F396851

General Info

Members Datasets Scaffolds Average Seq Length
303 176 301 347

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_100112599|Ga0070661_1001125993
Length 326
Sequence MIQGSFIDTLLYAPSYGWKDQSDRLIVPSSKQLWSEAFSRINIFRSRKNWISFVSFAAVVIYSMAVMGTHGTIWFHRYCTHKSYGFSHPIWRIVTQNIVIKTIPEEIYVVSHHVHHCKSDEPGDPYNSQAGFLYCMLAEYNHQRVSPYLEEDAYKKALHFMEHTGVKMNTYKQYRKWGSLSSPAYTIAVWMINWAFWFAVFFLIGGAALACAIFTAALLWFTFVRAFNYTGHGRGQKKHREGIDFDRSNLSINQARPGLLAGEWHNNHHLFPGSARAGFLPGQLDLAWVYIYTLRRLRMVSWYKDSKKEFLKKYVAAAPSSKRSTL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
134 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
139 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
140 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
141 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
142 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
143 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
146 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
147 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
148 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
149 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
150 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
151 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
152 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
153 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
154 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
155 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
156 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
157 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
158 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
159 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
160 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
161 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
162 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
163 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
164 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
167 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
172 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
173 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
174 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
175 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 0
Rhizosphere 94.72
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10073230 3300003316 Unclassified 1981
2 rootH2_10024039 3300003320 Bacteria 38953
3 rootL2_10009364 3300003322 Bacteria 1909
4 rootL2_10255980 3300003322 Bacteria 1589
5 rootH1_10001036 3300003323 Bacteria 30037
6 rootH1_10022472 3300003323 Bacteria 6084
7 Ga0065707_10009281 3300005295 Bacteria 2933
8 Ga0070676_10014069 3300005328 Bacteria 4391
9 Ga0070676_10119447 3300005328 Bacteria 1652
10 Ga0070683_100005655 3300005329 Bacteria 10442
11 Ga0070690_100095524 3300005330 Bacteria 1963
12 Ga0070690_100141270 3300005330 Bacteria 1635
13 Ga0070670_100007852 3300005331 Bacteria 9077
14 Ga0070670_100084464 3300005331 Bacteria 2727
15 Ga0070677_10002782 3300005333 Bacteria 5603
16 Ga0068869_100012073 3300005334 Bacteria 5694
17 Ga0068869_100056008 3300005334 Bacteria 2874
18 Ga0068869_100072933 3300005334 Bacteria 2545
19 Ga0070666_10003784 3300005335 Bacteria 9172
20 Ga0070666_10073776 3300005335 Bacteria 2324
21 Ga0068868_100005347 3300005338 Bacteria 9014
22 Ga0068868_100179410 3300005338 Bacteria 1756
23 Ga0068868_100362989 3300005338 Unclassified 1243
24 Ga0070689_100120673 3300005340 Bacteria 2093
25 Ga0070661_100071690 3300005344 Unclassified 2550
26 Ga0070661_100112599 3300005344 Bacteria 2033
27 Ga0070669_100006436 3300005353 Bacteria 8455
28 Ga0070669_100047747 3300005353 Bacteria 3123
29 Ga0070675_100176140 3300005354 Bacteria 1847
30 Ga0070671_100005053 3300005355 Bacteria 10519
31 Ga0070671_100064959 3300005355 Unclassified 3039
32 Ga0070674_100041867 3300005356 Bacteria 3108
33 Ga0070673_100065868 3300005364 Bacteria 2892
34 Ga0070673_100340363 3300005364 Bacteria 1329
35 Ga0070659_100046372 3300005366 Bacteria 3407
36 Ga0070667_100009708 3300005367 Bacteria 7977
37 Ga0070667_100060795 3300005367 Bacteria 3197
38 Ga0070678_100027979 3300005456 Bacteria 3837
39 Ga0070678_100048244 3300005456 Bacteria 3065
40 Ga0070678_100110529 3300005456 Bacteria 2149
41 Ga0070662_100052557 3300005457 Bacteria 2946
42 Ga0070681_10010876 3300005458 Bacteria 8995
43 Ga0068867_100016567 3300005459 Bacteria 5234
44 Ga0068867_100017783 3300005459 Bacteria 5047
45 Ga0068867_100108878 3300005459 Bacteria 2126
46 Ga0070685_10012675 3300005466 Bacteria 4434
47 Ga0070698_100002200 3300005471 Bacteria 21650
48 Ga0070684_100029718 3300005535 Bacteria 4634
49 Ga0070684_100099272 3300005535 Unclassified 2598
50 Ga0068853_100108111 3300005539 Bacteria 2467
51 Ga0068853_100130738 3300005539 Bacteria 2247
52 Ga0068853_100220261 3300005539 Bacteria 1733
53 Ga0070672_100042689 3300005543 Bacteria 3493
54 Ga0070686_100036032 3300005544 Bacteria 3060
55 Ga0070693_100072702 3300005547 Bacteria 2029
56 Ga0070665_100006860 3300005548 Bacteria 11579
57 Ga0070664_100039993 3300005564 Bacteria 3953
58 Ga0070664_100112002 3300005564 Bacteria 2383
59 Ga0070664_100125770 3300005564 Bacteria 2249
60 Ga0068857_100000945 3300005577 Bacteria 22138
61 Ga0068857_100162730 3300005577 Bacteria 2025
62 Ga0068854_100095833 3300005578 Bacteria 2216
63 Ga0068856_100023985 3300005614 Bacteria 5933
64 Ga0070702_100032308 3300005615 Bacteria 2871
65 Ga0070702_100191166 3300005615 Bacteria 1347
66 Ga0068852_100006922 3300005616 Bacteria 8246
67 Ga0068852_100007004 3300005616 Bacteria 8207
68 Ga0068852_100227690 3300005616 Bacteria 1776
69 Ga0068852_100262069 3300005616 Unclassified 1660
70 Ga0068859_100013424 3300005617 Bacteria 8214
71 Ga0068859_100160341 3300005617 Bacteria 2328
72 Ga0068859_100266860 3300005617 Bacteria 1804
73 Ga0068864_100026400 3300005618 Bacteria 4900
74 Ga0068864_100204248 3300005618 Bacteria 1816
75 Ga0068866_10011577 3300005718 Bacteria 3821
76 Ga0068861_100060276 3300005719 Bacteria 2908
77 Ga0068861_100186782 3300005719 Bacteria 1729
78 Ga0068851_10037634 3300005834 Bacteria 2426
79 Ga0068863_100013765 3300005841 Bacteria 7796
80 Ga0068863_100274968 3300005841 Unclassified 1631
81 Ga0068860_100032031 3300005843 Bacteria 5055
82 Ga0068862_100049546 3300005844 Bacteria 3588
83 Ga0075366_10142809 3300006195 Bacteria 1448
84 Ga0097621_100000260 3300006237 Bacteria 35593
85 Ga0097621_100039947 3300006237 Bacteria 3770
86 Ga0097621_100119348 3300006237 Bacteria 2235
87 Ga0097621_100139089 3300006237 Bacteria 2074
88 Ga0068871_100000078 3300006358 Bacteria 54385
89 Ga0068871_100003644 3300006358 Bacteria 10581
90 Ga0068871_100037335 3300006358 Bacteria 3874
91 Ga0075428_100017123 3300006844 Bacteria 8006
92 Ga0075428_100125996 3300006844 Bacteria 2787
93 Ga0075430_100027876 3300006846 Bacteria 4797
94 Ga0075431_100007656 3300006847 Bacteria 10754
95 Ga0075429_100223437 3300006880 Bacteria 1649
96 Ga0068865_100018464 3300006881 Bacteria 4500
97 Ga0097620_100013424 3300006931 Bacteria 8214
98 Ga0097620_100160339 3300006931 Bacteria 2328
99 Ga0097620_100266859 3300006931 Bacteria 1804
100 Ga0105240_10000054 3300009093 Bacteria 225529
101 Ga0114129_10097906 3300009147 Bacteria 4061
102 Ga0105241_10004091 3300009174 Bacteria 10780
103 Ga0105241_10054449 3300009174 Bacteria 3062
104 Ga0105241_10148315 3300009174 Bacteria 1916
105 Ga0105242_10079815 3300009176 Bacteria 2733
106 Ga0105248_10576845 3300009177 Bacteria 1269
107 Ga0105237_10003018 3300009545 Bacteria 20308
108 Ga0105237_10013778 3300009545 Bacteria 8467
109 Ga0105237_10042546 3300009545 Bacteria 4580
110 Ga0105238_10013713 3300009551 Bacteria 8188
111 Ga0105249_10019958 3300009553 Bacteria 5984
112 Ga0105249_10067183 3300009553 Unclassified 3302
113 Ga0105249_10234165 3300009553 Bacteria 1812
114 Ga0105239_10000533 3300010375 Bacteria 55092
115 Ga0105239_10043867 3300010375 Bacteria 4904
116 Ga0105239_10084527 3300010375 Bacteria 3495
117 Ga0105246_10004465 3300011119 Bacteria 8510
118 Ga0105246_10047860 3300011119 Unclassified 2922
119 Ga0105246_10272872 3300011119 Bacteria 1353
120 Ga0157373_10177931 3300013100 Bacteria 1498
121 Ga0157370_10128454 3300013104 Bacteria 2365
122 Ga0157369_10119806 3300013105 Bacteria 2793
123 Ga0157374_10003134 3300013296 Bacteria 13893
124 Ga0157374_10052924 3300013296 Unclassified 3783
125 Ga0157374_10095296 3300013296 Bacteria 2846
126 Ga0157378_10004812 3300013297 Bacteria 11831
127 Ga0163162_10000241 3300013306 Bacteria 49773
128 Ga0163162_10021543 3300013306 Bacteria 6349
129 Ga0163162_10029288 3300013306 Bacteria 5448
130 Ga0163162_10059729 3300013306 Bacteria 3845
131 Ga0163162_10132769 3300013306 Unclassified 2599
132 Ga0163162_10360024 3300013306 Bacteria 1588
133 Ga0157372_10000739 3300013307 Bacteria 35631
134 Ga0157372_10006065 3300013307 Bacteria 12840
135 Ga0157372_10220840 3300013307 Unclassified 2197
136 Ga0157372_10249460 3300013307 Bacteria 2060
137 Ga0157372_10336088 3300013307 Bacteria 1759
138 Ga0157375_10020249 3300013308 Bacteria 6073
139 Ga0157375_10032325 3300013308 Bacteria 4961
140 Ga0157375_10053050 3300013308 Bacteria 3988
141 Ga0157375_10069973 3300013308 Bacteria 3517
142 Ga0157375_10485054 3300013308 Bacteria 1401
143 Ga0163163_10005697 3300014325 Bacteria 10804
144 Ga0163163_10009922 3300014325 Bacteria 8539
145 Ga0163163_10055751 3300014325 Bacteria 3906
146 Ga0157380_10045770 3300014326 Bacteria 3435
147 Ga0157377_10009363 3300014745 Bacteria 4801
148 Ga0157377_10106907 3300014745 Bacteria 1676
149 Ga0157379_10105511 3300014968 Bacteria 2529
150 Ga0157379_10148241 3300014968 Bacteria 2116
151 Ga0157376_10005100 3300014969 Bacteria 9153
152 Ga0157376_10043719 3300014969 Unclassified 3677
153 Ga0163161_10009771 3300017792 Bacteria 6649
154 Ga0163161_10045425 3300017792 Bacteria 3168
155 Ga0163161_10046267 3300017792 Bacteria 3139
156 Ga0207642_10006007 3300025899 Bacteria 4008
157 Ga0207688_10053612 3300025901 Bacteria 2262
158 Ga0207688_10225527 3300025901 Unclassified 1130
159 Ga0207647_10000208 3300025904 Bacteria 47976
160 Ga0207647_10011128 3300025904 Bacteria 6321
161 Ga0207647_10021694 3300025904 Bacteria 4282
162 Ga0207647_10109905 3300025904 Bacteria 1630
163 Ga0207645_10000619 3300025907 Bacteria 29435
164 Ga0207645_10025856 3300025907 Bacteria 3796
165 Ga0207654_10001107 3300025911 Bacteria 14574
166 Ga0207654_10056761 3300025911 Bacteria 2272
167 Ga0207695_10000043 3300025913 Bacteria 444585
168 Ga0207695_10000128 3300025913 Bacteria 226098
169 Ga0207695_10000546 3300025913 Bacteria 78237
170 Ga0207695_10000673 3300025913 Bacteria 67322
171 Ga0207695_10052936 3300025913 Bacteria 4249
172 Ga0207695_10076068 3300025913 Bacteria 3414
173 Ga0207671_10004529 3300025914 Bacteria 13206
174 Ga0207671_10007678 3300025914 Bacteria 9313
175 Ga0207671_10009248 3300025914 Bacteria 8256
176 Ga0207671_10016465 3300025914 Bacteria 5744
177 Ga0207649_10067783 3300025920 Bacteria 2267
178 Ga0207681_10012646 3300025923 Bacteria 5211
179 Ga0207650_10005431 3300025925 Bacteria 8700
180 Ga0207650_10044024 3300025925 Bacteria 3279
181 Ga0207659_10126803 3300025926 Bacteria 1964
182 Ga0207659_10273241 3300025926 Bacteria 1379
183 Ga0207644_10003775 3300025931 Bacteria 9813
184 Ga0207644_10211071 3300025931 Bacteria 1535
185 Ga0207706_10043006 3300025933 Bacteria 4004
186 Ga0207706_10055864 3300025933 Bacteria 3481
187 Ga0207686_10235349 3300025934 Bacteria 1330
188 Ga0207670_10005390 3300025936 Bacteria 7018
189 Ga0207670_10149029 3300025936 Bacteria 1734
190 Ga0207669_10008389 3300025937 Bacteria 4848
191 Ga0207669_10063215 3300025937 Bacteria 2284
192 Ga0207704_10007516 3300025938 Bacteria 5154
193 Ga0207691_10014698 3300025940 Bacteria 7462
194 Ga0207691_10164663 3300025940 Bacteria 1944
195 Ga0207711_10131569 3300025941 Bacteria 2244
196 Ga0207689_10024708 3300025942 Bacteria 5037
197 Ga0207689_10028570 3300025942 Unclassified 4664
198 Ga0207689_10035170 3300025942 Bacteria 4162
199 Ga0207689_10037201 3300025942 Bacteria 4038
200 Ga0207689_10046289 3300025942 Bacteria 3595
201 Ga0207689_10058028 3300025942 Bacteria 3183
202 Ga0207661_10031430 3300025944 Bacteria 4101
203 Ga0207661_10078768 3300025944 Unclassified 2714
204 Ga0207667_10000351 3300025949 Bacteria 62752
205 Ga0207667_10025930 3300025949 Bacteria 6411
206 Ga0207651_10047924 3300025960 Unclassified 2885
207 Ga0207651_10242009 3300025960 Unclassified 1471
208 Ga0207712_10033129 3300025961 Bacteria 3491
209 Ga0207712_10085700 3300025961 Bacteria 2306
210 Ga0207668_10096967 3300025972 Bacteria 2181
211 Ga0207640_10046751 3300025981 Bacteria 2787
212 Ga0207658_10023483 3300025986 Bacteria 4305
213 Ga0207658_10068844 3300025986 Bacteria 2672
214 Ga0207677_10002112 3300026023 Bacteria 10435
215 Ga0207677_10019574 3300026023 Bacteria 4092
216 Ga0207703_10316752 3300026035 Bacteria 1427
217 Ga0207639_10098760 3300026041 Bacteria 2354
218 Ga0207702_10247716 3300026078 Bacteria 1672
219 Ga0207641_10016242 3300026088 Bacteria 6097
220 Ga0207641_10253592 3300026088 Unclassified 1644
221 Ga0207648_10001518 3300026089 Bacteria 25557
222 Ga0207648_10007762 3300026089 Bacteria 10479
223 Ga0207648_10026397 3300026089 Bacteria 5161
224 Ga0207648_10038179 3300026089 Bacteria 4227
225 Ga0207648_10112110 3300026089 Bacteria 2395
226 Ga0207648_10389481 3300026089 Bacteria 1261
227 Ga0207676_10354862 3300026095 Bacteria 1357
228 Ga0207674_10001234 3300026116 Bacteria 33386
229 Ga0207674_10012295 3300026116 Bacteria 9571
230 Ga0207675_100042605 3300026118 Bacteria 4238
231 Ga0207675_100059745 3300026118 Bacteria 3558
232 Ga0207683_10018030 3300026121 Bacteria 6020
233 Ga0207683_10027013 3300026121 Bacteria 4961
234 Ga0207683_10063029 3300026121 Bacteria 3266
235 Ga0207683_10109438 3300026121 Bacteria 2473
236 Ga0207698_10007814 3300026142 Bacteria 6725
237 Ga0207698_10053919 3300026142 Bacteria 3090
238 Ga0207698_10144658 3300026142 Unclassified 2054
239 Ga0207698_10236245 3300026142 Bacteria 1663
240 Ga0268266_10360155 3300028379 Bacteria 1368
241 Ga0268265_10084674 3300028380 Bacteria 2514
242 Ga0268264_10027079 3300028381 Bacteria 4683
243 Ga0268264_10148951 3300028381 Bacteria 2096
244 Ga0268264_10353376 3300028381 Unclassified 1400
245 Ga0307508_10002269 3300031616 Bacteria 20511
246 Ga0373957_0059412 3300035120 Bacteria 1479
247 Ga0373933_0025695 3300035724 Bacteria 3379
248 Ga0373937_0089216 3300036401 Bacteria 2855
249 Ga0373937_0164033 3300036401 Bacteria 2083
250 Ga0466957_0000543 3300044842 Bacteria 19067
251 Ga0495580_0155950 3300046472 Bacteria 1581
252 Ga0495582_0055410 3300046473 Bacteria 2186
253 Ga0495664_0074186 3300046477 Bacteria 2035
254 Ga0495628_0156897 3300046516 Unclassified 1731
255 Ga0495630_0008093 3300046517 Bacteria 7557
256 Ga0495587_0069172 3300046536 Unclassified 2056
257 Ga0495645_0037831 3300046543 Bacteria 3518
258 Ga0495633_0164848 3300046558 Bacteria 1022
259 Ga0495670_0033602 3300046691 Bacteria 2552
260 Ga0495672_0032785 3300047320 Bacteria 3226
261 Ga0495684_0042657 3300047471 Unclassified 3474
262 Ga0501292_001626 3300049515 Bacteria 2794
263 Ga0501298_000838 3300049521 Bacteria 4337
264 Ga0501299_001596 3300049522 Bacteria 2966
265 Ga0501034_0000410 3300049571 Bacteria 72148
266 Ga0501198_008335 3300049649 Bacteria 1503
267 Ga0501202_001268 3300049652 Bacteria 3990
268 Ga0501207_000267 3300049654 Bacteria 5422
269 Ga0501217_000029 3300049661 Bacteria 15673
270 Ga0501223_003533 3300049663 Bacteria 3388
271 Ga0501224_001017 3300049664 Bacteria 3637
272 Ga0501233_001210 3300049668 Bacteria 4395
273 Ga0501236_006808 3300049670 Bacteria 1413
274 Ga0501243_000550 3300049675 Bacteria 5032
275 Ga0501252_000110 3300049682 Bacteria 4716
276 Ga0501253_002158 3300049683 Bacteria 2170
277 Ga0501259_000683 3300049688 Bacteria 5457
278 Ga0501261_001062 3300049690 Bacteria 3363
279 Ga0501221_002165 3300049704 Bacteria 3260
280 Ga0501225_0000741 3300049705 Bacteria 10213
281 Ga0501225_0001972 3300049705 Bacteria 6409
282 Ga0501234_003744 3300049707 Bacteria 2390
283 Ga0501234_010584 3300049707 Bacteria 1439
284 Ga0501245_000551 3300049708 Bacteria 4567
285 Ga0501241_012837 3300049758 Bacteria 1523
286 Ga0501268_013809 3300049765 Bacteria 1308
287 Ga0501271_004175 3300049768 Bacteria 1360
288 Ga0501044_0216777 3300049823 Bacteria 1866
289 Ga0501212_003411 3300049851 Bacteria 1993
290 nmdc:mga0k408_152953_c1 3300050493 Bacteria 1374
291 nmdc:mga0qj67_34230_c1 3300050509 Bacteria 3968
292 nmdc:mga06r32_16055_c1 3300050510 Bacteria 6817
293 nmdc:mga06r32_394954_c1 3300050510 Unclassified 1365
294 nmdc:mga08y16_558965_c1 3300050511 Bacteria 1157
295 Ga0500646_0017980 3300053090 Bacteria 1859
296 Ga0500583_0000044 3300053092 Bacteria 81138
297 Ga0500583_0000246 3300053092 Bacteria 19362
298 Ga0500650_0063155 3300053098 Bacteria 1730
299 Ga0500568_0000555 3300053139 Bacteria 27491
300 Ga0500611_019274 3300053727 Unclassified 1271
301 Ga0466962_0007346 3300061719 Bacteria 5288

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100023985 Ga0068856_1000239855 292
2 3300003323 rootH1_10022472 rootH1_100224724 323
3 3300026078 Ga0207702_10247716 Ga0207702_102477161 323
4 3300005539 Ga0068853_100130738 Ga0068853_1001307382 324
5 3300005577 Ga0068857_100000945 Ga0068857_10000094511 324
6 3300005616 Ga0068852_100007004 Ga0068852_1000070048 324
7 3300009174 Ga0105241_10148315 Ga0105241_101483153 324
8 3300013100 Ga0157373_10177931 Ga0157373_101779313 324
9 3300013307 Ga0157372_10000739 Ga0157372_100007398 324
10 3300025904 Ga0207647_10011128 Ga0207647_100111288 324
11 3300025911 Ga0207654_10056761 Ga0207654_100567613 324
12 3300025913 Ga0207695_10052936 Ga0207695_100529367 324
13 3300025949 Ga0207667_10000351 Ga0207667_1000035132 324
14 3300025981 Ga0207640_10046751 Ga0207640_100467512 324
15 3300026041 Ga0207639_10098760 Ga0207639_100987603 324
16 3300026116 Ga0207674_10001234 Ga0207674_100012346 324
17 3300026142 Ga0207698_10007814 Ga0207698_100078148 324
18 3300010375 Ga0105239_10043867 Ga0105239_100438675 325
19 3300046558 Ga0495633_0164848 Ga0495633_0164848_25_1005 325
20 3300005344 Ga0070661_100112599 Ga0070661_1001125993 326
21 3300025920 Ga0207649_10067783 Ga0207649_100677833 326
22 3300009553 Ga0105249_10067183 Ga0105249_100671832 330
23 3300011119 Ga0105246_10272872 Ga0105246_102728721 330
24 3300025907 Ga0207645_10025856 Ga0207645_100258563 331
25 iso_pu_bacteria 2911138879 2911141902 334
26 3300014968 Ga0157379_10148241 Ga0157379_101482412 336
27 3300005328 Ga0070676_10119447 Ga0070676_101194471 337
28 3300005330 Ga0070690_100141270 Ga0070690_1001412701 337
29 3300005334 Ga0068869_100012073 Ga0068869_1000120734 337
30 3300005335 Ga0070666_10073776 Ga0070666_100737762 337
31 3300005338 Ga0068868_100005347 Ga0068868_1000053475 337
32 3300005354 Ga0070675_100176140 Ga0070675_1001761402 337
33 3300005355 Ga0070671_100064959 Ga0070671_1000649591 337
34 3300005367 Ga0070667_100060795 Ga0070667_1000607955 337
35 3300005456 Ga0070678_100110529 Ga0070678_1001105294 337
36 3300005457 Ga0070662_100052557 Ga0070662_1000525572 337
37 3300005459 Ga0068867_100017783 Ga0068867_1000177832 337
38 3300005459 Ga0068867_100108878 Ga0068867_1001088781 337
39 3300005539 Ga0068853_100108111 Ga0068853_1001081112 337
40 3300005564 Ga0070664_100125770 Ga0070664_1001257703 337
41 3300005578 Ga0068854_100095833 Ga0068854_1000958333 337
42 3300005615 Ga0070702_100032308 Ga0070702_1000323085 337
43 3300005615 Ga0070702_100191166 Ga0070702_1001911662 337
44 3300005719 Ga0068861_100186782 Ga0068861_1001867823 337
45 3300006237 Ga0097621_100119348 Ga0097621_1001193483 337
46 3300009177 Ga0105248_10576845 Ga0105248_105768451 337
47 3300011119 Ga0105246_10047860 Ga0105246_100478603 337
48 3300013296 Ga0157374_10003134 Ga0157374_1000313413 337
49 3300013306 Ga0163162_10029288 Ga0163162_100292883 337
50 3300013306 Ga0163162_10059729 Ga0163162_100597292 337
51 3300013307 Ga0157372_10249460 Ga0157372_102494601 337
52 3300013308 Ga0157375_10020249 Ga0157375_100202492 337
53 3300014745 Ga0157377_10106907 Ga0157377_101069072 337
54 3300014968 Ga0157379_10105511 Ga0157379_101055113 337
55 3300017792 Ga0163161_10009771 Ga0163161_100097714 337
56 3300017792 Ga0163161_10045425 Ga0163161_100454253 337
57 3300025926 Ga0207659_10126803 Ga0207659_101268032 337
58 3300025933 Ga0207706_10043006 Ga0207706_100430062 337
59 3300025934 Ga0207686_10235349 Ga0207686_102353491 337
60 3300025942 Ga0207689_10024708 Ga0207689_100247082 337
61 3300025942 Ga0207689_10035170 Ga0207689_100351703 337
62 3300025960 Ga0207651_10047924 Ga0207651_100479242 337
63 3300025986 Ga0207658_10068844 Ga0207658_100688441 337
64 3300026023 Ga0207677_10002112 Ga0207677_100021125 337
65 3300026035 Ga0207703_10316752 Ga0207703_103167521 337
66 3300026089 Ga0207648_10038179 Ga0207648_100381792 337
67 3300026089 Ga0207648_10112110 Ga0207648_101121102 337
68 3300026121 Ga0207683_10027013 Ga0207683_100270133 337
69 3300053139 Ga0500568_0000555 Ga0500568_0000555_25953_27035 337
70 3300003322 rootL2_10009364 rootL2_100093642 338
71 3300003323 rootH1_10001036 rootH1_1000103623 338
72 3300005331 Ga0070670_100084464 Ga0070670_1000844641 338
73 3300005335 Ga0070666_10003784 Ga0070666_100037843 338
74 3300005338 Ga0068868_100179410 Ga0068868_1001794101 338
75 3300005353 Ga0070669_100006436 Ga0070669_1000064362 338
76 3300006237 Ga0097621_100139089 Ga0097621_1001390891 338
77 3300009553 Ga0105249_10234165 Ga0105249_102341652 338
78 3300013296 Ga0157374_10095296 Ga0157374_100952961 338
79 3300013306 Ga0163162_10000241 Ga0163162_1000024145 338
80 3300025899 Ga0207642_10006007 Ga0207642_100060076 338
81 3300025907 Ga0207645_10000619 Ga0207645_1000061925 338
82 3300025961 Ga0207712_10085700 Ga0207712_100857004 338
83 3300031616 Ga0307508_10002269 Ga0307508_1000226912 338
84 3300044842 Ga0466957_0000543 Ga0466957_0000543_9085_10101 338
85 3300013306 Ga0163162_10021543 Ga0163162_100215432 339
86 3300013306 Ga0163162_10360024 Ga0163162_103600242 339
87 3300013308 Ga0157375_10485054 Ga0157375_104850541 339
88 3300026089 Ga0207648_10389481 Ga0207648_103894811 339
89 3300049823 Ga0501044_0216777 Ga0501044_0216777_506_1525 339
90 3300005329 Ga0070683_100005655 Ga0070683_1000056551 340
91 3300005330 Ga0070690_100095524 Ga0070690_1000955242 340
92 3300005338 Ga0068868_100362989 Ga0068868_1003629891 340
93 3300005344 Ga0070661_100071690 Ga0070661_1000716901 340
94 3300005355 Ga0070671_100005053 Ga0070671_10000505310 340
95 3300005456 Ga0070678_100027979 Ga0070678_1000279793 340
96 3300005459 Ga0068867_100016567 Ga0068867_1000165673 340
97 3300005466 Ga0070685_10012675 Ga0070685_100126752 340
98 3300005535 Ga0070684_100029718 Ga0070684_1000297184 340
99 3300005564 Ga0070664_100039993 Ga0070664_1000399932 340
100 3300005617 Ga0068859_100013424 Ga0068859_1000134244 340
101 3300005618 Ga0068864_100026400 Ga0068864_1000264001 340
102 3300005841 Ga0068863_100013765 Ga0068863_1000137659 340
103 3300006237 Ga0097621_100000260 Ga0097621_10000026020 340
104 3300006358 Ga0068871_100000078 Ga0068871_10000007834 340
105 3300006931 Ga0097620_100013424 Ga0097620_1000134244 340
106 3300009545 Ga0105237_10013778 Ga0105237_100137786 340
107 3300010375 Ga0105239_10000533 Ga0105239_100005336 340
108 3300013307 Ga0157372_10006065 Ga0157372_100060656 340
109 3300013308 Ga0157375_10053050 Ga0157375_100530504 340
110 3300014325 Ga0163163_10055751 Ga0163163_100557513 340
111 3300014745 Ga0157377_10009363 Ga0157377_100093632 340
112 3300017792 Ga0163161_10046267 Ga0163161_100462672 340
113 3300025901 Ga0207688_10225527 Ga0207688_102255271 340
114 3300025904 Ga0207647_10021694 Ga0207647_100216942 340
115 3300025913 Ga0207695_10076068 Ga0207695_100760682 340
116 3300025914 Ga0207671_10009248 Ga0207671_100092486 340
117 3300025925 Ga0207650_10044024 Ga0207650_100440242 340
118 3300025931 Ga0207644_10003775 Ga0207644_100037759 340
119 3300025933 Ga0207706_10055864 Ga0207706_100558643 340
120 3300025936 Ga0207670_10005390 Ga0207670_100053902 340
121 3300025941 Ga0207711_10131569 Ga0207711_101315691 340
122 3300025942 Ga0207689_10058028 Ga0207689_100580282 340
123 3300025944 Ga0207661_10031430 Ga0207661_100314302 340
124 3300025986 Ga0207658_10023483 Ga0207658_100234835 340
125 3300026088 Ga0207641_10016242 Ga0207641_100162423 340
126 3300026116 Ga0207674_10012295 Ga0207674_100122958 340
127 3300026121 Ga0207683_10109438 Ga0207683_101094382 340
128 3300026142 Ga0207698_10144658 Ga0207698_101446582 340
129 3300046691 Ga0495670_0033602 Ga0495670_0033602_304_1329 340
130 3300061719 Ga0466962_0007346 Ga0466962_0007346_4043_5065 340
131 3300005328 Ga0070676_10014069 Ga0070676_100140691 341
132 3300005333 Ga0070677_10002782 Ga0070677_100027827 341
133 3300005334 Ga0068869_100056008 Ga0068869_1000560084 341
134 3300005364 Ga0070673_100065868 Ga0070673_1000658682 341
135 3300005367 Ga0070667_100009708 Ga0070667_1000097084 341
136 3300005456 Ga0070678_100048244 Ga0070678_1000482441 341
137 3300005539 Ga0068853_100220261 Ga0068853_1002202611 341
138 3300005543 Ga0070672_100042689 Ga0070672_1000426894 341
139 3300005548 Ga0070665_100006860 Ga0070665_10000686014 341
140 3300005616 Ga0068852_100227690 Ga0068852_1002276901 341
141 3300005617 Ga0068859_100266860 Ga0068859_1002668602 341
142 3300005843 Ga0068860_100032031 Ga0068860_1000320314 341
143 3300005844 Ga0068862_100049546 Ga0068862_1000495463 341
144 3300006358 Ga0068871_100003644 Ga0068871_10000364413 341
145 3300006881 Ga0068865_100018464 Ga0068865_1000184641 341
146 3300006931 Ga0097620_100266859 Ga0097620_1002668592 341
147 3300009174 Ga0105241_10054449 Ga0105241_100544492 341
148 3300009545 Ga0105237_10003018 Ga0105237_1000301811 341
149 3300011119 Ga0105246_10004465 Ga0105246_100044656 341
150 3300013308 Ga0157375_10069973 Ga0157375_100699735 341
151 3300025901 Ga0207688_10053612 Ga0207688_100536123 341
152 3300025914 Ga0207671_10007678 Ga0207671_100076783 341
153 3300025938 Ga0207704_10007516 Ga0207704_100075165 341
154 3300025940 Ga0207691_10014698 Ga0207691_100146986 341
155 3300025942 Ga0207689_10037201 Ga0207689_100372013 341
156 3300026023 Ga0207677_10019574 Ga0207677_100195744 341
157 3300026089 Ga0207648_10007762 Ga0207648_100077624 341
158 3300026121 Ga0207683_10018030 Ga0207683_100180302 341
159 3300026142 Ga0207698_10236245 Ga0207698_102362451 341
160 3300028379 Ga0268266_10360155 Ga0268266_103601551 341
161 3300028381 Ga0268264_10027079 Ga0268264_100270794 341
162 3300003320 rootH2_10024039 rootH2_1002403923 342
163 3300006195 Ga0075366_10142809 Ga0075366_101428091 342
164 3300006847 Ga0075431_100007656 Ga0075431_10000765612 342
165 3300025937 Ga0207669_10063215 Ga0207669_100632153 342
166 3300035724 Ga0373933_0025695 Ga0373933_0025695_1928_2956 342
167 3300036401 Ga0373937_0164033 Ga0373937_0164033_847_1875 342
168 3300046516 Ga0495628_0156897 Ga0495628_0156897_21_1049 342
169 3300046517 Ga0495630_0008093 Ga0495630_0008093_4642_5670 342
170 3300047471 Ga0495684_0042657 Ga0495684_0042657_2379_3407 342
171 3300050493 nmdc:mga0k408_152953_c1 nmdc:mga0k408_152953_c1_32_1060 342
172 3300050511 nmdc:mga08y16_558965_c1 nmdc:mga08y16_558965_c1_110_1141 342
173 3300005718 Ga0068866_10011577 Ga0068866_100115773 343
174 3300006237 Ga0097621_100039947 Ga0097621_1000399475 343
175 3300006358 Ga0068871_100037335 Ga0068871_1000373352 343
176 3300025942 Ga0207689_10028570 Ga0207689_100285705 343
177 3300026089 Ga0207648_10001518 Ga0207648_1000151822 343
178 3300036401 Ga0373937_0089216 Ga0373937_0089216_423_1457 343
179 3300005356 Ga0070674_100041867 Ga0070674_1000418674 344
180 3300005544 Ga0070686_100036032 Ga0070686_1000360322 344
181 3300013297 Ga0157378_10004812 Ga0157378_100048126 344
182 3300025937 Ga0207669_10008389 Ga0207669_100083893 344
183 3300025960 Ga0207651_10242009 Ga0207651_102420091 344
184 3300026089 Ga0207648_10026397 Ga0207648_100263973 344
185 3300026121 Ga0207683_10063029 Ga0207683_100630293 344
186 3300005295 Ga0065707_10009281 Ga0065707_100092811 346
187 3300005334 Ga0068869_100072933 Ga0068869_1000729332 346
188 3300013306 Ga0163162_10132769 Ga0163162_101327692 346
189 3300013307 Ga0157372_10336088 Ga0157372_103360882 346
190 3300025904 Ga0207647_10109905 Ga0207647_101099052 347
191 3300025949 Ga0207667_10025930 Ga0207667_100259309 347
192 3300005616 Ga0068852_100262069 Ga0068852_1002620691 348
193 3300005841 Ga0068863_100274968 Ga0068863_1002749682 348
194 3300014969 Ga0157376_10005100 Ga0157376_100051004 348
195 3300026088 Ga0207641_10253592 Ga0207641_102535921 348
196 3300005617 Ga0068859_100160341 Ga0068859_1001603413 349
197 3300006931 Ga0097620_100160339 Ga0097620_1001603393 349
198 3300010375 Ga0105239_10084527 Ga0105239_100845273 349
199 3300013296 Ga0157374_10052924 Ga0157374_100529243 349
200 3300035120 Ga0373957_0059412 Ga0373957_0059412_213_1262 349
201 3300046472 Ga0495580_0155950 Ga0495580_0155950_394_1443 349
202 3300046473 Ga0495582_0055410 Ga0495582_0055410_533_1582 349
203 3300046477 Ga0495664_0074186 Ga0495664_0074186_352_1401 349
204 3300046536 Ga0495587_0069172 Ga0495587_0069172_362_1411 349
205 3300046543 Ga0495645_0037831 Ga0495645_0037831_1103_2152 349
206 3300047320 Ga0495672_0032785 Ga0495672_0032785_1026_2075 349
207 3300049571 Ga0501034_0000410 Ga0501034_0000410_7901_8959 349
208 3300005535 Ga0070684_100099272 Ga0070684_1000992721 350
209 3300009176 Ga0105242_10079815 Ga0105242_100798153 350
210 3300013307 Ga0157372_10220840 Ga0157372_102208401 350
211 3300013308 Ga0157375_10032325 Ga0157375_100323253 350
212 3300025913 Ga0207695_10000128 Ga0207695_10000128178 350
213 3300025942 Ga0207689_10046289 Ga0207689_100462891 350
214 3300025944 Ga0207661_10078768 Ga0207661_100787682 350
215 3300025972 Ga0207668_10096967 Ga0207668_100969671 350
216 3300026118 Ga0207675_100042605 Ga0207675_1000426053 350
217 3300028380 Ga0268265_10084674 Ga0268265_100846742 350
218 3300028381 Ga0268264_10353376 Ga0268264_103533761 350
219 3300006844 Ga0075428_100125996 Ga0075428_1001259963 352
220 3300003322 rootL2_10255980 rootL2_102559803 353
221 3300005366 Ga0070659_100046372 Ga0070659_1000463724 353
222 3300005471 Ga0070698_100002200 Ga0070698_10000220016 353
223 3300005577 Ga0068857_100162730 Ga0068857_1001627301 353
224 3300005616 Ga0068852_100006922 Ga0068852_1000069222 353
225 3300013105 Ga0157369_10119806 Ga0157369_101198063 353
226 3300025904 Ga0207647_10000208 Ga0207647_1000020836 353
227 3300050510 nmdc:mga06r32_394954_c1 nmdc:mga06r32_394954_c1_229_1293 353
228 3300053090 Ga0500646_0017980 Ga0500646_0017980_358_1452 353
229 3300053098 Ga0500650_0063155 Ga0500650_0063155_319_1413 353
230 3300005618 Ga0068864_100204248 Ga0068864_1002042483 355
231 3300009174 Ga0105241_10004091 Ga0105241_100040918 355
232 3300009551 Ga0105238_10013713 Ga0105238_100137133 355
233 3300009553 Ga0105249_10019958 Ga0105249_100199581 355
234 3300014325 Ga0163163_10005697 Ga0163163_100056977 355
235 3300025911 Ga0207654_10001107 Ga0207654_100011079 355
236 3300025913 Ga0207695_10000673 Ga0207695_1000067315 355
237 3300025914 Ga0207671_10004529 Ga0207671_100045294 355
238 3300025961 Ga0207712_10033129 Ga0207712_100331294 355
239 3300026095 Ga0207676_10354862 Ga0207676_103548621 355
240 3300028381 Ga0268264_10148951 Ga0268264_101489511 355
241 3300005547 Ga0070693_100072702 Ga0070693_1000727022 356
242 3300049683 Ga0501253_002158 Ga0501253_002158_496_1587 357
243 iso_pu_bacteria 2738541278 2738728050 358
244 3300009093 Ga0105240_10000054 Ga0105240_1000005481 359
245 3300009545 Ga0105237_10042546 Ga0105237_100425462 359
246 3300013104 Ga0157370_10128454 Ga0157370_101284543 359
247 3300025913 Ga0207695_10000043 Ga0207695_10000043218 359
248 3300025913 Ga0207695_10000546 Ga0207695_1000054636 359
249 3300025914 Ga0207671_10016465 Ga0207671_100164655 359
250 3300005340 Ga0070689_100120673 Ga0070689_1001206731 360
251 3300005353 Ga0070669_100047747 Ga0070669_1000477475 360
252 3300005364 Ga0070673_100340363 Ga0070673_1003403631 360
253 3300005719 Ga0068861_100060276 Ga0068861_1000602762 360
254 3300006844 Ga0075428_100017123 Ga0075428_1000171235 360
255 3300006846 Ga0075430_100027876 Ga0075430_1000278761 360
256 3300006880 Ga0075429_100223437 Ga0075429_1002234372 360
257 3300009147 Ga0114129_10097906 Ga0114129_100979064 360
258 3300025923 Ga0207681_10012646 Ga0207681_100126463 360
259 3300025936 Ga0207670_10149029 Ga0207670_101490291 360
260 3300026118 Ga0207675_100059745 Ga0207675_1000597453 360
261 3300050509 nmdc:mga0qj67_34230_c1 nmdc:mga0qj67_34230_c1_1586_2671 360
262 3300050510 nmdc:mga06r32_16055_c1 nmdc:mga06r32_16055_c1_2330_3415 360
263 3300005331 Ga0070670_100007852 Ga0070670_10000785213 362
264 3300005564 Ga0070664_100112002 Ga0070664_1001120021 362
265 3300005834 Ga0068851_10037634 Ga0068851_100376342 362
266 3300014325 Ga0163163_10009922 Ga0163163_1000992210 362
267 3300014326 Ga0157380_10045770 Ga0157380_100457703 362
268 3300025925 Ga0207650_10005431 Ga0207650_1000543112 362
269 3300025926 Ga0207659_10273241 Ga0207659_102732411 362
270 3300025931 Ga0207644_10211071 Ga0207644_102110711 362
271 3300025940 Ga0207691_10164663 Ga0207691_101646631 362
272 3300026142 Ga0207698_10053919 Ga0207698_100539192 362
273 3300049515 Ga0501292_001626 Ga0501292_001626_927_2048 362
274 3300049521 Ga0501298_000838 Ga0501298_000838_138_1259 362
275 3300049522 Ga0501299_001596 Ga0501299_001596_1708_2829 362
276 3300049649 Ga0501198_008335 Ga0501198_008335_138_1259 362
277 3300049652 Ga0501202_001268 Ga0501202_001268_170_1291 362
278 3300049654 Ga0501207_000267 Ga0501207_000267_1887_3008 362
279 3300049661 Ga0501217_000029 Ga0501217_000029_7023_8144 362
280 3300049663 Ga0501223_003533 Ga0501223_003533_611_1732 362
281 3300049664 Ga0501224_001017 Ga0501224_001017_233_1354 362
282 3300049668 Ga0501233_001210 Ga0501233_001210_3099_4220 362
283 3300049670 Ga0501236_006808 Ga0501236_006808_139_1260 362
284 3300049675 Ga0501243_000550 Ga0501243_000550_1695_2816 362
285 3300049682 Ga0501252_000110 Ga0501252_000110_2455_3576 362
286 3300049688 Ga0501259_000683 Ga0501259_000683_2612_3733 362
287 3300049690 Ga0501261_001062 Ga0501261_001062_1993_3114 362
288 3300049704 Ga0501221_002165 Ga0501221_002165_2000_3121 362
289 3300049705 Ga0501225_0000741 Ga0501225_0000741_4587_5708 362
290 3300049705 Ga0501225_0001972 Ga0501225_0001972_3167_4261 362
291 3300049707 Ga0501234_003744 Ga0501234_003744_139_1260 362
292 3300049707 Ga0501234_010584 Ga0501234_010584_135_1298 362
293 3300049708 Ga0501245_000551 Ga0501245_000551_2047_3168 362
294 3300049758 Ga0501241_012837 Ga0501241_012837_78_1199 362
295 3300049765 Ga0501268_013809 Ga0501268_013809_163_1284 362
296 3300049768 Ga0501271_004175 Ga0501271_004175_130_1251 362
297 3300049851 Ga0501212_003411 Ga0501212_003411_691_1812 362
298 3300053092 Ga0500583_0000044 Ga0500583_0000044_34424_35518 362
299 3300053092 Ga0500583_0000246 Ga0500583_0000246_4602_5696 362
300 3300053727 Ga0500611_019274 Ga0500611_019274_61_1155 362
301 3300003316 rootH1_10073230 rootH1_100732302 365
302 3300005458 Ga0070681_10010876 Ga0070681_100108767 365
303 3300014969 Ga0157376_10043719 Ga0157376_100437192 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00487

FA_desaturase

Fatty acid desaturase

50

277

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.5704 12 334
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.5601 51 345
4zyo-assembly1.cif.gz_A crystal structure of human integral membrane stearoyl-coa desaturase with substrate 0.558 12 334
4ymk-assembly2.cif.gz_D crystal structure of stearoyl-coenzyme a desaturase 1 0.5157 51 345
7rs4-assembly2.cif.gz_C crystal structure of the er-alpha ligand-binding domain (l372s, l536s) in complex with dmeri-8 0.2285 4 262
ID Description Score Start End Superfamily
af_Q9XTJ4_222_461_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.2792 83 251 1.10.565.10
af_O02151_129_350_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.2778 81 253 1.10.565.10
af_Q9XXB5_130_329_1.10.565.10 Mainly Alpha;Orthogonal Bundle;Retinoid X Receptor;Retinoid X Receptor 0.274 55 256 1.10.565.10
af_Q58749_1_145_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2695 175 257 1.20.1070.10
af_Q19153_286_501_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.2508 39 253 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A3C0ZDD1-F1-model_v4 Fatty acid desaturase 0.975 6 245 GO:0016020
AF-A0A3C0ZDD1-F1-model_v4 Fatty acid desaturase 0.9594 6 245 GO:0016020
AF-A0A519Y3N4-F1-model_v4 Acyl-CoA desaturase 0.9571 6 186 GO:0004768
GO:0005506
GO:0006636
GO:0016020
AF-A0A519Y3N4-F1-model_v4 Acyl-CoA desaturase 0.9371 6 186 GO:0004768
GO:0005506
GO:0006636
GO:0016020
AF-A0A3B9NLF3-F1-model_v4 Fatty acid desaturase 0.9199 6 337 GO:0006633
GO:0016020
GO:0016717

Feature Viewer

pLDDT pTM Quality
82.66 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map