F396831

General Info

Members Datasets Scaffolds Average Seq Length
303 141 606 101

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11182760|Ga0070658_111827602
Length 106
Sequence LIALVFRYEVRDNESFEAAYGPEGDWAQFFRHGAGYIGTELLHDVEEPERYLVVDRWESADAYNAFLAANQAEYLRRSDESRFHYVQELRFGTFENVWHAEDPAAP

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
93 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
94 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
124 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
131 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
132 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
133 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
136 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
137 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.54
Rhizosphere 84.82
Stem 0
Stem Tuber 0
Unclassified 5.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11182760 3300005327 Bacteria 665
2 Ga0070658_10491448 3300005327 Bacteria 1059
3 Ga0070658_10556569 3300005327 Bacteria 993
4 Ga0070683_100054322 3300005329 Bacteria 3714
5 Ga0070683_100409668 3300005329 Bacteria 1293
6 Ga0070683_100572246 3300005329 Bacteria 1080
7 Ga0070683_102041059 3300005329 Bacteria 551
8 Ga0070682_100100178 3300005337 Bacteria 1911
9 Ga0070682_100316607 3300005337 Unclassified 1151
10 Ga0070682_100644367 3300005337 Bacteria 842
11 Ga0070682_100785805 3300005337 Bacteria 772
12 Ga0070660_100023030 3300005339 Bacteria 4611
13 Ga0070660_100055513 3300005339 Bacteria 3061
14 Ga0070660_100123013 3300005339 Bacteria 2071
15 Ga0070660_100781577 3300005339 Bacteria 802
16 Ga0070661_100059520 3300005344 Bacteria 2801
17 Ga0070661_100103199 3300005344 Bacteria 2123
18 Ga0070661_100190126 3300005344 Bacteria 1565
19 Ga0070661_100252586 3300005344 Bacteria 1361
20 Ga0070661_100297746 3300005344 Bacteria 1255
21 Ga0070659_100170267 3300005366 Bacteria 1783
22 Ga0070659_100318390 3300005366 Bacteria 1300
23 Ga0070659_100361405 3300005366 Unclassified 1220
24 Ga0070714_100185651 3300005435 Bacteria 1894
25 Ga0070714_100202398 3300005435 Bacteria 1817
26 Ga0070714_100288341 3300005435 Bacteria 1527
27 Ga0070714_100531750 3300005435 Bacteria 1124
28 Ga0070714_100540476 3300005435 Bacteria 1115
29 Ga0070713_100684015 3300005436 Bacteria 979
30 Ga0070711_100103083 3300005439 Bacteria 2079
31 Ga0070663_100442489 3300005455 Bacteria 1070
32 Ga0070678_100299833 3300005456 Bacteria 1365
33 Ga0070662_101075334 3300005457 Bacteria 690
34 Ga0070681_10007221 3300005458 Bacteria 10837
35 Ga0070681_10259618 3300005458 Bacteria 1649
36 Ga0070681_10290295 3300005458 Bacteria 1545
37 Ga0070685_10379599 3300005466 Bacteria 973
38 Ga0070707_100805290 3300005468 Viruses 903
39 Ga0070679_100090793 3300005530 Bacteria 3043
40 Ga0070679_100280265 3300005530 Bacteria 1620
41 Ga0070679_101595010 3300005530 Bacteria 600
42 Ga0070684_100111046 3300005535 Bacteria 2458
43 Ga0068853_100397395 3300005539 Bacteria 1289
44 Ga0068853_101379334 3300005539 Bacteria 681
45 Ga0070693_100934176 3300005547 Bacteria 652
46 Ga0070665_100540592 3300005548 Bacteria 1177
47 Ga0068855_100064044 3300005563 Bacteria 4288
48 Ga0068855_100066235 3300005563 Bacteria 4212
49 Ga0068855_100164541 3300005563 Bacteria 2515
50 Ga0068855_101105217 3300005563 Bacteria 828
51 Ga0068857_100213824 3300005577 Bacteria 1760
52 Ga0068856_100021920 3300005614 Bacteria 6210
53 Ga0068856_100172256 3300005614 Bacteria 2177
54 Ga0068856_100796267 3300005614 Bacteria 965
55 Ga0068852_100144872 3300005616 Bacteria 2202
56 Ga0068852_100709335 3300005616 Bacteria 1016
57 Ga0070717_10330938 3300006028 Bacteria 1359
58 Ga0070715_10308055 3300006163 Bacteria 850
59 Ga0070712_100194189 3300006175 Bacteria 1590
60 Ga0068871_100538797 3300006358 Bacteria 1056
61 Ga0068871_101133160 3300006358 Bacteria 732
62 Ga0105240_10103567 3300009093 Bacteria 3458
63 Ga0105240_10546175 3300009093 Bacteria 1282
64 Ga0105245_10095146 3300009098 Bacteria 2747
65 Ga0105243_12810027 3300009148 Bacteria 527
66 Ga0105241_11280859 3300009174 Archaea 697
67 Ga0105241_11329522 3300009174 Bacteria 685
68 Ga0105242_10223686 3300009176 Bacteria 1683
69 Ga0105237_10202024 3300009545 Bacteria 1988
70 Ga0105237_10254506 3300009545 Bacteria 1758
71 Ga0105238_10010471 3300009551 Bacteria 9308
72 Ga0105238_10181953 3300009551 Bacteria 2079
73 Ga0105238_11372228 3300009551 Unclassified 734
74 Ga0105238_12232639 3300009551 Bacteria 582
75 Ga0105239_10302805 3300010375 Bacteria 1800
76 Ga0105239_10458067 3300010375 Bacteria 1447
77 Ga0105239_11170711 3300010375 Bacteria 886
78 Ga0105239_12571140 3300010375 Bacteria 594
79 Ga0157373_10522446 3300013100 Bacteria 859
80 Ga0157370_10083444 3300013104 Bacteria 3004
81 Ga0157370_10175555 3300013104 Bacteria 1991
82 Ga0157370_10348629 3300013104 Bacteria 1365
83 Ga0157369_10049233 3300013105 Bacteria 4569
84 Ga0157369_10766036 3300013105 Bacteria 992
85 Ga0157369_10818007 3300013105 Bacteria 957
86 Ga0157369_11006328 3300013105 Bacteria 853
87 Ga0157369_11874616 3300013105 Bacteria 609
88 Ga0157374_10711324 3300013296 Bacteria 1018
89 Ga0157374_10726771 3300013296 Bacteria 1007
90 Ga0157374_12484493 3300013296 Bacteria 546
91 Ga0157372_10397063 3300013307 Bacteria 1607
92 Ga0157372_10768461 3300013307 Bacteria 1120
93 Ga0157372_10839980 3300013307 Bacteria 1066
94 Ga0157372_11811278 3300013307 Unclassified 702
95 Ga0157375_10142357 3300013308 Bacteria 2526
96 Ga0157375_10848460 3300013308 Bacteria 1060
97 Ga0163163_12400197 3300014325 Bacteria 586
98 Ga0157377_10275445 3300014745 Bacteria 1101
99 Ga0157376_10171690 3300014969 Bacteria 1975
100 Ga0157376_12003213 3300014969 Bacteria 617
101 Ga0182006_1260925 3300015261 Bacteria 568
102 Ga0206353_10309551 3300020082 Bacteria 708
103 Ga0213874_10223389 3300021377 Bacteria 685
104 Ga0213876_10089062 3300021384 Bacteria 1635
105 Ga0213876_10662809 3300021384 Bacteria 555
106 Ga0224712_10676671 3300022467 Bacteria 507
107 Ga0207699_10358195 3300025906 Bacteria 1031
108 Ga0207705_10086629 3300025909 Bacteria 2289
109 Ga0207705_10992304 3300025909 Bacteria 649
110 Ga0207684_11715231 3300025910 Viruses 506
111 Ga0207707_10127092 3300025912 Bacteria 2229
112 Ga0207707_11098867 3300025912 Bacteria 648
113 Ga0207695_11051743 3300025913 Bacteria 694
114 Ga0207671_10177401 3300025914 Bacteria 1657
115 Ga0207671_10211740 3300025914 Bacteria 1516
116 Ga0207671_10518639 3300025914 Bacteria 950
117 Ga0207671_10806850 3300025914 Bacteria 744
118 Ga0207693_10045719 3300025915 Bacteria 3439
119 Ga0207663_10101362 3300025916 Bacteria 1934
120 Ga0207660_11278196 3300025917 Bacteria 596
121 Ga0207657_10046572 3300025919 Bacteria 3798
122 Ga0207657_10061096 3300025919 Bacteria 3232
123 Ga0207657_10069507 3300025919 Bacteria 2988
124 Ga0207657_10127230 3300025919 Bacteria 2091
125 Ga0207657_11237627 3300025919 Unclassified 566
126 Ga0207649_10127177 3300025920 Bacteria 1726
127 Ga0207649_10193784 3300025920 Bacteria 1431
128 Ga0207649_10231586 3300025920 Bacteria 1321
129 Ga0207649_10237807 3300025920 Bacteria 1306
130 Ga0207652_10058785 3300025921 Bacteria 3313
131 Ga0207646_10547250 3300025922 Viruses 1041
132 Ga0207694_10045730 3300025924 Bacteria 3381
133 Ga0207694_10275506 3300025924 Bacteria 1381
134 Ga0207687_10217071 3300025927 Bacteria 1504
135 Ga0207700_10927831 3300025928 Unclassified 779
136 Ga0207700_11217037 3300025928 Bacteria 672
137 Ga0207664_10238801 3300025929 Bacteria 1582
138 Ga0207664_10362987 3300025929 Bacteria 1283
139 Ga0207664_10402569 3300025929 Bacteria 1217
140 Ga0207664_10542873 3300025929 Bacteria 1043
141 Ga0207690_10200744 3300025932 Bacteria 1514
142 Ga0207690_10494083 3300025932 Unclassified 989
143 Ga0207690_11697155 3300025932 Bacteria 528
144 Ga0207661_10260960 3300025944 Bacteria 1543
145 Ga0207661_10367384 3300025944 Bacteria 1300
146 Ga0207661_10467121 3300025944 Bacteria 1151
147 Ga0207661_11348121 3300025944 Bacteria 655
148 Ga0207667_10231864 3300025949 Bacteria 1890
149 Ga0207667_10321153 3300025949 Bacteria 1581
150 Ga0207640_10047849 3300025981 Bacteria 2761
151 Ga0207640_11096036 3300025981 Bacteria 704
152 Ga0207677_10377268 3300026023 Unclassified 1196
153 Ga0207678_10126567 3300026067 Bacteria 2179
154 Ga0207678_10219779 3300026067 Bacteria 1626
155 Ga0207702_10314291 3300026078 Bacteria 1490
156 Ga0207702_10491029 3300026078 Bacteria 1196
157 Ga0207702_10623638 3300026078 Bacteria 1059
158 Ga0207674_12114766 3300026116 Bacteria 527
159 Ga0207683_10474104 3300026121 Bacteria 1155
160 Ga0207698_10187020 3300026142 Bacteria 1840
161 Ga0207698_10452067 3300026142 Bacteria 1240
162 Ga0268266_10370321 3300028379 Bacteria 1349
163 Ga0268266_11190110 3300028379 Bacteria 737
164 Ga0373936_0004175 3300035113 Bacteria 5445
165 Ga0373945_0008968 3300035116 Bacteria 3270
166 Ga0373943_0003813 3300035170 Bacteria 6849
167 Ga0373943_0778461 3300035170 Bacteria 569
168 Ga0373946_0063124 3300035171 Bacteria 1581
169 Ga0373935_0021402 3300035692 Bacteria 3959
170 Ga0373927_0043401 3300035695 Bacteria 2911
171 Ga0373947_0001362 3300035725 Bacteria 15017
172 Ga0373925_0006298 3300037068 Bacteria 8741
173 Ga0395900_0378468 3300037418 Unclassified 1384
174 Ga0395900_0773957 3300037418 Bacteria 889
175 Ga0395900_1050897 3300037418 Bacteria 733
176 Ga0395900_1614004 3300037418 Bacteria 560
177 Ga0395898_0008518 3300037466 Bacteria 10837
178 Ga0395898_0016020 3300037466 Bacteria 7677
179 Ga0395898_0027494 3300037466 Bacteria 5709
180 Ga0395898_0539730 3300037466 Bacteria 1108
181 Ga0395898_1047053 3300037466 Bacteria 751
182 Ga0395905_0518603 3300037471 Bacteria 1092
183 Ga0395905_0546351 3300037471 Bacteria 1060
184 Ga0395905_1741151 3300037471 Bacteria 529
185 Ga0395901_0064395 3300038443 Bacteria 3816
186 Ga0395901_0774379 3300038443 Bacteria 950
187 Ga0436365_1105586 3300039437 Bacteria 2551
188 Ga0436365_1801617 3300039437 Bacteria 2583
189 Ga0436363_1407479 3300039450 Bacteria 1112
190 Ga0451839_0919644 3300041496 Bacteria 676
191 Ga0451841_0105009 3300041498 Bacteria 548
192 Ga0466969_0208407 3300044656 Bacteria 891
193 Ga0466965_0546386 3300044683 Unclassified 654
194 Ga0466966_0062135 3300044684 Bacteria 2355
195 Ga0466966_0176066 3300044684 Bacteria 1299
196 Ga0466966_0189968 3300044684 Bacteria 1245
197 Ga0466966_0240206 3300044684 Bacteria 1092
198 Ga0466966_0651635 3300044684 Bacteria 634
199 Ga0466961_0002522 3300044693 Bacteria 11359
200 Ga0466961_0229692 3300044693 Bacteria 1142
201 Ga0466961_0640932 3300044693 Bacteria 638
202 Ga0466961_0677103 3300044693 Bacteria 618
203 Ga0466963_0007650 3300044694 Bacteria 6450
204 Ga0466963_0040979 3300044694 Bacteria 3036
205 Ga0466963_0101552 3300044694 Bacteria 1969
206 Ga0466963_0133958 3300044694 Bacteria 1713
207 Ga0466963_0148302 3300044694 Archaea 1628
208 Ga0466963_0183518 3300044694 Bacteria 1461
209 Ga0466963_1025221 3300044694 Bacteria 581
210 Ga0466964_0007704 3300044706 Bacteria 4031
211 Ga0466964_0008125 3300044706 Bacteria 3937
212 Ga0466971_0001396 3300044719 Bacteria 10143
213 Ga0466971_0499470 3300044719 Bacteria 600
214 Ga0466968_0654852 3300044735 Bacteria 533
215 Ga0466970_0055642 3300044765 Bacteria 2113
216 Ga0466957_0000929 3300044842 Bacteria 14986
217 Ga0466957_0057041 3300044842 Bacteria 2389
218 Ga0466960_0020143 3300044901 Bacteria 2951
219 Ga0466960_0056311 3300044901 Bacteria 1914
220 Ga0466959_0022872 3300045049 Bacteria 4620
221 Ga0466959_0143656 3300045049 Bacteria 1685
222 Ga0466959_0401680 3300045049 Bacteria 931
223 Ga0466959_1008387 3300045049 Bacteria 554
224 Ga0466958_0006176 3300045836 Bacteria 6499
225 Ga0466958_0466684 3300045836 Bacteria 818
226 Ga0466958_0602723 3300045836 Bacteria 714
227 Ga0466967_0014595 3300045976 Bacteria 6126
228 Ga0466967_0044139 3300045976 Bacteria 3864
229 Ga0466967_0050980 3300045976 Bacteria 3625
230 Ga0466967_0057278 3300045976 Bacteria 3440
231 Ga0466967_0095591 3300045976 Bacteria 2708
232 Ga0466967_0118875 3300045976 Bacteria 2438
233 Ga0466967_0206695 3300045976 Bacteria 1861
234 Ga0466967_0258546 3300045976 Bacteria 1665
235 Ga0466967_0626828 3300045976 Bacteria 1062
236 Ga0466967_1001735 3300045976 Archaea 832
237 Ga0466967_1419537 3300045976 Bacteria 691
238 Ga0495603_0126018 3300046455 Bacteria 1492
239 Ga0495629_0278310 3300046459 Bacteria 1149
240 Ga0495629_0712281 3300046459 Bacteria 666
241 Ga0495641_0006772 3300046461 Bacteria 7345
242 Ga0495582_0110383 3300046473 Bacteria 1545
243 Ga0495665_0086233 3300046531 Bacteria 1650
244 Ga0495646_0426740 3300046680 Bacteria 687
245 Ga0495658_0206994 3300046683 Bacteria 1224
246 Ga0495624_0640149 3300046690 Bacteria 633
247 Ga0495680_0440728 3300047322 Bacteria 893
248 Ga0496101_0002657 3300048904 Bacteria 10974
249 Ga0496101_0044764 3300048904 Bacteria 3168
250 Ga0496101_0089580 3300048904 Bacteria 2287
251 Ga0496101_1016275 3300048904 Unclassified 652
252 Ga0496102_0016337 3300048905 Bacteria 6484
253 Ga0496102_0905019 3300048905 Unclassified 804
254 Ga0496103_0069106 3300048906 Bacteria 2208
255 Ga0496104_0018412 3300048907 Bacteria 6371
256 Ga0496104_0158431 3300048907 Bacteria 2172
257 Ga0496105_0011983 3300048908 Bacteria 6865
258 Ga0496105_0017196 3300048908 Bacteria 5792
259 Ga0496106_0003528 3300048909 Bacteria 11653
260 Ga0496106_0383681 3300048909 Unclassified 1129
261 Ga0496107_0005690 3300048910 Bacteria 8528
262 Ga0496107_0051644 3300048910 Bacteria 2966
263 Ga0496108_0008467 3300048911 Bacteria 8345
264 Ga0496108_0164269 3300048911 Bacteria 1919
265 Ga0496108_0477372 3300048911 Bacteria 1089
266 Ga0496109_0018664 3300048912 Bacteria 6095
267 Ga0496109_0260025 3300048912 Bacteria 1635
268 Ga0496109_1667234 3300048912 Bacteria 571
269 Ga0496110_0036762 3300048913 Bacteria 4254
270 Ga0496110_0137212 3300048913 Bacteria 2211
271 Ga0496110_0212410 3300048913 Bacteria 1759
272 Ga0496110_1527068 3300048913 Bacteria 578
273 Ga0496111_0075506 3300048914 Bacteria 2456
274 Ga0496111_0134091 3300048914 Bacteria 1834
275 Ga0496111_0384385 3300048914 Unclassified 1038
276 Ga0496112_1400422 3300048915 Bacteria 614
277 Ga0496113_0403750 3300048916 Bacteria 1097
278 Ga0496114_0082627 3300048917 Bacteria 2715
279 Ga0496114_0206384 3300048917 Bacteria 1722
280 Ga0496114_0776616 3300048917 Unclassified 836
281 Ga0496114_1005334 3300048917 Bacteria 717
282 Ga0496114_1170932 3300048917 Unclassified 654
283 Ga0496115_0003812 3300048918 Bacteria 10859
284 Ga0496115_0759789 3300048918 Bacteria 757
285 Ga0496115_0818537 3300048918 Archaea 724
286 Ga0501043_0602145 3300049579 Bacteria 812
287 Ga0501046_1130437 3300049580 Bacteria 540
288 Ga0501067_0000306 3300049583 Bacteria 26960
289 Ga0501067_0069114 3300049583 Bacteria 1956
290 Ga0501067_0265098 3300049583 Bacteria 956
291 Ga0501067_0393610 3300049583 Unclassified 773
292 Ga0501069_0010204 3300049585 Bacteria 4968
293 Ga0501069_0160334 3300049585 Bacteria 1295
294 Ga0501069_0471383 3300049585 Bacteria 747
295 Ga0501070_0033951 3300049586 Bacteria 4268
296 Ga0501070_0438971 3300049586 Bacteria 1053
297 Ga0501070_0607238 3300049586 Bacteria 872
298 Ga0501074_1120461 3300049590 Bacteria 552
299 Ga0501080_1736400 3300049742 Unclassified 526
300 Ga0501035_0462931 3300049822 Bacteria 1048
301 Ga0466962_0000864 3300061719 Bacteria 13743
302 Ga0466962_0011148 3300061719 Bacteria 4327
303 Ga0466962_0593518 3300061719 Bacteria 564
304 Ga0070658_11182760
305 Ga0070658_10491448
306 Ga0070658_10556569
307 Ga0070683_100054322
308 Ga0070683_100409668
309 Ga0070683_100572246
310 Ga0070683_102041059
311 Ga0070682_100100178
312 Ga0070682_100316607
313 Ga0070682_100644367
314 Ga0070682_100785805
315 Ga0070660_100023030
316 Ga0070660_100055513
317 Ga0070660_100123013
318 Ga0070660_100781577
319 Ga0070661_100059520
320 Ga0070661_100103199
321 Ga0070661_100190126
322 Ga0070661_100252586
323 Ga0070661_100297746
324 Ga0070659_100170267
325 Ga0070659_100318390
326 Ga0070659_100361405
327 Ga0070714_100185651
328 Ga0070714_100202398
329 Ga0070714_100288341
330 Ga0070714_100531750
331 Ga0070714_100540476
332 Ga0070713_100684015
333 Ga0070711_100103083
334 Ga0070663_100442489
335 Ga0070678_100299833
336 Ga0070662_101075334
337 Ga0070681_10007221
338 Ga0070681_10259618
339 Ga0070681_10290295
340 Ga0070685_10379599
341 Ga0070707_100805290
342 Ga0070679_100090793
343 Ga0070679_100280265
344 Ga0070679_101595010
345 Ga0070684_100111046
346 Ga0068853_100397395
347 Ga0068853_101379334
348 Ga0070693_100934176
349 Ga0070665_100540592
350 Ga0068855_100064044
351 Ga0068855_100066235
352 Ga0068855_100164541
353 Ga0068855_101105217
354 Ga0068857_100213824
355 Ga0068856_100021920
356 Ga0068856_100172256
357 Ga0068856_100796267
358 Ga0068852_100144872
359 Ga0068852_100709335
360 Ga0070717_10330938
361 Ga0070715_10308055
362 Ga0070712_100194189
363 Ga0068871_100538797
364 Ga0068871_101133160
365 Ga0105240_10103567
366 Ga0105240_10546175
367 Ga0105245_10095146
368 Ga0105243_12810027
369 Ga0105241_11280859
370 Ga0105241_11329522
371 Ga0105242_10223686
372 Ga0105237_10202024
373 Ga0105237_10254506
374 Ga0105238_10010471
375 Ga0105238_10181953
376 Ga0105238_11372228
377 Ga0105238_12232639
378 Ga0105239_10302805
379 Ga0105239_10458067
380 Ga0105239_11170711
381 Ga0105239_12571140
382 Ga0157373_10522446
383 Ga0157370_10083444
384 Ga0157370_10175555
385 Ga0157370_10348629
386 Ga0157369_10049233
387 Ga0157369_10766036
388 Ga0157369_10818007
389 Ga0157369_11006328
390 Ga0157369_11874616
391 Ga0157374_10711324
392 Ga0157374_10726771
393 Ga0157374_12484493
394 Ga0157372_10397063
395 Ga0157372_10768461
396 Ga0157372_10839980
397 Ga0157372_11811278
398 Ga0157375_10142357
399 Ga0157375_10848460
400 Ga0163163_12400197
401 Ga0157377_10275445
402 Ga0157376_10171690
403 Ga0157376_12003213
404 Ga0182006_1260925
405 Ga0206353_10309551
406 Ga0213874_10223389
407 Ga0213876_10089062
408 Ga0213876_10662809
409 Ga0224712_10676671
410 Ga0207699_10358195
411 Ga0207705_10086629
412 Ga0207705_10992304
413 Ga0207684_11715231
414 Ga0207707_10127092
415 Ga0207707_11098867
416 Ga0207695_11051743
417 Ga0207671_10177401
418 Ga0207671_10211740
419 Ga0207671_10518639
420 Ga0207671_10806850
421 Ga0207693_10045719
422 Ga0207663_10101362
423 Ga0207660_11278196
424 Ga0207657_10046572
425 Ga0207657_10061096
426 Ga0207657_10069507
427 Ga0207657_10127230
428 Ga0207657_11237627
429 Ga0207649_10127177
430 Ga0207649_10193784
431 Ga0207649_10231586
432 Ga0207649_10237807
433 Ga0207652_10058785
434 Ga0207646_10547250
435 Ga0207694_10045730
436 Ga0207694_10275506
437 Ga0207687_10217071
438 Ga0207700_10927831
439 Ga0207700_11217037
440 Ga0207664_10238801
441 Ga0207664_10362987
442 Ga0207664_10402569
443 Ga0207664_10542873
444 Ga0207690_10200744
445 Ga0207690_10494083
446 Ga0207690_11697155
447 Ga0207661_10260960
448 Ga0207661_10367384
449 Ga0207661_10467121
450 Ga0207661_11348121
451 Ga0207667_10231864
452 Ga0207667_10321153
453 Ga0207640_10047849
454 Ga0207640_11096036
455 Ga0207677_10377268
456 Ga0207678_10126567
457 Ga0207678_10219779
458 Ga0207702_10314291
459 Ga0207702_10491029
460 Ga0207702_10623638
461 Ga0207674_12114766
462 Ga0207683_10474104
463 Ga0207698_10187020
464 Ga0207698_10452067
465 Ga0268266_10370321
466 Ga0268266_11190110
467 Ga0373936_0004175
468 Ga0373945_0008968
469 Ga0373943_0003813
470 Ga0373943_0778461
471 Ga0373946_0063124
472 Ga0373935_0021402
473 Ga0373927_0043401
474 Ga0373947_0001362
475 Ga0373925_0006298
476 Ga0395900_0378468
477 Ga0395900_0773957
478 Ga0395900_1050897
479 Ga0395900_1614004
480 Ga0395898_0008518
481 Ga0395898_0016020
482 Ga0395898_0027494
483 Ga0395898_0539730
484 Ga0395898_1047053
485 Ga0395905_0518603
486 Ga0395905_0546351
487 Ga0395905_1741151
488 Ga0395901_0064395
489 Ga0395901_0774379
490 Ga0436365_1105586
491 Ga0436365_1801617
492 Ga0436363_1407479
493 Ga0451839_0919644
494 Ga0451841_0105009
495 Ga0466969_0208407
496 Ga0466965_0546386
497 Ga0466966_0062135
498 Ga0466966_0176066
499 Ga0466966_0189968
500 Ga0466966_0240206
501 Ga0466966_0651635
502 Ga0466961_0002522
503 Ga0466961_0229692
504 Ga0466961_0640932
505 Ga0466961_0677103
506 Ga0466963_0007650
507 Ga0466963_0040979
508 Ga0466963_0101552
509 Ga0466963_0133958
510 Ga0466963_0148302
511 Ga0466963_0183518
512 Ga0466963_1025221
513 Ga0466964_0007704
514 Ga0466964_0008125
515 Ga0466971_0001396
516 Ga0466971_0499470
517 Ga0466968_0654852
518 Ga0466970_0055642
519 Ga0466957_0000929
520 Ga0466957_0057041
521 Ga0466960_0020143
522 Ga0466960_0056311
523 Ga0466959_0022872
524 Ga0466959_0143656
525 Ga0466959_0401680
526 Ga0466959_1008387
527 Ga0466958_0006176
528 Ga0466958_0466684
529 Ga0466958_0602723
530 Ga0466967_0014595
531 Ga0466967_0044139
532 Ga0466967_0050980
533 Ga0466967_0057278
534 Ga0466967_0095591
535 Ga0466967_0118875
536 Ga0466967_0206695
537 Ga0466967_0258546
538 Ga0466967_0626828
539 Ga0466967_1001735
540 Ga0466967_1419537
541 Ga0495603_0126018
542 Ga0495629_0278310
543 Ga0495629_0712281
544 Ga0495641_0006772
545 Ga0495582_0110383
546 Ga0495665_0086233
547 Ga0495646_0426740
548 Ga0495658_0206994
549 Ga0495624_0640149
550 Ga0495680_0440728
551 Ga0496101_0002657
552 Ga0496101_0044764
553 Ga0496101_0089580
554 Ga0496101_1016275
555 Ga0496102_0016337
556 Ga0496102_0905019
557 Ga0496103_0069106
558 Ga0496104_0018412
559 Ga0496104_0158431
560 Ga0496105_0011983
561 Ga0496105_0017196
562 Ga0496106_0003528
563 Ga0496106_0383681
564 Ga0496107_0005690
565 Ga0496107_0051644
566 Ga0496108_0008467
567 Ga0496108_0164269
568 Ga0496108_0477372
569 Ga0496109_0018664
570 Ga0496109_0260025
571 Ga0496109_1667234
572 Ga0496110_0036762
573 Ga0496110_0137212
574 Ga0496110_0212410
575 Ga0496110_1527068
576 Ga0496111_0075506
577 Ga0496111_0134091
578 Ga0496111_0384385
579 Ga0496112_1400422
580 Ga0496113_0403750
581 Ga0496114_0082627
582 Ga0496114_0206384
583 Ga0496114_0776616
584 Ga0496114_1005334
585 Ga0496114_1170932
586 Ga0496115_0003812
587 Ga0496115_0759789
588 Ga0496115_0818537
589 Ga0501043_0602145
590 Ga0501046_1130437
591 Ga0501067_0000306
592 Ga0501067_0069114
593 Ga0501067_0265098
594 Ga0501067_0393610
595 Ga0501069_0010204
596 Ga0501069_0160334
597 Ga0501069_0471383
598 Ga0501070_0033951
599 Ga0501070_0438971
600 Ga0501070_0607238
601 Ga0501074_1120461
602 Ga0501080_1736400
603 Ga0501035_0462931
604 Ga0466962_0000864
605 Ga0466962_0011148
606 Ga0466962_0593518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03992

ABM

Antibiotic biosynthesis monooxygenase

27

83

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.8509 2 99
7bio-assembly1.cif.gz_A crystal structure of monooxygenase rslo4 from streptomyces bottropensis 0.8268 1 100
3kng-assembly1.cif.gz_B crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, determined to 1.9 resolution 0.8153 2 99
3kg1-assembly3.cif.gz_A-2 crystal structure of snoab, a cofactor-independent oxygenase from streptomyces nogalater, mutant n63a 0.797 2 99
8ecp-assembly1.cif.gz_B r16a pa0709 with bme modifications 0.7778 1 98
ID Description Score Start End Superfamily
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8509 2 99 3.30.70.100
3kg1A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.797 2 99 3.30.70.100
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7437 1 99 3.30.70.100
af_P9WLA3_32_98_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7357 5 69 3.10.450.240
1iujA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7311 1 99 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A538JC12-F1-model_v4 ABM domain-containing protein 0.9966 2 100
AF-A0A538IK52-F1-model_v4 ABM domain-containing protein 0.9917 1 99
AF-A0A3A0ESU3-F1-model_v4 ABM domain-containing protein 0.9849 1 96
AF-A0A538IK52-F1-model_v4 ABM domain-containing protein 0.9819 1 99
AF-A0A850ADQ3-F1-model_v4 Antibiotic biosynthesis monooxygenase 0.98 1 96 GO:0004497

Map