F396705

General Info

Members Datasets Scaffolds Average Seq Length
302 228 604 420

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0015054|Ga0496121_0015054_3041_4501
Length 486
Sequence LRVVRAYSRSRRGYFALHRLVNHRCGDNTARILLIDFVFIAQLNVTKQTCGSEVRSMTEASVLSAPVAHSTDKSHKAIWAASIGNLLEWYDFGVYAYLASLIATKFFPGNDPTASLLAAFAAYGVGFLARPLGGIVIGRLGDVKGRKAALVLTIFLMALGTIGLGLVPSYDSIGIWAPTLLVLLRILQGVAAGGEWGTSTAFMIEWSPPDRRGFFGSFQQVSTAGGSLLGSAVAATLTSSLSGQAMLDWGWRVPFLLGAILLVVGIYLRQNVEETPSYEASKRAVAEQPVVAGAPLGLLAFGFTIFWTVAYYTLLAWMPSFTQRFAGLSPSQSLWSNTIGLVAMIIAVPLWGALSDRIGRRPLLMASAISIGLLSWPLFTLMSKSGGLALVVPIQIVFGILLALYSGAGPAAISEIFPTHLRSTWMSTGYSLAVAIFGGFAPFIATWLIQVTGSPVAPTYLYLLPSAVISLAVIWRLNETSGRQLG

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
178 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
208 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
212 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
213 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
217 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
218 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
219 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
220 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
221 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
222 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
225 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
226 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
227 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
228 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0
Isolates 1.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.27
Nodule 0.66
Rhizoplane 2.32
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0015054 3300048924 Bacteria 8140
2 CNAas_1002052 3300000532 Bacteria 1512
3 Ga0065715_10122661 3300005293 Bacteria 2199
4 Ga0070676_10025384 3300005328 Bacteria 3349
5 Ga0070683_100050245 3300005329 Bacteria 3859
6 Ga0070683_100209457 3300005329 Bacteria 1852
7 Ga0070677_10056497 3300005333 Bacteria 1606
8 Ga0068869_100017339 3300005334 Bacteria 4879
9 Ga0068869_100036958 3300005334 Bacteria 3470
10 Ga0070666_10075547 3300005335 Bacteria 2297
11 Ga0070680_100070860 3300005336 Bacteria 2864
12 Ga0070680_100108945 3300005336 Bacteria 2304
13 Ga0068868_100157484 3300005338 Bacteria 1874
14 Ga0070660_100022805 3300005339 Bacteria 4635
15 Ga0070689_100004068 3300005340 Bacteria 9845
16 Ga0070689_100200186 3300005340 Bacteria 1630
17 Ga0070687_100020571 3300005343 Bacteria 3087
18 Ga0070661_100194285 3300005344 Bacteria 1549
19 Ga0070668_100016520 3300005347 Bacteria 5519
20 Ga0070671_100074562 3300005355 Bacteria 2835
21 Ga0070671_100120135 3300005355 Bacteria 2211
22 Ga0070674_100075192 3300005356 Bacteria 2398
23 Ga0070659_100202902 3300005366 Bacteria 1633
24 Ga0070667_100159224 3300005367 Bacteria 1987
25 Ga0070709_10005722 3300005434 Bacteria 6745
26 Ga0070709_10006456 3300005434 Bacteria 6395
27 Ga0070709_10163739 3300005434 Bacteria 1549
28 Ga0070714_100078270 3300005435 Bacteria 2873
29 Ga0070713_100008584 3300005436 Bacteria 7255
30 Ga0070713_100041848 3300005436 Bacteria 3735
31 Ga0070713_100049204 3300005436 Bacteria 3476
32 Ga0070701_10005136 3300005438 Bacteria 5376
33 Ga0070700_100001421 3300005441 Bacteria 11910
34 Ga0070700_100097321 3300005441 Bacteria 1932
35 Ga0070700_100121942 3300005441 Bacteria 1748
36 Ga0070694_100124358 3300005444 Bacteria 1855
37 Ga0070678_100004309 3300005456 Bacteria 8046
38 Ga0070681_10060585 3300005458 Bacteria 3761
39 Ga0070685_10084495 3300005466 Bacteria 1910
40 Ga0070698_100001015 3300005471 Bacteria 30868
41 Ga0070698_100104813 3300005471 Bacteria 2797
42 Ga0070679_100002873 3300005530 Bacteria 15663
43 Ga0070679_100026065 3300005530 Bacteria 5739
44 Ga0070679_100111633 3300005530 Bacteria 2720
45 Ga0070679_100127389 3300005530 Bacteria 2528
46 Ga0070684_100004894 3300005535 Bacteria 10227
47 Ga0070684_100034444 3300005535 Bacteria 4330
48 Ga0068853_100117150 3300005539 Bacteria 2372
49 Ga0070686_100001332 3300005544 Bacteria 13971
50 Ga0070695_100021754 3300005545 Bacteria 3929
51 Ga0070696_100038991 3300005546 Bacteria 3280
52 Ga0070665_100190439 3300005548 Bacteria 2052
53 Ga0068855_100244724 3300005563 Bacteria 2002
54 Ga0068855_100306555 3300005563 Bacteria 1758
55 Ga0068857_100007213 3300005577 Bacteria 9571
56 Ga0068854_100030817 3300005578 Bacteria 3723
57 Ga0068856_100070636 3300005614 Bacteria 3454
58 Ga0070702_100004308 3300005615 Bacteria 6487
59 Ga0070702_100026642 3300005615 Bacteria 3109
60 Ga0068852_100149927 3300005616 Bacteria 2168
61 Ga0068859_100079380 3300005617 Bacteria 3322
62 Ga0068859_100316799 3300005617 Bacteria 1653
63 Ga0068866_10006807 3300005718 Bacteria 4772
64 Ga0068861_100003015 3300005719 Bacteria 11117
65 Ga0068861_100012566 3300005719 Bacteria 5907
66 Ga0068851_10033390 3300005834 Bacteria 2564
67 Ga0068870_10016724 3300005840 Bacteria 3512
68 Ga0068863_100088062 3300005841 Bacteria 2942
69 Ga0068858_100014800 3300005842 Bacteria 7339
70 Ga0068858_100047084 3300005842 Bacteria 3999
71 Ga0068860_100017570 3300005843 Bacteria 6968
72 Ga0068860_100019707 3300005843 Bacteria 6540
73 Ga0068862_100015657 3300005844 Bacteria 6300
74 Ga0081455_10000156 3300005937 Bacteria 82406
75 Ga0081539_10002346 3300005985 Bacteria 27215
76 Ga0081539_10003829 3300005985 Bacteria 17671
77 Ga0070717_10001213 3300006028 Bacteria 17487
78 Ga0070717_10029087 3300006028 Bacteria 4430
79 Ga0075364_10002559 3300006051 Bacteria 10189
80 Ga0070712_100008646 3300006175 Bacteria 6412
81 Ga0075362_10033146 3300006177 Bacteria 2245
82 Ga0075369_10010840 3300006186 Bacteria 3572
83 Ga0097621_100003599 3300006237 Bacteria 10707
84 Ga0075370_10139376 3300006353 Bacteria 1417
85 Ga0068871_100130833 3300006358 Bacteria 2128
86 Ga0068871_100142479 3300006358 Bacteria 2039
87 Ga0075428_100043750 3300006844 Bacteria 4923
88 Ga0075428_100070893 3300006844 Bacteria 3809
89 Ga0075428_100162592 3300006844 Bacteria 2423
90 Ga0075430_100048708 3300006846 Bacteria 3578
91 Ga0075431_100114837 3300006847 Bacteria 2779
92 Ga0075434_100009856 3300006871 Bacteria 8936
93 Ga0075429_100037136 3300006880 Bacteria 4240
94 Ga0068865_100055413 3300006881 Bacteria 2758
95 Ga0097620_100079383 3300006931 Bacteria 3322
96 Ga0097620_100316813 3300006931 Bacteria 1653
97 Ga0075435_100018932 3300007076 Bacteria 5247
98 Ga0099794_10046512 3300007265 Bacteria 2078
99 Ga0105250_10004616 3300009092 Bacteria 6303
100 Ga0105240_10213248 3300009093 Bacteria 2255
101 Ga0111539_10000510 3300009094 Bacteria 49338
102 Ga0105245_10057587 3300009098 Bacteria 3496
103 Ga0105245_10222225 3300009098 Bacteria 1823
104 Ga0105247_10019196 3300009101 Bacteria 4104
105 Ga0105247_10102673 3300009101 Bacteria 1830
106 Ga0114129_10415654 3300009147 Bacteria 1770
107 Ga0105243_10006561 3300009148 Bacteria 8987
108 Ga0105241_10024409 3300009174 Bacteria 4489
109 Ga0105241_10111938 3300009174 Bacteria 2186
110 Ga0105241_10178393 3300009174 Bacteria 1760
111 Ga0105242_10018513 3300009176 Bacteria 5446
112 Ga0105248_10068505 3300009177 Bacteria 3984
113 Ga0105237_10029467 3300009545 Bacteria 5580
114 Ga0105238_10015056 3300009551 Bacteria 7833
115 Ga0105238_10069153 3300009551 Bacteria 3531
116 Ga0105238_10080560 3300009551 Bacteria 3245
117 Ga0105249_10036762 3300009553 Bacteria 4443
118 Ga0105249_10072462 3300009553 Bacteria 3184
119 Ga0105239_10095041 3300010375 Bacteria 3293
120 Ga0157373_10034588 3300013100 Bacteria 3629
121 Ga0157370_10312602 3300013104 Bacteria 1450
122 Ga0157369_10017915 3300013105 Bacteria 7950
123 Ga0157369_10192386 3300013105 Bacteria 2143
124 Ga0157374_10135072 3300013296 Bacteria 2390
125 Ga0157378_10006442 3300013297 Bacteria 10263
126 Ga0157378_10056062 3300013297 Bacteria 3511
127 Ga0157378_10238188 3300013297 Bacteria 1737
128 Ga0163162_10064660 3300013306 Bacteria 3703
129 Ga0163162_10135292 3300013306 Bacteria 2575
130 Ga0163162_10516180 3300013306 Bacteria 1325
131 Ga0157372_10278709 3300013307 Bacteria 1944
132 Ga0157375_10135469 3300013308 Bacteria 2586
133 Ga0157380_10065165 3300014326 Bacteria 2927
134 Ga0157380_10186034 3300014326 Bacteria 1829
135 Ga0213875_10000089 3300021388 Bacteria 105772
136 Ga0209677_103963 3300025253 Bacteria 4493
137 Ga0209233_1008433 3300025261 Bacteria 3193
138 Ga0209455_1004846 3300025272 Bacteria 4291
139 Ga0209758_1003296 3300025297 Bacteria 14947
140 Ga0207656_10066958 3300025321 Bacteria 1588
141 Ga0207696_1026089 3300025711 Bacteria 1812
142 Ga0207682_10002480 3300025893 Bacteria 8262
143 Ga0207642_10001838 3300025899 Bacteria 6548
144 Ga0207710_10029896 3300025900 Bacteria 2374
145 Ga0207688_10069979 3300025901 Bacteria 1989
146 Ga0207680_10131105 3300025903 Bacteria 1652
147 Ga0207699_10011682 3300025906 Bacteria 4444
148 Ga0207699_10116609 3300025906 Bacteria 1720
149 Ga0207645_10048218 3300025907 Bacteria 2720
150 Ga0207645_10127214 3300025907 Bacteria 1657
151 Ga0207643_10013730 3300025908 Bacteria 4392
152 Ga0207643_10052730 3300025908 Bacteria 2310
153 Ga0207707_10013204 3300025912 Bacteria 7199
154 Ga0207707_10018930 3300025912 Bacteria 6003
155 Ga0207707_10139459 3300025912 Bacteria 2120
156 Ga0207693_10024763 3300025915 Bacteria 4760
157 Ga0207693_10146281 3300025915 Bacteria 1858
158 Ga0207660_10001745 3300025917 Bacteria 14574
159 Ga0207660_10008485 3300025917 Bacteria 6646
160 Ga0207657_10014879 3300025919 Bacteria 7569
161 Ga0207657_10046084 3300025919 Bacteria 3820
162 Ga0207649_10060302 3300025920 Bacteria 2384
163 Ga0207652_10005265 3300025921 Bacteria 10502
164 Ga0207652_10133190 3300025921 Bacteria 2218
165 Ga0207694_10009134 3300025924 Bacteria 7483
166 Ga0207694_10012022 3300025924 Bacteria 6526
167 Ga0207659_10050552 3300025926 Bacteria 2954
168 Ga0207687_10029437 3300025927 Bacteria 3695
169 Ga0207687_10140640 3300025927 Bacteria 1831
170 Ga0207700_10018895 3300025928 Bacteria 4644
171 Ga0207700_10112973 3300025928 Bacteria 2189
172 Ga0207664_10093099 3300025929 Bacteria 2475
173 Ga0207644_10108363 3300025931 Bacteria 2097
174 Ga0207690_10138717 3300025932 Bacteria 1789
175 Ga0207706_10016650 3300025933 Bacteria 6634
176 Ga0207686_10001649 3300025934 Bacteria 12461
177 Ga0207709_10010206 3300025935 Bacteria 5173
178 Ga0207670_10004949 3300025936 Bacteria 7250
179 Ga0207670_10066630 3300025936 Bacteria 2474
180 Ga0207669_10038263 3300025937 Bacteria 2760
181 Ga0207704_10012012 3300025938 Bacteria 4285
182 Ga0207691_10145949 3300025940 Bacteria 2083
183 Ga0207711_10048363 3300025941 Bacteria 3639
184 Ga0207689_10002710 3300025942 Bacteria 16380
185 Ga0207689_10008638 3300025942 Bacteria 8870
186 Ga0207689_10074817 3300025942 Bacteria 2783
187 Ga0207661_10005259 3300025944 Bacteria 9105
188 Ga0207661_10048838 3300025944 Bacteria 3365
189 Ga0207679_10088543 3300025945 Bacteria 2387
190 Ga0207667_10020883 3300025949 Bacteria 7268
191 Ga0207667_10164624 3300025949 Bacteria 2280
192 Ga0207712_10021463 3300025961 Bacteria 4240
193 Ga0207668_10016102 3300025972 Bacteria 4659
194 Ga0207640_10058999 3300025981 Bacteria 2531
195 Ga0207703_10012136 3300026035 Bacteria 6714
196 Ga0207639_10185080 3300026041 Bacteria 1775
197 Ga0207708_10003997 3300026075 Bacteria 10851
198 Ga0207708_10040121 3300026075 Bacteria 3568
199 Ga0207641_10227078 3300026088 Bacteria 1734
200 Ga0207648_10000461 3300026089 Bacteria 45235
201 Ga0207674_10002366 3300026116 Bacteria 23835
202 Ga0207675_100001140 3300026118 Bacteria 26326
203 Ga0207675_100003585 3300026118 Bacteria 15134
204 Ga0207683_10007001 3300026121 Bacteria 9670
205 Ga0207683_10009672 3300026121 Bacteria 8218
206 Ga0209588_1003938 3300027671 Bacteria 4153
207 Ga0207428_10010418 3300027907 Bacteria 8304
208 Ga0268266_10051127 3300028379 Bacteria 3547
209 Ga0268265_10030806 3300028380 Bacteria 3867
210 Ga0268265_10107434 3300028380 Bacteria 2269
211 Ga0268264_10027979 3300028381 Bacteria 4609
212 Ga0265320_10012245 3300031240 Bacteria 5003
213 Ga0265340_10036855 3300031247 Bacteria 2422
214 Ga0265339_10017324 3300031249 Bacteria 4270
215 Ga0265331_10042836 3300031250 Bacteria 2194
216 Ga0265316_10042952 3300031344 Bacteria 3608
217 Ga0265313_10006285 3300031595 Bacteria 8461
218 Ga0307508_10000090 3300031616 Bacteria 106893
219 Ga0265314_10082797 3300031711 Bacteria 2110
220 Ga0265342_10010898 3300031712 Bacteria 6252
221 Ga0307510_10000001 3300033180 Bacteria 1172244
222 Ga0373931_0001653 3300035691 Bacteria 9645
223 Ga0373937_0093489 3300036401 Bacteria 2788
224 Ga0316584_0002713 3300036712 Bacteria 11313
225 Ga0395900_0013539 3300037418 Bacteria 8332
226 Ga0395900_0019893 3300037418 Bacteria 6843
227 Ga0395900_0179086 3300037418 Bacteria 2155
228 Ga0395898_0000744 3300037466 Bacteria 56861
229 Ga0395898_0024424 3300037466 Bacteria 6096
230 Ga0436364_0019427 3300037853 Bacteria 2104
231 Ga0436364_1385267 3300037853 Bacteria 30479
232 Ga0395901_0026045 3300038443 Bacteria 6005
233 Ga0436365_1830264 3300039437 Bacteria 6522
234 Ga0436360_0646777 3300039438 Bacteria 2764
235 Ga0436361_0412437 3300039447 Bacteria 15631
236 Ga0436361_0799281 3300039447 Bacteria 1633
237 Ga0436363_0856319 3300039450 Bacteria 9045
238 Ga0466963_0021957 3300044694 Bacteria 4035
239 Ga0466967_0058239 3300045976 Bacteria 3414
240 Ga0466967_0199638 3300045976 Bacteria 1894
241 Ga0495638_0032385 3300046460 Bacteria 3351
242 Ga0495664_0118617 3300046477 Bacteria 1600
243 Ga0495607_0000082 3300046501 Bacteria 96822
244 Ga0495610_0035735 3300046512 Bacteria 2547
245 Ga0495632_0007636 3300046519 Bacteria 6760
246 Ga0495637_0061202 3300046520 Bacteria 1544
247 Ga0495643_0039367 3300046522 Bacteria 2586
248 Ga0495648_0036875 3300046524 Bacteria 3147
249 Ga0495609_0053108 3300046538 Bacteria 1802
250 Ga0495621_0037702 3300046539 Bacteria 1682
251 Ga0495656_0050345 3300046615 Bacteria 1778
252 Ga0495668_0007207 3300046616 Bacteria 7144
253 Ga0495670_0085630 3300046691 Bacteria 1609
254 Ga0495626_0022196 3300048091 Bacteria 3137
255 Ga0496101_0105138 3300048904 Bacteria 2118
256 Ga0496102_0022138 3300048905 Bacteria 5631
257 Ga0496102_0070873 3300048905 Bacteria 3201
258 Ga0496106_0133992 3300048909 Bacteria 1944
259 Ga0496110_0017027 3300048913 Bacteria 6076
260 Ga0496113_0019130 3300048916 Bacteria 4785
261 Ga0496115_0119132 3300048918 Bacteria 2171
262 Ga0496116_0113030 3300048919 Bacteria 1590
263 Ga0496119_0001412 3300048922 Bacteria 29074
264 Ga0496119_0004278 3300048922 Bacteria 14298
265 Ga0496121_0057769 3300048924 Bacteria 3213
266 Ga0496126_0007228 3300048929 Bacteria 12214
267 Ga0495682_0000254 3300049460 Bacteria 42240
268 Ga0501034_0003652 3300049571 Bacteria 17412
269 Ga0501034_0003885 3300049571 Bacteria 16815
270 Ga0501076_0054908 3300049592 Bacteria 3158
271 Ga0501076_0279823 3300049592 Bacteria 1367
272 Ga0501083_0084301 3300049744 Bacteria 2104
273 Ga0501044_0032306 3300049823 Bacteria 5504
274 nmdc:mga03683_33522_c1 3300050489 Bacteria 2073
275 nmdc:mga0k408_4517_c1 3300050493 Bacteria 7385
276 nmdc:mga06z11_2144_c1 3300050494 Bacteria 7485
277 nmdc:mga08y16_11925_c1 3300050511 Bacteria 9131
278 nmdc:mga0n895_28260_c1 3300050512 Bacteria 5335
279 nmdc:mga0rr50_13696_c1 3300050513 Bacteria 5291
280 Ga0500647_0079350 3300053091 Bacteria 1574
281 Ga0500566_0000005 3300053094 Bacteria 159299
282 Ga0500641_0012161 3300053096 Bacteria 3138
283 Ga0500572_000016 3300053111 Bacteria 51017
284 Ga0500614_001900 3300053123 Bacteria 4810
285 Ga0500559_0007560 3300053136 Bacteria 4804
286 Ga0500603_000167 3300053150 Bacteria 16576
287 Ga0500603_000389 3300053150 Bacteria 11496
288 Ga0500616_0033560 3300053153 Bacteria 2800
289 Ga0500622_0006282 3300053156 Bacteria 6940
290 Ga0500634_0064287 3300053161 Bacteria 1939
291 Ga0500638_015401 3300053162 Bacteria 3508
292 Ga0500639_000023 3300053163 Bacteria 85696
293 Ga0500637_0005902 3300053178 Bacteria 5977
294 Ga0500645_003233 3300053730 Bacteria 6742
295 Ga0500596_000934 3300053735 Bacteria 5831
296 Ga0500599_000738 3300053736 Bacteria 3566
297 Ga0501082_0000653 3300060353 Bacteria 30577
298 2819593743 2818991445 Bacteria 4955017
299 2857576129 2857576091 Bacteria 5465855
300 2904698870 2904690495 Bacteria 9412302
301 2908759016 2908756301 Bacteria 8864324
302 8002393756 8002392321 Bacteria 4159911
303 Ga0496121_0015054
304 CNAas_1002052
305 Ga0065715_10122661
306 Ga0070676_10025384
307 Ga0070683_100050245
308 Ga0070683_100209457
309 Ga0070677_10056497
310 Ga0068869_100017339
311 Ga0068869_100036958
312 Ga0070666_10075547
313 Ga0070680_100070860
314 Ga0070680_100108945
315 Ga0068868_100157484
316 Ga0070660_100022805
317 Ga0070689_100004068
318 Ga0070689_100200186
319 Ga0070687_100020571
320 Ga0070661_100194285
321 Ga0070668_100016520
322 Ga0070671_100074562
323 Ga0070671_100120135
324 Ga0070674_100075192
325 Ga0070659_100202902
326 Ga0070667_100159224
327 Ga0070709_10005722
328 Ga0070709_10006456
329 Ga0070709_10163739
330 Ga0070714_100078270
331 Ga0070713_100008584
332 Ga0070713_100041848
333 Ga0070713_100049204
334 Ga0070701_10005136
335 Ga0070700_100001421
336 Ga0070700_100097321
337 Ga0070700_100121942
338 Ga0070694_100124358
339 Ga0070678_100004309
340 Ga0070681_10060585
341 Ga0070685_10084495
342 Ga0070698_100001015
343 Ga0070698_100104813
344 Ga0070679_100002873
345 Ga0070679_100026065
346 Ga0070679_100111633
347 Ga0070679_100127389
348 Ga0070684_100004894
349 Ga0070684_100034444
350 Ga0068853_100117150
351 Ga0070686_100001332
352 Ga0070695_100021754
353 Ga0070696_100038991
354 Ga0070665_100190439
355 Ga0068855_100244724
356 Ga0068855_100306555
357 Ga0068857_100007213
358 Ga0068854_100030817
359 Ga0068856_100070636
360 Ga0070702_100004308
361 Ga0070702_100026642
362 Ga0068852_100149927
363 Ga0068859_100079380
364 Ga0068859_100316799
365 Ga0068866_10006807
366 Ga0068861_100003015
367 Ga0068861_100012566
368 Ga0068851_10033390
369 Ga0068870_10016724
370 Ga0068863_100088062
371 Ga0068858_100014800
372 Ga0068858_100047084
373 Ga0068860_100017570
374 Ga0068860_100019707
375 Ga0068862_100015657
376 Ga0081455_10000156
377 Ga0081539_10002346
378 Ga0081539_10003829
379 Ga0070717_10001213
380 Ga0070717_10029087
381 Ga0075364_10002559
382 Ga0070712_100008646
383 Ga0075362_10033146
384 Ga0075369_10010840
385 Ga0097621_100003599
386 Ga0075370_10139376
387 Ga0068871_100130833
388 Ga0068871_100142479
389 Ga0075428_100043750
390 Ga0075428_100070893
391 Ga0075428_100162592
392 Ga0075430_100048708
393 Ga0075431_100114837
394 Ga0075434_100009856
395 Ga0075429_100037136
396 Ga0068865_100055413
397 Ga0097620_100079383
398 Ga0097620_100316813
399 Ga0075435_100018932
400 Ga0099794_10046512
401 Ga0105250_10004616
402 Ga0105240_10213248
403 Ga0111539_10000510
404 Ga0105245_10057587
405 Ga0105245_10222225
406 Ga0105247_10019196
407 Ga0105247_10102673
408 Ga0114129_10415654
409 Ga0105243_10006561
410 Ga0105241_10024409
411 Ga0105241_10111938
412 Ga0105241_10178393
413 Ga0105242_10018513
414 Ga0105248_10068505
415 Ga0105237_10029467
416 Ga0105238_10015056
417 Ga0105238_10069153
418 Ga0105238_10080560
419 Ga0105249_10036762
420 Ga0105249_10072462
421 Ga0105239_10095041
422 Ga0157373_10034588
423 Ga0157370_10312602
424 Ga0157369_10017915
425 Ga0157369_10192386
426 Ga0157374_10135072
427 Ga0157378_10006442
428 Ga0157378_10056062
429 Ga0157378_10238188
430 Ga0163162_10064660
431 Ga0163162_10135292
432 Ga0163162_10516180
433 Ga0157372_10278709
434 Ga0157375_10135469
435 Ga0157380_10065165
436 Ga0157380_10186034
437 Ga0213875_10000089
438 Ga0209677_103963
439 Ga0209233_1008433
440 Ga0209455_1004846
441 Ga0209758_1003296
442 Ga0207656_10066958
443 Ga0207696_1026089
444 Ga0207682_10002480
445 Ga0207642_10001838
446 Ga0207710_10029896
447 Ga0207688_10069979
448 Ga0207680_10131105
449 Ga0207699_10011682
450 Ga0207699_10116609
451 Ga0207645_10048218
452 Ga0207645_10127214
453 Ga0207643_10013730
454 Ga0207643_10052730
455 Ga0207707_10013204
456 Ga0207707_10018930
457 Ga0207707_10139459
458 Ga0207693_10024763
459 Ga0207693_10146281
460 Ga0207660_10001745
461 Ga0207660_10008485
462 Ga0207657_10014879
463 Ga0207657_10046084
464 Ga0207649_10060302
465 Ga0207652_10005265
466 Ga0207652_10133190
467 Ga0207694_10009134
468 Ga0207694_10012022
469 Ga0207659_10050552
470 Ga0207687_10029437
471 Ga0207687_10140640
472 Ga0207700_10018895
473 Ga0207700_10112973
474 Ga0207664_10093099
475 Ga0207644_10108363
476 Ga0207690_10138717
477 Ga0207706_10016650
478 Ga0207686_10001649
479 Ga0207709_10010206
480 Ga0207670_10004949
481 Ga0207670_10066630
482 Ga0207669_10038263
483 Ga0207704_10012012
484 Ga0207691_10145949
485 Ga0207711_10048363
486 Ga0207689_10002710
487 Ga0207689_10008638
488 Ga0207689_10074817
489 Ga0207661_10005259
490 Ga0207661_10048838
491 Ga0207679_10088543
492 Ga0207667_10020883
493 Ga0207667_10164624
494 Ga0207712_10021463
495 Ga0207668_10016102
496 Ga0207640_10058999
497 Ga0207703_10012136
498 Ga0207639_10185080
499 Ga0207708_10003997
500 Ga0207708_10040121
501 Ga0207641_10227078
502 Ga0207648_10000461
503 Ga0207674_10002366
504 Ga0207675_100001140
505 Ga0207675_100003585
506 Ga0207683_10007001
507 Ga0207683_10009672
508 Ga0209588_1003938
509 Ga0207428_10010418
510 Ga0268266_10051127
511 Ga0268265_10030806
512 Ga0268265_10107434
513 Ga0268264_10027979
514 Ga0265320_10012245
515 Ga0265340_10036855
516 Ga0265339_10017324
517 Ga0265331_10042836
518 Ga0265316_10042952
519 Ga0265313_10006285
520 Ga0307508_10000090
521 Ga0265314_10082797
522 Ga0265342_10010898
523 Ga0307510_10000001
524 Ga0373931_0001653
525 Ga0373937_0093489
526 Ga0316584_0002713
527 Ga0395900_0013539
528 Ga0395900_0019893
529 Ga0395900_0179086
530 Ga0395898_0000744
531 Ga0395898_0024424
532 Ga0436364_0019427
533 Ga0436364_1385267
534 Ga0395901_0026045
535 Ga0436365_1830264
536 Ga0436360_0646777
537 Ga0436361_0412437
538 Ga0436361_0799281
539 Ga0436363_0856319
540 Ga0466963_0021957
541 Ga0466967_0058239
542 Ga0466967_0199638
543 Ga0495638_0032385
544 Ga0495664_0118617
545 Ga0495607_0000082
546 Ga0495610_0035735
547 Ga0495632_0007636
548 Ga0495637_0061202
549 Ga0495643_0039367
550 Ga0495648_0036875
551 Ga0495609_0053108
552 Ga0495621_0037702
553 Ga0495656_0050345
554 Ga0495668_0007207
555 Ga0495670_0085630
556 Ga0495626_0022196
557 Ga0496101_0105138
558 Ga0496102_0022138
559 Ga0496102_0070873
560 Ga0496106_0133992
561 Ga0496110_0017027
562 Ga0496113_0019130
563 Ga0496115_0119132
564 Ga0496116_0113030
565 Ga0496119_0001412
566 Ga0496119_0004278
567 Ga0496121_0057769
568 Ga0496126_0007228
569 Ga0495682_0000254
570 Ga0501034_0003652
571 Ga0501034_0003885
572 Ga0501076_0054908
573 Ga0501076_0279823
574 Ga0501083_0084301
575 Ga0501044_0032306
576 nmdc:mga03683_33522_c1
577 nmdc:mga0k408_4517_c1
578 nmdc:mga06z11_2144_c1
579 nmdc:mga08y16_11925_c1
580 nmdc:mga0n895_28260_c1
581 nmdc:mga0rr50_13696_c1
582 Ga0500647_0079350
583 Ga0500566_0000005
584 Ga0500641_0012161
585 Ga0500572_000016
586 Ga0500614_001900
587 Ga0500559_0007560
588 Ga0500603_000167
589 Ga0500603_000389
590 Ga0500616_0033560
591 Ga0500622_0006282
592 Ga0500634_0064287
593 Ga0500638_015401
594 Ga0500639_000023
595 Ga0500637_0005902
596 Ga0500645_003233
597 Ga0500596_000934
598 Ga0500599_000738
599 Ga0501082_0000653
600 2819593743
601 2857576129
602 2904698870
603 2908759016
604 8002393756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

77

291

0.92

PF13347

MFS_2

MFS/sugar transport protein

199

478

0.84

PF07690

MFS_1

Major Facilitator Superfamily

326

485

0.81

PF00083

Sugar_tr

Sugar (and other) transporter

297

486

0.74

PF07690

MFS_1

Major Facilitator Superfamily

81

341

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gby-assembly1.cif.gz_A the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose 0.8353 14 429
6n3i-assembly1.cif.gz_A crystal structure of a double trp xyle mutants (g58w/l315w) 0.8166 16 429
4gby-assembly1.cif.gz_A the structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose 0.8083 14 429
7lo8-assembly1.cif.gz_Z nora in complex with fab36 0.7883 19 419
6m20-assembly3.cif.gz_C crystal structure of plasmodium falciparum hexose transporter pfht1 bound with glucose 0.788 18 429
ID Description Score Start End Superfamily
af_P77228_2_198_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9704 36 228 1.20.1250.20
af_P37643_22_237_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9492 21 229 1.20.1250.20
af_P77228_2_198_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9464 36 228 1.20.1250.20
af_Q2G0K4_17_228_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9422 20 228 1.20.1250.20
af_Q2G0K4_242_431_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9322 236 425 1.20.1250.20
ID Description Score Start End GO Terms
AF-A8GQ69-F1-model_v4 Proline/betaine transporter 0.9564 19 230 GO:0005886
GO:0015293
AF-A0A4R4Z5I5-F1-model_v4 MFS transporter 0.955 19 430 GO:0005886
GO:0015293
AF-A0A7H4N414-F1-model_v4 TcuC 0.9525 74 419 GO:0005886
GO:0015293
AF-U2LN81-F1-model_v4 deleted 0.9492 68 430
AF-A0A520EVB7-F1-model_v4 deleted 0.9489 71 429

Map