | Ga0207642_10006007 | Ga0207642_100060076 | 338 |
| 81 | 3300025907 | Ga0207645_10000619 | Ga0207645_1000061925 | 338 |
| 82 | 3300025961 | Ga0207712_10085700 | Ga0207712_100857004 | 338 |
| 83 | 3300031616 | Ga0307508_10002269 | Ga0307508_1000226912 | 338 |
| 84 | 3300044842 | Ga0466957_0000543 | Ga0466957_0000543_9085_10101 | 338 |
| 85 | 3300013306 | Ga0163162_10021543 | Ga0163162_100215432 | 339 |
| 86 | 3300013306 | Ga0163162_10360024 | Ga0163162_103600242 | 339 |
| 87 | 3300013308 | Ga0157375_10485054 | Ga0157375_104850541 | 339 |
| 88 | 3300026089 | Ga0207648_10389481 | Ga0207648_103894811 | 339 |
| 89 | 3300049823 | Ga0501044_0216777 | Ga0501044_0216777_506_1525 | 339 |
| 90 | 3300005329 | Ga0070683_100005655 | Ga0070683_1000056551 | 340 |
| 91 | 3300005330 | Ga0070690_100095524 | Ga0070690_1000955242 | 340 |
| 92 | 3300005338 | Ga0068868_100362989 | Ga0068868_1003629891 | 340 |
| 93 | 3300005344 | Ga0070661_100071690 | Ga0070661_1000716901 | 340 |
| 94 | 3300005355 | Ga0070671_100005053 | Ga0070671_10000505310 | 340 |
| 95 | 3300005456 | Ga0070678_100027979 | Ga0070678_1000279793 | 340 |
| 96 | 3300005459 | Ga0068867_100016567 | Ga0068867_1000165673 | 340 |
| 97 | 3300005466 | Ga0070685_10012675 | Ga0070685_100126752 | 340 |
| 98 | 3300005535 | Ga0070684_100029718 | Ga0070684_1000297184 | 340 |
| 99 | 3300005564 | Ga0070664_100039993 | Ga0070664_1000399932 | 340 |
| 100 | 3300005617 | Ga0068859_100013424 | Ga0068859_1000134244 | 340 |
| 101 | 3300005618 | Ga0068864_100026400 | Ga0068864_1000264001 | 340 |
| 102 | 3300005841 | Ga0068863_100013765 | Ga0068863_1000137659 | 340 |
| 103 | 3300006237 | Ga0097621_100000260 | Ga0097621_10000026020 | 340 |
| 104 | 3300006358 | Ga0068871_100000078 | Ga0068871_10000007834 | 340 |
| 105 | 3300006931 | Ga0097620_100013424 | Ga0097620_1000134244 | 340 |
| 106 | 3300009545 | Ga0105237_10013778 | Ga0105237_100137786 | 340 |
| 107 | 3300010375 | Ga0105239_10000533 | Ga0105239_100005336 | 340 |
| 108 | 3300013307 | Ga0157372_10006065 | Ga0157372_100060656 | 340 |
| 109 | 3300013308 | Ga0157375_10053050 | Ga0157375_100530504 | 340 |
| 110 | 3300014325 | Ga0163163_10055751 | Ga0163163_100557513 | 340 |
| 111 | 3300014745 | Ga0157377_10009363 | Ga0157377_100093632 | 340 |
| 112 | 3300017792 | Ga0163161_10046267 | Ga0163161_100462672 | 340 |
| 113 | 3300025901 | Ga0207688_10225527 | Ga0207688_102255271 | 340 |
| 114 | 3300025904 | Ga0207647_10021694 | Ga0207647_100216942 | 340 |
| 115 | 3300025913 | Ga0207695_10076068 | Ga0207695_100760682 | 340 |
| 116 | 3300025914 | Ga0207671_10009248 | Ga0207671_100092486 | 340 |
| 117 | 3300025925 | Ga0207650_10044024 | Ga0207650_100440242 | 340 |
| 118 | 3300025931 | Ga0207644_10003775 | Ga0207644_100037759 | 340 |
| 119 | 3300025933 | Ga0207706_10055864 | Ga0207706_100558643 | 340 |
| 120 | 3300025936 | Ga0207670_10005390 | Ga0207670_100053902 | 340 |
| 121 | 3300025941 | Ga0207711_10131569 | Ga0207711_101315691 | 340 |
| 122 | 3300025942 | Ga0207689_10058028 | Ga0207689_100580282 | 340 |
| 123 | 3300025944 | Ga0207661_10031430 | Ga0207661_100314302 | 340 |
| 124 | 3300025986 | Ga0207658_10023483 | Ga0207658_100234835 | 340 |
| 125 | 3300026088 | Ga0207641_10016242 | Ga0207641_100162423 | 340 |
| 126 | 3300026116 | Ga0207674_10012295 | Ga0207674_100122958 | 340 |
| 127 | 3300026121 | Ga0207683_10109438 | Ga0207683_101094382 | 340 |
| 128 | 3300026142 | Ga0207698_10144658 | Ga0207698_101446582 | 340 |
| 129 | 3300046691 | Ga0495670_0033602 | Ga0495670_0033602_304_1329 | 340 |
| 130 | 3300061719 | Ga0466962_0007346 | Ga0466962_0007346_4043_5065 | 340 |
| 131 | 3300005328 | Ga0070676_10014069 | Ga0070676_100140691 | 341 |
| 132 | 3300005333 | Ga0070677_10002782 | Ga0070677_100027827 | 341 |
| 133 | 3300005334 | Ga0068869_100056008 | Ga0068869_1000560084 | 341 |
| 134 | 3300005364 | Ga0070673_100065868 | Ga0070673_1000658682 | 341 |
| 135 | 3300005367 | Ga0070667_100009708 | Ga0070667_1000097084 | 341 |
| 136 | 3300005456 | Ga0070678_100048244 | Ga0070678_1000482441 | 341 |
| 137 | 3300005539 | Ga0068853_100220261 | Ga0068853_1002202611 | 341 |
| 138 | 3300005543 | Ga0070672_100042689 | Ga0070672_1000426894 | 341 |
| 139 | 3300005548 | Ga0070665_100006860 | Ga0070665_10000686014 | 341 |
| 140 | 3300005616 | Ga0068852_100227690 | Ga0068852_1002276901 | 341 |
| 141 | 3300005617 | Ga0068859_100266860 | Ga0068859_1002668602 | 341 |
| 142 | 3300005843 | Ga0068860_100032031 | Ga0068860_1000320314 | 341 |
| 143 | 3300005844 | Ga0068862_100049546 | Ga0068862_1000495463 | 341 |
| 144 | 3300006358 | Ga0068871_100003644 | Ga0068871_10000364413 | 341 |
| 145 | 3300006881 | Ga0068865_100018464 | Ga0068865_1000184641 | 341 |
| 146 | 3300006931 | Ga0097620_100266859 | Ga0097620_1002668592 | 341 |
| 147 | 3300009174 | Ga0105241_10054449 | Ga0105241_100544492 | 341 |
| 148 | 3300009545 | Ga0105237_10003018 | Ga0105237_1000301811 | 341 |
| 149 | 3300011119 | Ga0105246_10004465 | Ga0105246_100044656 | 341 |
| 150 | 3300013308 | Ga0157375_10069973 | Ga0157375_100699735 | 341 |
| 151 | 3300025901 | Ga0207688_10053612 | Ga0207688_100536123 | 341 |
| 152 | 3300025914 | Ga0207671_10007678 | Ga0207671_100076783 | 341 |
| 153 | 3300025938 | Ga0207704_10007516 | Ga0207704_100075165 | 341 |
| 154 | 3300025940 | Ga0207691_10014698 | Ga0207691_100146986 | 341 |
| 155 | 3300025942 | Ga0207689_10037201 | Ga0207689_100372013 | 341 |
| 156 | 3300026023 | Ga0207677_10019574 | Ga0207677_100195744 | 341 |
| 157 | 3300026089 | Ga0207648_10007762 | Ga0207648_100077624 | 341 |
| 158 | 3300026121 | Ga0207683_10018030 | Ga0207683_100180302 | 341 |
| 159 | 3300026142 | Ga0207698_10236245 | Ga0207698_102362451 | 341 |
| 160 | 3300028379 | Ga0268266_10360155 | Ga0268266_103601551 | 341 |
| 161 | 3300028381 | Ga0268264_10027079 | Ga0268264_100270794 | 341 |
| 162 | 3300003320 | rootH2_10024039 | rootH2_1002403923 | 342 |
| 163 | 3300006195 | Ga0075366_10142809 | Ga0075366_101428091 | 342 |
| 164 | 3300006847 | Ga0075431_100007656 | Ga0075431_10000765612 | 342 |
| 165 | 3300025937 | Ga0207669_10063215 | Ga0207669_100632153 | 342 |
| 166 | 3300035724 | Ga0373933_0025695 | Ga0373933_0025695_1928_2956 | 342 |
| 167 | 3300036401 | Ga0373937_0164033 | Ga0373937_0164033_847_1875 | 342 |
| 168 | 3300046516 | Ga0495628_0156897 | Ga0495628_0156897_21_1049 | 342 |
| 169 | 3300046517 | Ga0495630_0008093 | Ga0495630_0008093_4642_5670 | 342 |
| 170 | 3300047471 | Ga0495684_0042657 | Ga0495684_0042657_2379_3407 | 342 |
| 171 | 3300050493 | nmdc:mga0k408_152953_c1 | nmdc:mga0k408_152953_c1_32_1060 | 342 |
| 172 | 3300050511 | nmdc:mga08y16_558965_c1 | nmdc:mga08y16_558965_c1_110_1141 | 342 |
| 173 | 3300005718 | Ga0068866_10011577 | Ga0068866_100115773 | 343 |
| 174 | 3300006237 | Ga0097621_100039947 | Ga0097621_1000399475 | 343 |
| 175 | 3300006358 | Ga0068871_100037335 | Ga0068871_1000373352 | 343 |
| 176 | 3300025942 | Ga0207689_10028570 | Ga0207689_100285705 | 343 |
| 177 | 3300026089 | Ga0207648_10001518 | Ga0207648_1000151822 | 343 |
| 178 | 3300036401 | Ga0373937_0089216 | Ga0373937_0089216_423_1457 | 343 |
| 179 | 3300005356 | Ga0070674_100041867 | Ga0070674_1000418674 | 344 |
| 180 | 3300005544 | Ga0070686_100036032 | Ga0070686_1000360322 | 344 |
| 181 | 3300013297 | Ga0157378_10004812 | Ga0157378_100048126 | 344 |
| 182 | 3300025937 | Ga0207669_10008389 | Ga0207669_100083893 | 344 |
| 183 | 3300025960 | Ga0207651_10242009 | Ga0207651_102420091 | 344 |
| 184 | 3300026089 | Ga0207648_10026397 | Ga0207648_100263973 | 344 |
| 185 | 3300026121 | Ga0207683_10063029 | Ga0207683_100630293 | 344 |
| 186 | 3300005295 | Ga0065707_10009281 | Ga0065707_100092811 | 346 |
| 187 | 3300005334 | Ga0068869_100072933 | Ga0068869_1000729332 | 346 |
| 188 | 3300013306 | Ga0163162_10132769 | Ga0163162_101327692 | 346 |
| 189 | 3300013307 | Ga0157372_10336088 | Ga0157372_103360882 | 346 |
| 190 | 3300025904 | Ga0207647_10109905 | Ga0207647_101099052 | 347 |
| 191 | 3300025949 | Ga0207667_10025930 | Ga0207667_100259309 | 347 |
| 192 | 3300005616 | Ga0068852_100262069 | Ga0068852_1002620691 | 348 |
| 193 | 3300005841 | Ga0068863_100274968 | Ga0068863_1002749682 | 348 |
| 194 | 3300014969 | Ga0157376_10005100 | Ga0157376_100051004 | 348 |
| 195 | 3300026088 | Ga0207641_10253592 | Ga0207641_102535921 | 348 |
| 196 | 3300005617 | Ga0068859_100160341 | Ga0068859_1001603413 | 349 |
| 197 | 3300006931 | Ga0097620_100160339 | Ga0097620_1001603393 | 349 |
| 198 | 3300010375 | Ga0105239_10084527 | Ga0105239_100845273 | 349 |
| 199 | 3300013296 | Ga0157374_10052924 | Ga0157374_100529243 | 349 |
| 200 | 3300035120 | Ga0373957_0059412 | Ga0373957_0059412_213_1262 | 349 |
| 201 | 3300046472 | Ga0495580_0155950 | Ga0495580_0155950_394_1443 | 349 |
| 202 | 3300046473 | Ga0495582_0055410 | Ga0495582_0055410_533_1582 | 349 |
| 203 | 3300046477 | Ga0495664_0074186 | Ga0495664_0074186_352_1401 | 349 |
| 204 | 3300046536 | Ga0495587_0069172 | Ga0495587_0069172_362_1411 | 349 |
| 205 | 3300046543 | Ga0495645_0037831 | Ga0495645_0037831_1103_2152 | 349 |
| 206 | 3300047320 | Ga0495672_0032785 | Ga0495672_0032785_1026_2075 | 349 |
| 207 | 3300049571 | Ga0501034_0000410 | Ga0501034_0000410_7901_8959 | 349 |
| 208 | 3300005535 | Ga0070684_100099272 | Ga0070684_1000992721 | 350 |
| 209 | 3300009176 | Ga0105242_10079815 | Ga0105242_100798153 | 350 |
| 210 | 3300013307 | Ga0157372_10220840 | Ga0157372_102208401 | 350 |
| 211 | 3300013308 | Ga0157375_10032325 | Ga0157375_100323253 | 350 |
| 212 | 3300025913 | Ga0207695_10000128 | Ga0207695_10000128178 | 350 |
| 213 | 3300025942 | Ga0207689_10046289 | Ga0207689_100462891 | 350 |
| 214 | 3300025944 | Ga0207661_10078768 | Ga0207661_100787682 | 350 |
| 215 | 3300025972 | Ga0207668_10096967 | Ga0207668_100969671 | 350 |
| 216 | 3300026118 | Ga0207675_100042605 | Ga0207675_1000426053 | 350 |
| 217 | 3300028380 | Ga0268265_10084674 | Ga0268265_100846742 | 350 |
| 218 | 3300028381 | Ga0268264_10353376 | Ga0268264_103533761 | 350 |
| 219 | 3300006844 | Ga0075428_100125996 | Ga0075428_1001259963 | 352 |
| 220 | 3300003322 | rootL2_10255980 | rootL2_102559803 | 353 |
| 221 | 3300005366 | Ga0070659_100046372 | Ga0070659_1000463724 | 353 |
| 222 | 3300005471 | Ga0070698_100002200 | Ga0070698_10000220016 | 353 |
| 223 | 3300005577 | Ga0068857_100162730 | Ga0068857_1001627301 | 353 |
| 224 | 3300005616 | Ga0068852_100006922 | Ga0068852_1000069222 | 353 |
| 225 | 3300013105 | Ga0157369_10119806 | Ga0157369_101198063 | 353 |
| 226 | 3300025904 | Ga0207647_10000208 | Ga0207647_1000020836 | 353 |
| 227 | 3300050510 | nmdc:mga06r32_394954_c1 | nmdc:mga06r32_394954_c1_229_1293 | 353 |
| 228 | 3300053090 | Ga0500646_0017980 | Ga0500646_0017980_358_1452 | 353 |
| 229 | 3300053098 | Ga0500650_0063155 | Ga0500650_0063155_319_1413 | 353 |
| 230 | 3300005618 | Ga0068864_100204248 | Ga0068864_1002042483 | 355 |
| 231 | 3300009174 | Ga0105241_10004091 | Ga0105241_100040918 | 355 |
| 232 | 3300009551 | Ga0105238_10013713 | Ga0105238_100137133 | 355 |
| 233 | 3300009553 | Ga0105249_10019958 | Ga0105249_100199581 | 355 |
| 234 | 3300014325 | Ga0163163_10005697 | Ga0163163_100056977 | 355 |
| 235 | 3300025911 | Ga0207654_10001107 | Ga0207654_100011079 | 355 |
| 236 | 3300025913 | Ga0207695_10000673 | Ga0207695_1000067315 | 355 |
| 237 | 3300025914 | Ga0207671_10004529 | Ga0207671_100045294 | 355 |
| 238 | 3300025961 | Ga0207712_10033129 | Ga0207712_100331294 | 355 |
| 239 | 3300026095 | Ga0207676_10354862 | Ga0207676_103548621 | 355 |
| 240 | 3300028381 | Ga0268264_10148951 | Ga0268264_101489511 | 355 |
| 241 | 3300005547 | Ga0070693_100072702 | Ga0070693_1000727022 | 356 |
| 242 | 3300049683 | Ga0501253_002158 | Ga0501253_002158_496_1587 | 357 |
| 243 | iso_pu_bacteria | 2738541278 | 2738728050 | 358 |
| 244 | 3300009093 | Ga0105240_10000054 | Ga0105240_1000005481 | 359 |
| 245 | 3300009545 | Ga0105237_10042546 | Ga0105237_100425462 | 359 |
| 246 | 3300013104 | Ga0157370_10128454 | Ga0157370_101284543 | 359 |
| 247 | 3300025913 | Ga0207695_10000043 | Ga0207695_10000043218 | 359 |
| 248 | 3300025913 | Ga0207695_10000546 | Ga0207695_1000054636 | 359 |
| 249 | 3300025914 | Ga0207671_10016465 | Ga0207671_100164655 | 359 |
| 250 | 3300005340 | Ga0070689_100120673 | Ga0070689_1001206731 | 360 |
| 251 | 3300005353 | Ga0070669_100047747 | Ga0070669_1000477475 | 360 |
| 252 | 3300005364 | Ga0070673_100340363 | Ga0070673_1003403631 | 360 |
| 253 | 3300005719 | Ga0068861_100060276 | Ga0068861_1000602762 | 360 |
| 254 | 3300006844 | Ga0075428_100017123 | Ga0075428_1000171235 | 360 |
| 255 | 3300006846 | Ga0075430_100027876 | Ga0075430_1000278761 | 360 |
| 256 | 3300006880 | Ga0075429_100223437 | Ga0075429_1002234372 | 360 |
| 257 | 3300009147 | Ga0114129_10097906 | Ga0114129_100979064 | 360 |
| 258 | 3300025923 | Ga0207681_10012646 | Ga0207681_100126463 | 360 |
| 259 | 3300025936 | Ga0207670_10149029 | Ga0207670_101490291 | 360 |
| 260 | 3300026118 | Ga0207675_100059745 | Ga0207675_1000597453 | 360 |
| 261 | 3300050509 | nmdc:mga0qj67_34230_c1 | nmdc:mga0qj67_34230_c1_1586_2671 | 360 |
| 262 | 3300050510 | nmdc:mga06r32_16055_c1 | nmdc:mga06r32_16055_c1_2330_3415 | 360 |
| 263 | 3300005331 | Ga0070670_100007852 | Ga0070670_10000785213 | 362 |
| 264 | 3300005564 | Ga0070664_100112002 | Ga0070664_1001120021 | 362 |
| 265 | 3300005834 | Ga0068851_10037634 | Ga0068851_100376342 | 362 |
| 266 | 3300014325 | Ga0163163_10009922 | Ga0163163_1000992210 | 362 |
| 267 | 3300014326 | Ga0157380_10045770 | Ga0157380_100457703 | 362 |
| 268 | 3300025925 | Ga0207650_10005431 | Ga0207650_1000543112 | 362 |
| 269 | 3300025926 | Ga0207659_10273241 | Ga0207659_102732411 | 362 |
| 270 | 3300025931 | Ga0207644_10211071 | Ga0207644_102110711 | 362 |
| 271 | 3300025940 | Ga0207691_10164663 | Ga0207691_101646631 | 362 |
| 272 | 3300026142 | Ga0207698_10053919 | Ga0207698_100539192 | 362 |
| 273 | 3300049515 | Ga0501292_001626 | Ga0501292_001626_927_2048 | 362 |
| 274 | 3300049521 | Ga0501298_000838 | Ga0501298_000838_138_1259 | 362 |
| 275 | 3300049522 | Ga0501299_001596 | Ga0501299_001596_1708_2829 | 362 |
| 276 | 3300049649 | Ga0501198_008335 | Ga0501198_008335_138_1259 | 362 |
| 277 | 3300049652 | Ga0501202_001268 | Ga0501202_001268_170_1291 | 362 |
| 278 | 3300049654 | Ga0501207_000267 | Ga0501207_000267_1887_3008 | 362 |
| 279 | 3300049661 | Ga0501217_000029 | Ga0501217_000029_7023_8144 | 362 |
| 280 | 3300049663 | Ga0501223_003533 | Ga0501223_003533_611_1732 | 362 |
| 281 | 3300049664 | Ga0501224_001017 | Ga0501224_001017_233_1354 | 362 |
| 282 | 3300049668 | Ga0501233_001210 | Ga0501233_001210_3099_4220 | 362 |
| 283 | 3300049670 | Ga0501236_006808 | Ga0501236_006808_139_1260 | 362 |
| 284 | 3300049675 | Ga0501243_000550 | Ga0501243_000550_1695_2816 | 362 |
| 285 | 3300049682 | Ga0501252_000110 | Ga0501252_000110_2455_3576 | 362 |
| 286 | 3300049688 | Ga0501259_000683 | Ga0501259_000683_2612_3733 | 362 |
| 287 | 3300049690 | Ga0501261_001062 | Ga0501261_001062_1993_3114 | 362 |
| 288 | 3300049704 | Ga0501221_002165 | Ga0501221_002165_2000_3121 | 362 |
| 289 | 3300049705 | Ga0501225_0000741 | Ga0501225_0000741_4587_5708 | 362 |
| 290 | 3300049705 | Ga0501225_0001972 | Ga0501225_0001972_3167_4261 | 362 |
| 291 | 3300049707 | Ga0501234_003744 | Ga0501234_003744_139_1260 | 362 |
| 292 | 3300049707 | Ga0501234_010584 | Ga0501234_010584_135_1298 | 362 |
| 293 | 3300049708 | Ga0501245_000551 | Ga0501245_000551_2047_3168 | 362 |
| 294 | 3300049758 | Ga0501241_012837 | Ga0501241_012837_78_1199 | 362 |
| 295 | 3300049765 | Ga0501268_013809 | Ga0501268_013809_163_1284 | 362 |
| 296 | 3300049768 | Ga0501271_004175 | Ga0501271_004175_130_1251 | 362 |
| 297 | 3300049851 | Ga0501212_003411 | Ga0501212_003411_691_1812 | 362 |
| 298 | 3300053092 | Ga0500583_0000044 | Ga0500583_0000044_34424_35518 | 362 |
| 299 | 3300053092 | Ga0500583_0000246 | Ga0500583_0000246_4602_5696 | 362 |
| 300 | 3300053727 | Ga0500611_019274 | Ga0500611_019274_61_1155 | 362 |
| 301 | 3300003316 | rootH1_10073230 | rootH1_100732302 | 365 |
| 302 | 3300005458 | Ga0070681_10010876 | Ga0070681_100108767 | 365 |
| 303 | 3300014969 | Ga0157376_10043719 | Ga0157376_100437192 | 365 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4zyo-assembly1.cif.gz_A | crystal structure of human integral membrane stearoyl-coa desaturase with substrate | 0.5704 | 12 | 334 |
| 4ymk-assembly2.cif.gz_D | crystal structure of stearoyl-coenzyme a desaturase 1 | 0.5601 | 51 | 345 |
| 4zyo-assembly1.cif.gz_A | crystal structure of human integral membrane stearoyl-coa desaturase with substrate | 0.558 | 12 | 334 |
| 4ymk-assembly2.cif.gz_D | crystal structure of stearoyl-coenzyme a desaturase 1 | 0.5157 | 51 | 345 |
| 7rs4-assembly2.cif.gz_C | crystal structure of the er-alpha ligand-binding domain (l372s, l536s) in complex with dmeri-8 | 0.2285 | 4 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9XTJ4_222_461_1.10.565.10 | Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor | 0.2792 | 83 | 251 | 1.10.565.10 |
| af_O02151_129_350_1.10.565.10 | Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor | 0.2778 | 81 | 253 | 1.10.565.10 |
| af_Q9XXB5_130_329_1.10.565.10 | Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor | 0.274 | 55 | 256 | 1.10.565.10 |
| af_Q58749_1_145_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.2695 | 175 | 257 | 1.20.1070.10 |
| af_Q19153_286_501_1.20.1640.10 | Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain | 0.2508 | 39 | 253 | 1.20.1640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C0ZDD1-F1-model_v4 | Fatty acid desaturase | 0.975 | 6 | 245 |
GO:0016020
|
| AF-A0A3C0ZDD1-F1-model_v4 | Fatty acid desaturase | 0.9594 | 6 | 245 |
GO:0016020
|
| AF-A0A519Y3N4-F1-model_v4 | Acyl-CoA desaturase | 0.9571 | 6 | 186 |
GO:0004768
GO:0005506 GO:0006636 GO:0016020 |
| AF-A0A519Y3N4-F1-model_v4 | Acyl-CoA desaturase | 0.9371 | 6 | 186 |
GO:0004768
GO:0005506 GO:0006636 GO:0016020 |
| AF-A0A3B9NLF3-F1-model_v4 | Fatty acid desaturase | 0.9199 | 6 | 337 |
GO:0006633
GO:0016020 GO:0016717 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar