F396728

General Info

Members Datasets Scaffolds Average Seq Length
302 161 604 228

Family's Representative Sequence

Representative Sequence 3300049592|Ga0501076_0159775|Ga0501076_0159775_63_869
Length 268
Sequence VLAAREVRKDFPMSGDAVHAVRGVSLEVRSGEYVAIVGPSGCGKSTLLHLLGGIDTPTAGTIWIDGARLDALHDRALTRLRLTRIGFVFQRFHLLPVLTALENVELPMAEAGVDRAERRGRALELLEYVGLTGRAGHRATQLSGGEMQRVAIARALANRPAVILADEPTGELDAATGRGILDLFRRLNLDGATLVVVTHDESLAAEAGRVVRMMDGRVVGDTASVQLSEGRDQGSGARARGRRPEDPASPRTNRCSPIPDPCPLTPDP

Samples

Sample ID Description Type Environment
1 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
70 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
71 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
78 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
79 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
80 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
81 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
82 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
83 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
84 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
90 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
91 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
92 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
93 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
94 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
95 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
96 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
97 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
98 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
101 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
123 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
127 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
128 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
129 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
130 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
131 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
132 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
133 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
134 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
137 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
138 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
139 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
140 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
141 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
142 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
143 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
144 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
157 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
158 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
159 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
161 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.58
Rhizosphere 86.42
Stem 0
Stem Tuber 0
Unclassified 1.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501076_0159775 3300049592 Bacteria 1836
2 MBSR1b_contig_9657664 2162886012 Bacteria 3923
3 Ga0070683_100051486 3300005329 Bacteria 3813
4 Ga0070677_10109962 3300005333 Bacteria 1229
5 Ga0070680_100194421 3300005336 Unclassified 1710
6 Ga0070680_100205206 3300005336 Bacteria 1662
7 Ga0070709_10118727 3300005434 Bacteria 1789
8 Ga0070709_10127158 3300005434 Bacteria 1735
9 Ga0070709_10139291 3300005434 Bacteria 1665
10 Ga0070714_100223073 3300005435 Bacteria 1733
11 Ga0070711_100000170 3300005439 Bacteria 34633
12 Ga0070694_100046865 3300005444 Bacteria 2904
13 Ga0070681_10005821 3300005458 Bacteria 11930
14 Ga0070681_10160050 3300005458 Bacteria 2175
15 Ga0068867_100402308 3300005459 Bacteria 1155
16 Ga0070685_10270407 3300005466 Bacteria 1134
17 Ga0070707_100002249 3300005468 Bacteria 18413
18 Ga0070699_100068580 3300005518 Bacteria 3080
19 Ga0070679_100110352 3300005530 Bacteria 2737
20 Ga0070684_100058394 3300005535 Bacteria 3372
21 Ga0070697_100197074 3300005536 Bacteria 1711
22 Ga0070672_100134548 3300005543 Bacteria 2035
23 Ga0070686_100085394 3300005544 Bacteria 2099
24 Ga0070695_100012854 3300005545 Bacteria 5024
25 Ga0070695_100031067 3300005545 Bacteria 3328
26 Ga0070696_100003230 3300005546 Bacteria 10855
27 Ga0070696_100452827 3300005546 Bacteria 1013
28 Ga0070693_100004085 3300005547 Bacteria 6872
29 Ga0070693_100500887 3300005547 Bacteria 862
30 Ga0070704_100003321 3300005549 Bacteria 9206
31 Ga0070704_100011639 3300005549 Bacteria 5400
32 Ga0068855_100619622 3300005563 Bacteria 1165
33 Ga0070664_100035522 3300005564 Bacteria 4184
34 Ga0070664_100869953 3300005564 Bacteria 844
35 Ga0068859_100034267 3300005617 Bacteria 5097
36 Ga0068859_101179456 3300005617 Bacteria 843
37 Ga0068862_100241080 3300005844 Bacteria 1644
38 Ga0081538_10039055 3300005981 Bacteria 3050
39 Ga0070712_100029283 3300006175 Bacteria 3690
40 Ga0075428_100058767 3300006844 Bacteria 4210
41 Ga0075428_101022899 3300006844 Bacteria 874
42 Ga0075430_100775565 3300006846 Bacteria 790
43 Ga0075431_100033954 3300006847 Bacteria 5258
44 Ga0075431_100110803 3300006847 Bacteria 2833
45 Ga0075433_10219208 3300006852 Bacteria 1690
46 Ga0075433_10294247 3300006852 Bacteria 1438
47 Ga0075434_100016978 3300006871 Bacteria 7003
48 Ga0075434_100162529 3300006871 Bacteria 2253
49 Ga0075434_100287819 3300006871 Bacteria 1663
50 Ga0075429_100000353 3300006880 Bacteria 33619
51 Ga0075429_100413808 3300006880 Bacteria 1181
52 Ga0075436_100004648 3300006914 Bacteria 9404
53 Ga0097620_100034267 3300006931 Bacteria 5097
54 Ga0097620_101179392 3300006931 Bacteria 843
55 Ga0114129_10007118 3300009147 Bacteria 15917
56 Ga0114129_10041557 3300009147 Bacteria 6478
57 Ga0114129_10067672 3300009147 Bacteria 4981
58 Ga0114129_10180375 3300009147 Bacteria 2874
59 Ga0114129_10238996 3300009147 Bacteria 2442
60 Ga0105248_10175608 3300009177 Unclassified 2414
61 Ga0105248_10838358 3300009177 Bacteria 1038
62 Ga0105249_10309044 3300009553 Bacteria 1588
63 Ga0105239_11161546 3300010375 Unclassified 889
64 Ga0157375_10293032 3300013308 Bacteria 1790
65 Ga0207682_10028128 3300025893 Bacteria 2243
66 Ga0207642_10029068 3300025899 Bacteria 2285
67 Ga0207699_10112140 3300025906 Bacteria 1750
68 Ga0207699_10119103 3300025906 Bacteria 1705
69 Ga0207684_10206089 3300025910 Bacteria 1696
70 Ga0207707_10015643 3300025912 Bacteria 6609
71 Ga0207707_10223001 3300025912 Bacteria 1641
72 Ga0207693_10036357 3300025915 Bacteria 3882
73 Ga0207663_10006722 3300025916 Bacteria 5912
74 Ga0207660_10000732 3300025917 Bacteria 21858
75 Ga0207660_10437195 3300025917 Bacteria 1057
76 Ga0207652_10085907 3300025921 Bacteria 2758
77 Ga0207652_10578459 3300025921 Bacteria 1008
78 Ga0207646_10184497 3300025922 Bacteria 1884
79 Ga0207646_10300543 3300025922 Bacteria 1450
80 Ga0207700_10215608 3300025928 Bacteria 1625
81 Ga0207706_10043637 3300025933 Bacteria 3973
82 Ga0207691_10476472 3300025940 Bacteria 1061
83 Ga0207711_10114284 3300025941 Unclassified 2404
84 Ga0207661_10417365 3300025944 Bacteria 1219
85 Ga0207679_10009747 3300025945 Bacteria 6162
86 Ga0207679_10112479 3300025945 Bacteria 2152
87 Ga0207640_10031908 3300025981 Bacteria 3262
88 Ga0207640_10459016 3300025981 Bacteria 1052
89 Ga0207678_10740756 3300026067 Bacteria 866
90 Ga0207708_10149513 3300026075 Bacteria 1837
91 Ga0207648_10192214 3300026089 Bacteria 1809
92 Ga0207676_10099246 3300026095 Bacteria 2410
93 Ga0207676_10589553 3300026095 Bacteria 1066
94 Ga0207675_100379414 3300026118 Unclassified 1390
95 Ga0268266_10329391 3300028379 Bacteria 1431
96 Ga0268265_10293903 3300028380 Bacteria 1460
97 Ga0307408_100009717 3300031548 Bacteria 6339
98 Ga0307408_100051913 3300031548 Bacteria 2956
99 Ga0307408_100354301 3300031548 Bacteria 1246
100 Ga0307408_100422990 3300031548 Bacteria 1149
101 Ga0307405_10032334 3300031731 Bacteria 3092
102 Ga0307405_10034401 3300031731 Bacteria 3015
103 Ga0307405_10074407 3300031731 Bacteria 2197
104 Ga0307405_10087868 3300031731 Bacteria 2050
105 Ga0307413_10009075 3300031824 Bacteria 4736
106 Ga0307413_10263358 3300031824 Bacteria 1286
107 Ga0307410_10001848 3300031852 Bacteria 9866
108 Ga0307410_10012372 3300031852 Bacteria 4932
109 Ga0307410_10204314 3300031852 Bacteria 1510
110 Ga0307410_10340675 3300031852 Bacteria 1195
111 Ga0307406_10035861 3300031901 Bacteria 3053
112 Ga0307406_10076676 3300031901 Bacteria 2209
113 Ga0307406_10079887 3300031901 Bacteria 2170
114 Ga0307406_10118624 3300031901 Bacteria 1835
115 Ga0307407_10069196 3300031903 Bacteria 2094
116 Ga0307407_10134984 3300031903 Bacteria 1584
117 Ga0307407_10252739 3300031903 Bacteria 1208
118 Ga0307412_10255048 3300031911 Bacteria 1364
119 Ga0307409_100004494 3300031995 Bacteria 7851
120 Ga0307409_100107552 3300031995 Bacteria 2330
121 Ga0307409_100153101 3300031995 Bacteria 2005
122 Ga0307409_100172205 3300031995 Bacteria 1906
123 Ga0307409_100391659 3300031995 Bacteria 1324
124 Ga0307409_100740457 3300031995 Bacteria 986
125 Ga0307416_100000228 3300032002 Bacteria 29891
126 Ga0307416_100003937 3300032002 Bacteria 8843
127 Ga0307416_100020231 3300032002 Bacteria 4743
128 Ga0307416_100069603 3300032002 Bacteria 2913
129 Ga0307416_100128440 3300032002 Bacteria 2275
130 Ga0307416_100152597 3300032002 Bacteria 2121
131 Ga0307416_100168419 3300032002 Bacteria 2036
132 Ga0307414_10058239 3300032004 Bacteria 2721
133 Ga0307414_10087021 3300032004 Bacteria 2307
134 Ga0307414_10181844 3300032004 Bacteria 1692
135 Ga0307414_10392360 3300032004 Bacteria 1203
136 Ga0307414_10618461 3300032004 Bacteria 973
137 Ga0307411_10011638 3300032005 Bacteria 4761
138 Ga0307411_10038842 3300032005 Bacteria 3007
139 Ga0307411_10094603 3300032005 Bacteria 2095
140 Ga0307411_10113495 3300032005 Bacteria 1944
141 Ga0307411_10115318 3300032005 Bacteria 1932
142 Ga0307415_100003295 3300032126 Bacteria 8202
143 Ga0307415_100023979 3300032126 Bacteria 3800
144 Ga0307415_100407366 3300032126 Bacteria 1163
145 Ga0307415_100680078 3300032126 Bacteria 926
146 Ga0373952_0072124 3300035092 Bacteria 865
147 Ga0373932_0047620 3300035112 Bacteria 1261
148 Ga0373941_0043325 3300035115 Bacteria 1401
149 Ga0373960_0050148 3300035121 Bacteria 1236
150 Ga0373961_0009279 3300035241 Bacteria 2405
151 Ga0373931_0082321 3300035691 Bacteria 1779
152 Ga0373931_0149705 3300035691 Bacteria 1359
153 Ga0395905_0034599 3300037471 Bacteria 4745
154 Ga0439433_0060624 3300041999 Bacteria 902
155 Ga0451577_0244315 3300042876 Bacteria 1625
156 Ga0496100_0216319 3300048903 Bacteria 1404
157 Ga0496101_0110218 3300048904 Bacteria 2071
158 Ga0496102_0021901 3300048905 Bacteria 5658
159 Ga0496102_0063352 3300048905 Bacteria 3385
160 Ga0496102_0155546 3300048905 Bacteria 2149
161 Ga0496102_0278878 3300048905 Bacteria 1575
162 Ga0496102_0788400 3300048905 Bacteria 873
163 Ga0496103_0002370 3300048906 Bacteria 11882
164 Ga0496104_0048776 3300048907 Bacteria 3992
165 Ga0496104_0063888 3300048907 Bacteria 3492
166 Ga0496104_0067759 3300048907 Bacteria 3391
167 Ga0496105_0162381 3300048908 Bacteria 1834
168 Ga0496106_0014458 3300048909 Bacteria 5832
169 Ga0496106_0061991 3300048909 Bacteria 2839
170 Ga0496106_0237767 3300048909 Bacteria 1455
171 Ga0496106_0353698 3300048909 Bacteria 1180
172 Ga0496107_0030481 3300048910 Bacteria 3844
173 Ga0496108_0007450 3300048911 Bacteria 8871
174 Ga0496108_0023111 3300048911 Bacteria 5113
175 Ga0496108_0028232 3300048911 Bacteria 4642
176 Ga0496108_0049457 3300048911 Bacteria 3516
177 Ga0496109_0003160 3300048912 Archaea 13731
178 Ga0496109_0004549 3300048912 Bacteria 11587
179 Ga0496109_0006268 3300048912 Bacteria 10006
180 Ga0496109_0138602 3300048912 Bacteria 2274
181 Ga0496110_0006135 3300048913 Bacteria 9477
182 Ga0496110_0019336 3300048913 Bacteria 5729
183 Ga0496110_0068395 3300048913 Bacteria 3143
184 Ga0496111_0006146 3300048914 Bacteria 7772
185 Ga0496111_0017771 3300048914 Bacteria 4918
186 Ga0496111_0017863 3300048914 Bacteria 4906
187 Ga0496111_0056089 3300048914 Bacteria 2850
188 Ga0496112_0001284 3300048915 Bacteria 19047
189 Ga0496112_0003112 3300048915 Bacteria 13600
190 Ga0496112_0006241 3300048915 Bacteria 10444
191 Ga0496112_0173921 3300048915 Bacteria 2118
192 Ga0496112_0231754 3300048915 Bacteria 1801
193 Ga0496113_0001972 3300048916 Bacteria 11756
194 Ga0496113_0004480 3300048916 Bacteria 8595
195 Ga0496113_0006305 3300048916 Bacteria 7502
196 Ga0496114_0098357 3300048917 Bacteria 2495
197 Ga0501296_001924 3300049519 Bacteria 2122
198 Ga0501031_0125675 3300049568 Bacteria 1676
199 Ga0501032_0104130 3300049569 Bacteria 1880
200 Ga0501032_0249244 3300049569 Bacteria 1153
201 Ga0501032_0486908 3300049569 Bacteria 789
202 Ga0501033_0062940 3300049570 Bacteria 2731
203 Ga0501033_0407206 3300049570 Bacteria 948
204 Ga0501034_0070704 3300049571 Bacteria 3501
205 Ga0501034_0535360 3300049571 Bacteria 1082
206 Ga0501036_0012453 3300049572 Bacteria 7050
207 Ga0501036_0076476 3300049572 Bacteria 2832
208 Ga0501036_0092286 3300049572 Bacteria 2558
209 Ga0501036_0431498 3300049572 Bacteria 1098
210 Ga0501037_0114312 3300049573 Bacteria 1943
211 Ga0501038_0135291 3300049574 Bacteria 2020
212 Ga0501038_0271122 3300049574 Bacteria 1338
213 Ga0501039_0075326 3300049575 Bacteria 2623
214 Ga0501039_0159512 3300049575 Bacteria 1773
215 Ga0501040_0013868 3300049576 Bacteria 5304
216 Ga0501040_0021889 3300049576 Bacteria 4275
217 Ga0501040_0150996 3300049576 Bacteria 1639
218 Ga0501040_0157230 3300049576 Bacteria 1605
219 Ga0501041_0004152 3300049577 Bacteria 8383
220 Ga0501042_0035399 3300049578 Bacteria 3542
221 Ga0501042_0130293 3300049578 Bacteria 1813
222 Ga0501043_0178693 3300049579 Bacteria 1654
223 Ga0501043_0299509 3300049579 Bacteria 1229
224 Ga0501046_0095790 3300049580 Bacteria 2280
225 Ga0501047_0021865 3300049581 Bacteria 6142
226 Ga0501047_0055033 3300049581 Bacteria 3848
227 Ga0501048_0035487 3300049582 Bacteria 3590
228 Ga0501048_0141394 3300049582 Bacteria 1702
229 Ga0501068_0157082 3300049584 Bacteria 1432
230 Ga0501068_0489084 3300049584 Bacteria 798
231 Ga0501070_0053787 3300049586 Bacteria 3339
232 Ga0501070_0370082 3300049586 Bacteria 1162
233 Ga0501071_0013059 3300049587 Bacteria 5653
234 Ga0501071_0287722 3300049587 Bacteria 1244
235 Ga0501072_0106948 3300049588 Bacteria 2225
236 Ga0501074_0013649 3300049590 Bacteria 5905
237 Ga0501074_0022310 3300049590 Bacteria 4599
238 Ga0501075_0008222 3300049591 Bacteria 7268
239 Ga0501075_0010109 3300049591 Bacteria 6621
240 Ga0501075_0129304 3300049591 Bacteria 1924
241 Ga0501076_0033620 3300049592 Bacteria 4004
242 Ga0501076_0036692 3300049592 Bacteria 3841
243 Ga0501076_0373660 3300049592 Bacteria 1171
244 Ga0501077_0000310 3300049593 Bacteria 28987
245 Ga0501077_0067156 3300049593 Bacteria 2274
246 Ga0501199_000878 3300049650 Bacteria 2664
247 Ga0501202_001508 3300049652 Bacteria 3743
248 Ga0501214_001575 3300049659 Bacteria 1800
249 Ga0501216_003926 3300049660 Bacteria 2188
250 Ga0501235_011940 3300049669 Bacteria 1909
251 Ga0501239_002484 3300049672 Bacteria 1677
252 Ga0501247_001778 3300049677 Bacteria 2153
253 Ga0501252_002528 3300049682 Bacteria 1823
254 Ga0501225_0021754 3300049705 Bacteria 1771
255 Ga0501079_0022475 3300049741 Bacteria 4836
256 Ga0501079_0065040 3300049741 Bacteria 2813
257 Ga0501079_0082703 3300049741 Bacteria 2483
258 Ga0501079_0286671 3300049741 Bacteria 1287
259 Ga0501080_0063722 3300049742 Bacteria 3430
260 Ga0501080_0263104 3300049742 Bacteria 1571
261 Ga0501081_0012077 3300049743 Bacteria 5660
262 Ga0501081_0019990 3300049743 Bacteria 4463
263 Ga0501081_0085258 3300049743 Bacteria 2217
264 Ga0501083_0202272 3300049744 Bacteria 1295
265 Ga0501083_0336100 3300049744 Bacteria 982
266 Ga0501263_000123 3300049760 Bacteria 4244
267 Ga0501264_004960 3300049761 Bacteria 1206
268 Ga0501266_006145 3300049763 Bacteria 1494
269 Ga0501268_000202 3300049765 Bacteria 5732
270 Ga0501273_000300 3300049770 Bacteria 3840
271 Ga0501035_0051452 3300049822 Bacteria 3688
272 Ga0501044_0042807 3300049823 Bacteria 4708
273 Ga0501044_0114818 3300049823 Bacteria 2698
274 Ga0501045_0044344 3300049824 Bacteria 3239
275 Ga0501045_0068880 3300049824 Bacteria 2600
276 Ga0501045_0190288 3300049824 Bacteria 1530
277 Ga0501212_019028 3300049851 Bacteria 1050
278 nmdc:mga05p37_51622_c1 3300050507 Bacteria 5056
279 nmdc:mga05p37_858197_c1 3300050507 Bacteria 985
280 nmdc:mga09592_1418_c1 3300050508 Bacteria 19224
281 nmdc:mga0qj67_244904_c1 3300050509 Bacteria 1454
282 nmdc:mga0qj67_814030_c1 3300050509 Bacteria 739
283 nmdc:mga06r32_103452_c1 3300050510 Bacteria 2796
284 nmdc:mga08y16_585038_c1 3300050511 Bacteria 1126
285 nmdc:mga0n895_252412_c1 3300050512 Bacteria 1790
286 nmdc:mga0n895_513190_c1 3300050512 Bacteria 1207
287 nmdc:mga0rr50_224604_c1 3300050513 Bacteria 1552
288 nmdc:mga0a205_123375_c1 3300050515 Bacteria 2490
289 nmdc:mga0a205_314307_c1 3300050515 Bacteria 1438
290 nmdc:mga0a205_41534_c2 3300050515 Bacteria 3277
291 Ga0501084_0007144 3300054114 Bacteria 9199
292 Ga0501084_0012565 3300054114 Bacteria 7015
293 Ga0501084_0038984 3300054114 Bacteria 3974
294 Ga0590071_002346 3300059421 Bacteria 4780
295 Ga0590071_007444 3300059421 Bacteria 2588
296 Ga0590074_007932 3300059423 Bacteria 1770
297 Ga0590074_008144 3300059423 Bacteria 1746
298 Ga0590077_021503 3300059426 Bacteria 1374
299 Ga0501082_0002743 3300060353 Bacteria 15385
300 Ga0501082_0043037 3300060353 Bacteria 3893
301 Ga0501082_0125785 3300060353 Bacteria 2223
302 Ga0530510_0162213 3300061734 Bacteria 1654
303 Ga0501076_0159775
304 MBSR1b_contig_9657664
305 Ga0070683_100051486
306 Ga0070677_10109962
307 Ga0070680_100194421
308 Ga0070680_100205206
309 Ga0070709_10118727
310 Ga0070709_10127158
311 Ga0070709_10139291
312 Ga0070714_100223073
313 Ga0070711_100000170
314 Ga0070694_100046865
315 Ga0070681_10005821
316 Ga0070681_10160050
317 Ga0068867_100402308
318 Ga0070685_10270407
319 Ga0070707_100002249
320 Ga0070699_100068580
321 Ga0070679_100110352
322 Ga0070684_100058394
323 Ga0070697_100197074
324 Ga0070672_100134548
325 Ga0070686_100085394
326 Ga0070695_100012854
327 Ga0070695_100031067
328 Ga0070696_100003230
329 Ga0070696_100452827
330 Ga0070693_100004085
331 Ga0070693_100500887
332 Ga0070704_100003321
333 Ga0070704_100011639
334 Ga0068855_100619622
335 Ga0070664_100035522
336 Ga0070664_100869953
337 Ga0068859_100034267
338 Ga0068859_101179456
339 Ga0068862_100241080
340 Ga0081538_10039055
341 Ga0070712_100029283
342 Ga0075428_100058767
343 Ga0075428_101022899
344 Ga0075430_100775565
345 Ga0075431_100033954
346 Ga0075431_100110803
347 Ga0075433_10219208
348 Ga0075433_10294247
349 Ga0075434_100016978
350 Ga0075434_100162529
351 Ga0075434_100287819
352 Ga0075429_100000353
353 Ga0075429_100413808
354 Ga0075436_100004648
355 Ga0097620_100034267
356 Ga0097620_101179392
357 Ga0114129_10007118
358 Ga0114129_10041557
359 Ga0114129_10067672
360 Ga0114129_10180375
361 Ga0114129_10238996
362 Ga0105248_10175608
363 Ga0105248_10838358
364 Ga0105249_10309044
365 Ga0105239_11161546
366 Ga0157375_10293032
367 Ga0207682_10028128
368 Ga0207642_10029068
369 Ga0207699_10112140
370 Ga0207699_10119103
371 Ga0207684_10206089
372 Ga0207707_10015643
373 Ga0207707_10223001
374 Ga0207693_10036357
375 Ga0207663_10006722
376 Ga0207660_10000732
377 Ga0207660_10437195
378 Ga0207652_10085907
379 Ga0207652_10578459
380 Ga0207646_10184497
381 Ga0207646_10300543
382 Ga0207700_10215608
383 Ga0207706_10043637
384 Ga0207691_10476472
385 Ga0207711_10114284
386 Ga0207661_10417365
387 Ga0207679_10009747
388 Ga0207679_10112479
389 Ga0207640_10031908
390 Ga0207640_10459016
391 Ga0207678_10740756
392 Ga0207708_10149513
393 Ga0207648_10192214
394 Ga0207676_10099246
395 Ga0207676_10589553
396 Ga0207675_100379414
397 Ga0268266_10329391
398 Ga0268265_10293903
399 Ga0307408_100009717
400 Ga0307408_100051913
401 Ga0307408_100354301
402 Ga0307408_100422990
403 Ga0307405_10032334
404 Ga0307405_10034401
405 Ga0307405_10074407
406 Ga0307405_10087868
407 Ga0307413_10009075
408 Ga0307413_10263358
409 Ga0307410_10001848
410 Ga0307410_10012372
411 Ga0307410_10204314
412 Ga0307410_10340675
413 Ga0307406_10035861
414 Ga0307406_10076676
415 Ga0307406_10079887
416 Ga0307406_10118624
417 Ga0307407_10069196
418 Ga0307407_10134984
419 Ga0307407_10252739
420 Ga0307412_10255048
421 Ga0307409_100004494
422 Ga0307409_100107552
423 Ga0307409_100153101
424 Ga0307409_100172205
425 Ga0307409_100391659
426 Ga0307409_100740457
427 Ga0307416_100000228
428 Ga0307416_100003937
429 Ga0307416_100020231
430 Ga0307416_100069603
431 Ga0307416_100128440
432 Ga0307416_100152597
433 Ga0307416_100168419
434 Ga0307414_10058239
435 Ga0307414_10087021
436 Ga0307414_10181844
437 Ga0307414_10392360
438 Ga0307414_10618461
439 Ga0307411_10011638
440 Ga0307411_10038842
441 Ga0307411_10094603
442 Ga0307411_10113495
443 Ga0307411_10115318
444 Ga0307415_100003295
445 Ga0307415_100023979
446 Ga0307415_100407366
447 Ga0307415_100680078
448 Ga0373952_0072124
449 Ga0373932_0047620
450 Ga0373941_0043325
451 Ga0373960_0050148
452 Ga0373961_0009279
453 Ga0373931_0082321
454 Ga0373931_0149705
455 Ga0395905_0034599
456 Ga0439433_0060624
457 Ga0451577_0244315
458 Ga0496100_0216319
459 Ga0496101_0110218
460 Ga0496102_0021901
461 Ga0496102_0063352
462 Ga0496102_0155546
463 Ga0496102_0278878
464 Ga0496102_0788400
465 Ga0496103_0002370
466 Ga0496104_0048776
467 Ga0496104_0063888
468 Ga0496104_0067759
469 Ga0496105_0162381
470 Ga0496106_0014458
471 Ga0496106_0061991
472 Ga0496106_0237767
473 Ga0496106_0353698
474 Ga0496107_0030481
475 Ga0496108_0007450
476 Ga0496108_0023111
477 Ga0496108_0028232
478 Ga0496108_0049457
479 Ga0496109_0003160
480 Ga0496109_0004549
481 Ga0496109_0006268
482 Ga0496109_0138602
483 Ga0496110_0006135
484 Ga0496110_0019336
485 Ga0496110_0068395
486 Ga0496111_0006146
487 Ga0496111_0017771
488 Ga0496111_0017863
489 Ga0496111_0056089
490 Ga0496112_0001284
491 Ga0496112_0003112
492 Ga0496112_0006241
493 Ga0496112_0173921
494 Ga0496112_0231754
495 Ga0496113_0001972
496 Ga0496113_0004480
497 Ga0496113_0006305
498 Ga0496114_0098357
499 Ga0501296_001924
500 Ga0501031_0125675
501 Ga0501032_0104130
502 Ga0501032_0249244
503 Ga0501032_0486908
504 Ga0501033_0062940
505 Ga0501033_0407206
506 Ga0501034_0070704
507 Ga0501034_0535360
508 Ga0501036_0012453
509 Ga0501036_0076476
510 Ga0501036_0092286
511 Ga0501036_0431498
512 Ga0501037_0114312
513 Ga0501038_0135291
514 Ga0501038_0271122
515 Ga0501039_0075326
516 Ga0501039_0159512
517 Ga0501040_0013868
518 Ga0501040_0021889
519 Ga0501040_0150996
520 Ga0501040_0157230
521 Ga0501041_0004152
522 Ga0501042_0035399
523 Ga0501042_0130293
524 Ga0501043_0178693
525 Ga0501043_0299509
526 Ga0501046_0095790
527 Ga0501047_0021865
528 Ga0501047_0055033
529 Ga0501048_0035487
530 Ga0501048_0141394
531 Ga0501068_0157082
532 Ga0501068_0489084
533 Ga0501070_0053787
534 Ga0501070_0370082
535 Ga0501071_0013059
536 Ga0501071_0287722
537 Ga0501072_0106948
538 Ga0501074_0013649
539 Ga0501074_0022310
540 Ga0501075_0008222
541 Ga0501075_0010109
542 Ga0501075_0129304
543 Ga0501076_0033620
544 Ga0501076_0036692
545 Ga0501076_0373660
546 Ga0501077_0000310
547 Ga0501077_0067156
548 Ga0501199_000878
549 Ga0501202_001508
550 Ga0501214_001575
551 Ga0501216_003926
552 Ga0501235_011940
553 Ga0501239_002484
554 Ga0501247_001778
555 Ga0501252_002528
556 Ga0501225_0021754
557 Ga0501079_0022475
558 Ga0501079_0065040
559 Ga0501079_0082703
560 Ga0501079_0286671
561 Ga0501080_0063722
562 Ga0501080_0263104
563 Ga0501081_0012077
564 Ga0501081_0019990
565 Ga0501081_0085258
566 Ga0501083_0202272
567 Ga0501083_0336100
568 Ga0501263_000123
569 Ga0501264_004960
570 Ga0501266_006145
571 Ga0501268_000202
572 Ga0501273_000300
573 Ga0501035_0051452
574 Ga0501044_0042807
575 Ga0501044_0114818
576 Ga0501045_0044344
577 Ga0501045_0068880
578 Ga0501045_0190288
579 Ga0501212_019028
580 nmdc:mga05p37_51622_c1
581 nmdc:mga05p37_858197_c1
582 nmdc:mga09592_1418_c1
583 nmdc:mga0qj67_244904_c1
584 nmdc:mga0qj67_814030_c1
585 nmdc:mga06r32_103452_c1
586 nmdc:mga08y16_585038_c1
587 nmdc:mga0n895_252412_c1
588 nmdc:mga0n895_513190_c1
589 nmdc:mga0rr50_224604_c1
590 nmdc:mga0a205_123375_c1
591 nmdc:mga0a205_314307_c1
592 nmdc:mga0a205_41534_c2
593 Ga0501084_0007144
594 Ga0501084_0012565
595 Ga0501084_0038984
596 Ga0590071_002346
597 Ga0590071_007444
598 Ga0590074_007932
599 Ga0590074_008144
600 Ga0590077_021503
601 Ga0501082_0002743
602 Ga0501082_0043037
603 Ga0501082_0125785
604 Ga0530510_0162213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9568 3 213
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9491 1 213
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9472 4 212
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9433 1 215
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.943 4 213
ID Description Score Start End Superfamily
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9668 22 212 3.40.50.300
af_Q2FUZ1_1_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.963 3 214 3.40.50.300
af_P9WQK5_1_219_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9569 4 204 3.40.50.300
af_Q2FZR0_1_324_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9545 1 211 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9533 3 212 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A4Q6CE20-F1-model_v4 deleted 0.9795 83 212
AF-A0A0D7KEI4-F1-model_v4 ABC transporter domain-containing protein 0.9748 94 208 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2V5X8W1-F1-model_v4 ABC transporter 0.9746 2 212 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A436W3Z4-F1-model_v4 ABC transporter ATP-binding protein 0.9733 90 212 GO:0005524
GO:0016887
GO:0022857
GO:0043190
AF-A0A7H4ZMJ9-F1-model_v4 deleted 0.9709 2 212

Map