F396681

General Info

Members Datasets Scaffolds Average Seq Length
302 193 302 1016

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0006734|Ga0495672_0006734_4498_7830
Length 1090
Sequence MSEDRHINFKLMRERVLAEQGGGMSGKSYWRSLEELADSPEFREFVEREYPQHAEEWHDPVERRTFLKLMGASMALAGLSGCAFQPAEKIVPNVKQSEDSVPGKALFFATASSLGGIATPLLARSNEGRPTKLEGNPDHPNSRNADXEDRGSSATDIFSQASVLSLYDPDRSQIPLFREESRTWSTFVGELRTALDEQRPKQGAGIRFLTETITSPTLAAQLKGILTEFPQAKWHQYEPVNNDNARAGAMMAFGQPVNTTYDFTKADRILALDADFLSAHPGMLKYARDFASRRRPPKDPGNVDIGGIPDGYLWMNRLYVIETTPTTTGAAADHHWAVKPSEFERVARDLAGGIVSLGSSTGTPEGQSSTEVKPDGTTVEKRQIVSVGTAQPGELSLQDVLSLTSDLREHKGTSIVIAGREAPPQVHALAHAMNNALGNVGKTVFYTDSLEANSVDQRQSLQELLKDIDDGHVEMLLIIGGNPVYNTPADLKLNQERMFKPKLRVHLSQYRDETSSFCHWHIPESHYLETWSDTRAYDGTVSIVQPLIEPLYQSKSAHEFLAVFTPQYDKKPYEIVRDCWRSQQSAVPKPAATPSPDFESWWRKCVHDGFVPGTALVPKSVTPTQNQPAINYNVQASTTGPFEIVFRTDPTIYDGRFANNGWLQELPKPLSKLTWDNAALISPNTAKQLGITKTIGKKGGDIYVDTLKITHQGRTFEDMVPTWITPGQPDGVVTIHLGYGRTHAGNTGNGHGFNAYQIRTSDSPWSAGGVQVEKGSGQALVAVTQLHFLLEDRDFSKEDRDILRSQTLDEYMKGTPAGESHDPAADDTLYQPFDYKNQGNGLDYAWGMAIDLNNCIGCNACTIACQSENNIPVVGKEQVVRSREMHWIRIDTYFKGEDANQPEATNFMPVPCMHCENAPCEPVCPVHATVHSAEGLNDMVYNRCVGTKYCQNNCPYKVRRFNFFLYQDWEKPTYQLMRNPEVSIRSRGVMEKCTYCVQRIQGAKIQAEIRSETEGKQVRVRDGDIVTACQAVCPTEAIVFGDINDPNSRVSQLKADRRDYSLLAELNTKPRTTYLTALRNPNPEIKKQEG

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
156 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
164 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
181 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.01
Metatranscriptomes 0.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.32
Nodule 0
Rhizoplane 1.99
Rhizosphere 95.36
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000052 3300000532 Bacteria 8245
2 JGI24741J21665_1000465 3300001915 Bacteria 12341
3 JGI24740J21852_10000530 3300001979 Bacteria 16298
4 JGI24751J29686_10000013 3300002459 Bacteria 113565
5 rootH2_10005673 3300003320 Bacteria 75939
6 Ga0058862_10061456 3300004803 Bacteria 7933
7 Ga0065714_10002186 3300005288 Bacteria 191932
8 Ga0065712_10000113 3300005290 Bacteria 191931
9 Ga0065715_10091322 3300005293 Bacteria 5887
10 Ga0070658_10021364 3300005327 Bacteria 5188
11 Ga0070676_10004427 3300005328 Bacteria 7391
12 Ga0070683_100000033 3300005329 Bacteria 135305
13 Ga0070690_100001847 3300005330 Bacteria 11237
14 Ga0070690_100010235 3300005330 Bacteria 5452
15 Ga0070670_100001988 3300005331 Bacteria 16709
16 Ga0070670_100003304 3300005331 Bacteria 13344
17 Ga0070670_100008319 3300005331 Bacteria 8842
18 Ga0070670_100013213 3300005331 Bacteria 7073
19 Ga0068869_100003009 3300005334 Bacteria 10251
20 Ga0068869_100023343 3300005334 Bacteria 4270
21 Ga0070666_10002924 3300005335 Bacteria 10330
22 Ga0070666_10020274 3300005335 Bacteria 4297
23 Ga0070680_100005143 3300005336 Bacteria 9886
24 Ga0070680_100008934 3300005336 Bacteria 7682
25 Ga0070680_100026058 3300005336 Bacteria 4676
26 Ga0070682_100000076 3300005337 Bacteria 90097
27 Ga0070682_100005775 3300005337 Bacteria 6906
28 Ga0068868_100006831 3300005338 Bacteria 8101
29 Ga0068868_100012560 3300005338 Bacteria 6193
30 Ga0068868_100037182 3300005338 Bacteria 3773
31 Ga0070689_100012981 3300005340 Bacteria 6018
32 Ga0070691_10001388 3300005341 Bacteria 10341
33 Ga0070687_100001292 3300005343 Bacteria 8733
34 Ga0070661_100006901 3300005344 Bacteria 7832
35 Ga0070692_10012961 3300005345 Bacteria 3876
36 Ga0070668_100001118 3300005347 Bacteria 18921
37 Ga0070669_100001323 3300005353 Bacteria 17869
38 Ga0070669_100001921 3300005353 Bacteria 15002
39 Ga0070669_100023755 3300005353 Bacteria 4393
40 Ga0070675_100002457 3300005354 Bacteria 13856
41 Ga0070671_100005941 3300005355 Bacteria 9725
42 Ga0070673_100001253 3300005364 Bacteria 14749
43 Ga0070688_100005362 3300005365 Bacteria 6743
44 Ga0070659_100036886 3300005366 Bacteria 3811
45 Ga0070667_100004354 3300005367 Bacteria 11944
46 Ga0070700_100012795 3300005441 Bacteria 4698
47 Ga0070694_100007992 3300005444 Bacteria 6463
48 Ga0070694_100019113 3300005444 Bacteria 4356
49 Ga0070708_100000137 3300005445 Bacteria 50233
50 Ga0070662_100021258 3300005457 Bacteria 4429
51 Ga0070681_10000273 3300005458 Bacteria 41372
52 Ga0070681_10001057 3300005458 Bacteria 23417
53 Ga0070681_10002209 3300005458 Bacteria 17745
54 Ga0070681_10007055 3300005458 Bacteria 10939
55 Ga0070681_10017990 3300005458 Bacteria 7062
56 Ga0070706_100000019 3300005467 Bacteria 166483
57 Ga0070706_100001324 3300005467 Bacteria 26322
58 Ga0070706_100005412 3300005467 Bacteria 12159
59 Ga0070707_100000651 3300005468 Bacteria 34704
60 Ga0070698_100000902 3300005471 Bacteria 32626
61 Ga0070698_100002590 3300005471 Bacteria 19918
62 Ga0070698_100005088 3300005471 Bacteria 14398
63 Ga0070699_100000439 3300005518 Bacteria 39981
64 Ga0070699_100006382 3300005518 Bacteria 10278
65 Ga0070679_100000737 3300005530 Bacteria 28290
66 Ga0070679_100001215 3300005530 Bacteria 22690
67 Ga0070679_100006475 3300005530 Bacteria 10916
68 Ga0070679_100006834 3300005530 Bacteria 10637
69 Ga0070684_100029772 3300005535 Bacteria 4631
70 Ga0070697_100000265 3300005536 Bacteria 42493
71 Ga0070697_100000983 3300005536 Bacteria 21549
72 Ga0070697_100004343 3300005536 Bacteria 10874
73 Ga0068853_100002977 3300005539 Bacteria 12913
74 Ga0068853_100022256 3300005539 Bacteria 5292
75 Ga0070672_100000166 3300005543 Bacteria 36328
76 Ga0070693_100001971 3300005547 Bacteria 9391
77 Ga0070665_100006963 3300005548 Bacteria 11495
78 Ga0068855_100037615 3300005563 Bacteria 5753
79 Ga0070664_100003396 3300005564 Bacteria 12856
80 Ga0070664_100005118 3300005564 Bacteria 10524
81 Ga0068857_100000993 3300005577 Bacteria 21789
82 Ga0068856_100028036 3300005614 Bacteria 5495
83 Ga0070702_100016193 3300005615 Bacteria 3822
84 Ga0068852_100007405 3300005616 Bacteria 8011
85 Ga0068859_100024990 3300005617 Bacteria 5996
86 Ga0068859_100043757 3300005617 Bacteria 4500
87 Ga0068864_100007825 3300005618 Bacteria 8807
88 Ga0068864_100032135 3300005618 Bacteria 4457
89 Ga0068861_100005638 3300005719 Bacteria 8490
90 Ga0068870_10000136 3300005840 Bacteria 25517
91 Ga0068858_100012079 3300005842 Bacteria 8138
92 Ga0068858_100013352 3300005842 Bacteria 7748
93 Ga0068858_100034462 3300005842 Bacteria 4696
94 Ga0068862_100002024 3300005844 Bacteria 18363
95 Ga0068862_100010229 3300005844 Bacteria 7740
96 Ga0081455_10030785 3300005937 Bacteria 4870
97 Ga0081539_10001769 3300005985 Bacteria 34433
98 Ga0081539_10005899 3300005985 Bacteria 12114
99 Ga0075365_10000761 3300006038 Bacteria 13103
100 Ga0097621_100007866 3300006237 Bacteria 7647
101 Ga0075370_10003796 3300006353 Bacteria 7232
102 Ga0068871_100009123 3300006358 Bacteria 7167
103 Ga0068871_100017546 3300006358 Bacteria 5420
104 Ga0075428_100045998 3300006844 Bacteria 4795
105 Ga0075431_100002296 3300006847 Bacteria 18361
106 Ga0075434_100007662 3300006871 Bacteria 9989
107 Ga0075434_100013687 3300006871 Bacteria 7733
108 Ga0075436_100009702 3300006914 Bacteria 6586
109 Ga0097620_100024991 3300006931 Bacteria 5996
110 Ga0097620_100043763 3300006931 Bacteria 4500
111 Ga0075435_100005050 3300007076 Bacteria 9168
112 Ga0105240_10000137 3300009093 Bacteria 149925
113 Ga0105240_10074435 3300009093 Bacteria 4192
114 Ga0111539_10001481 3300009094 Bacteria 31365
115 Ga0111539_10001618 3300009094 Bacteria 30088
116 Ga0111539_10033885 3300009094 Bacteria 6196
117 Ga0105245_10000052 3300009098 Bacteria 126402
118 Ga0105245_10021981 3300009098 Bacteria 5598
119 Ga0114129_10029864 3300009147 Bacteria 7720
120 Ga0114129_10032605 3300009147 Bacteria 7361
121 Ga0105243_10015118 3300009148 Bacteria 5842
122 Ga0105248_10008939 3300009177 Bacteria 11017
123 Ga0105248_10042976 3300009177 Bacteria 5067
124 Ga0105237_10001605 3300009545 Bacteria 29357
125 Ga0105237_10006838 3300009545 Bacteria 12570
126 Ga0105238_10009924 3300009551 Bacteria 9546
127 Ga0105238_10012970 3300009551 Bacteria 8414
128 Ga0105249_10000480 3300009553 Bacteria 37106
129 Ga0105249_10014783 3300009553 Bacteria 6899
130 Ga0105239_10044152 3300010375 Bacteria 4886
131 Ga0157373_10024168 3300013100 Bacteria 4403
132 Ga0157370_10010055 3300013104 Bacteria 10004
133 Ga0157370_10021172 3300013104 Bacteria 6483
134 Ga0157378_10007811 3300013297 Bacteria 9338
135 Ga0157378_10049300 3300013297 Bacteria 3746
136 Ga0163162_10000477 3300013306 Bacteria 37086
137 Ga0163162_10000539 3300013306 Bacteria 34986
138 Ga0163162_10001294 3300013306 Bacteria 23375
139 Ga0163162_10017227 3300013306 Bacteria 7069
140 Ga0157375_10000059 3300013308 Bacteria 118614
141 Ga0157375_10000396 3300013308 Bacteria 39655
142 Ga0157375_10003903 3300013308 Bacteria 12930
143 Ga0157375_10053048 3300013308 Bacteria 3988
144 Ga0163163_10001169 3300014325 Bacteria 22322
145 Ga0163163_10002277 3300014325 Bacteria 16189
146 Ga0163163_10002445 3300014325 Bacteria 15711
147 Ga0163163_10008771 3300014325 Bacteria 8999
148 Ga0157380_10001478 3300014326 Bacteria 15379
149 Ga0157379_10043236 3300014968 Bacteria 4022
150 Ga0157376_10011154 3300014969 Bacteria 6612
151 Ga0206353_10537404 3300020082 Bacteria 5881
152 Ga0224712_10005442 3300022467 Bacteria 3546
153 Ga0207697_10008801 3300025315 Bacteria 4394
154 Ga0207653_10001391 3300025885 Bacteria 7838
155 Ga0207710_10002109 3300025900 Bacteria 9404
156 Ga0207688_10007346 3300025901 Bacteria 5997
157 Ga0207647_10000240 3300025904 Bacteria 44855
158 Ga0207647_10000801 3300025904 Bacteria 24373
159 Ga0207645_10015529 3300025907 Bacteria 5057
160 Ga0207705_10001704 3300025909 Bacteria 17461
161 Ga0207705_10001799 3300025909 Bacteria 16906
162 Ga0207684_10000079 3300025910 Bacteria 179842
163 Ga0207684_10024329 3300025910 Bacteria 5164
164 Ga0207707_10000008 3300025912 Bacteria 330313
165 Ga0207707_10000295 3300025912 Bacteria 53118
166 Ga0207707_10000627 3300025912 Bacteria 35031
167 Ga0207707_10001295 3300025912 Bacteria 23292
168 Ga0207707_10004620 3300025912 Bacteria 12097
169 Ga0207707_10006114 3300025912 Bacteria 10523
170 Ga0207671_10009323 3300025914 Bacteria 8216
171 Ga0207660_10000464 3300025917 Bacteria 26807
172 Ga0207660_10000525 3300025917 Bacteria 25613
173 Ga0207660_10005981 3300025917 Bacteria 7901
174 Ga0207662_10000900 3300025918 Bacteria 13738
175 Ga0207662_10010604 3300025918 Bacteria 5095
176 Ga0207657_10004931 3300025919 Bacteria 14032
177 Ga0207649_10004211 3300025920 Bacteria 7835
178 Ga0207652_10000065 3300025921 Bacteria 111252
179 Ga0207652_10000148 3300025921 Bacteria 75801
180 Ga0207652_10001216 3300025921 Bacteria 23078
181 Ga0207652_10006259 3300025921 Bacteria 9608
182 Ga0207646_10000494 3300025922 Bacteria 52791
183 Ga0207681_10000879 3300025923 Bacteria 19782
184 Ga0207681_10002712 3300025923 Bacteria 11216
185 Ga0207681_10023287 3300025923 Bacteria 3959
186 Ga0207694_10028592 3300025924 Bacteria 4250
187 Ga0207650_10000001 3300025925 Bacteria 1545726
188 Ga0207650_10002322 3300025925 Bacteria 13255
189 Ga0207659_10005272 3300025926 Bacteria 7833
190 Ga0207687_10000005 3300025927 Bacteria 770649
191 Ga0207687_10008058 3300025927 Bacteria 6894
192 Ga0207706_10005693 3300025933 Bacteria 11608
193 Ga0207709_10003272 3300025935 Bacteria 9718
194 Ga0207670_10002555 3300025936 Bacteria 9555
195 Ga0207691_10011098 3300025940 Bacteria 8649
196 Ga0207691_10013097 3300025940 Bacteria 7939
197 Ga0207691_10017673 3300025940 Bacteria 6760
198 Ga0207711_10005158 3300025941 Bacteria 11066
199 Ga0207711_10017510 3300025941 Bacteria 5952
200 Ga0207689_10002833 3300025942 Bacteria 16002
201 Ga0207689_10020541 3300025942 Bacteria 5556
202 Ga0207661_10000006 3300025944 Bacteria 537727
203 Ga0207679_10003732 3300025945 Bacteria 9443
204 Ga0207667_10047913 3300025949 Bacteria 4520
205 Ga0207712_10000164 3300025961 Bacteria 68361
206 Ga0207668_10001056 3300025972 Bacteria 16429
207 Ga0207677_10009822 3300026023 Bacteria 5393
208 Ga0207703_10015752 3300026035 Bacteria 5897
209 Ga0207639_10005198 3300026041 Bacteria 8780
210 Ga0207678_10003106 3300026067 Bacteria 15041
211 Ga0207678_10018949 3300026067 Bacteria 6048
212 Ga0207708_10009878 3300026075 Bacteria 7086
213 Ga0207702_10014693 3300026078 Bacteria 6496
214 Ga0207702_10038934 3300026078 Bacteria 3982
215 Ga0207676_10007589 3300026095 Bacteria 7698
216 Ga0207676_10027345 3300026095 Bacteria 4247
217 Ga0207676_10030114 3300026095 Bacteria 4070
218 Ga0207674_10000079 3300026116 Bacteria 102085
219 Ga0207674_10003058 3300026116 Bacteria 20694
220 Ga0207674_10024833 3300026116 Bacteria 6397
221 Ga0207698_10004107 3300026142 Bacteria 8841
222 Ga0207428_10004803 3300027907 Bacteria 12761
223 Ga0207428_10007605 3300027907 Bacteria 9871
224 Ga0207428_10021261 3300027907 Bacteria 5495
225 Ga0268266_10013170 3300028379 Bacteria 7132
226 Ga0268265_10009096 3300028380 Bacteria 6716
227 Ga0265330_10000765 3300031235 Bacteria 20208
228 Ga0307408_100018415 3300031548 Bacteria 4688
229 Ga0307405_10007108 3300031731 Bacteria 5566
230 Ga0307406_10002329 3300031901 Bacteria 10323
231 Ga0307409_100013674 3300031995 Bacteria 5239
232 Ga0307416_100002993 3300032002 Bacteria 9858
233 Ga0307416_100017367 3300032002 Bacteria 5033
234 Ga0307414_10002257 3300032004 Bacteria 10072
235 Ga0307414_10018953 3300032004 Bacteria 4253
236 Ga0373954_0004342 3300035118 Bacteria 6095
237 Ga0373924_0000284 3300035410 Bacteria 15573
238 Ga0373924_0008956 3300035410 Bacteria 3657
239 Ga0373937_0000340 3300036401 Bacteria 44240
240 Ga0373937_0005772 3300036401 Bacteria 10641
241 Ga0373937_0009459 3300036401 Bacteria 8472
242 Ga0373925_0004331 3300037068 Bacteria 10742
243 Ga0395900_0000013 3300037418 Bacteria 388765
244 Ga0395900_0000735 3300037418 Bacteria 43503
245 Ga0395898_0030568 3300037466 Bacteria 5389
246 Ga0395905_0000065 3300037471 Bacteria 184928
247 Ga0395905_0048396 3300037471 Bacteria 3985
248 Ga0395901_0066272 3300038443 Bacteria 3761
249 Ga0436365_0051833 3300039437 Bacteria 32975
250 Ga0436365_0776493 3300039437 Bacteria 5435
251 Ga0436365_1238698 3300039437 Bacteria 6628
252 Ga0436361_0085822 3300039447 Bacteria 6255
253 Ga0439458_0003721 3300042157 Bacteria 3537
254 Ga0439434_0006038 3300042435 Bacteria 3533
255 Ga0466966_0003650 3300044684 Bacteria 10160
256 Ga0466966_0009452 3300044684 Bacteria 6458
257 Ga0466964_0015785 3300044706 Bacteria 2875
258 Ga0466957_0003501 3300044842 Bacteria 8626
259 Ga0451576_0009423 3300045051 Bacteria 11317
260 Ga0451576_0059789 3300045051 Bacteria 3977
261 Ga0495584_0010813 3300046491 Bacteria 4685
262 Ga0495663_0000189 3300046525 Bacteria 24645
263 Ga0495598_0001001 3300046537 Bacteria 5419
264 Ga0495609_0000697 3300046538 Bacteria 25847
265 Ga0495604_0023584 3300047317 Bacteria 4909
266 Ga0495672_0006734 3300047320 Bacteria 8820
267 Ga0496104_0009333 3300048907 Bacteria 8725
268 Ga0496105_0007596 3300048908 Bacteria 8405
269 Ga0496106_0024782 3300048909 Bacteria 4461
270 Ga0496109_0001048 3300048912 Bacteria 22875
271 Ga0496112_0013708 3300048915 Bacteria 7493
272 Ga0496115_0022841 3300048918 Bacteria 4850
273 Ga0501034_0006563 3300049571 Bacteria 12495
274 Ga0501034_0019471 3300049571 Bacteria 6941
275 Ga0501034_0043131 3300049571 Bacteria 4566
276 Ga0501038_0012043 3300049574 Bacteria 7897
277 Ga0501039_0007746 3300049575 Bacteria 8194
278 Ga0501040_0013516 3300049576 Bacteria 5367
279 Ga0501042_0017435 3300049578 Bacteria 4952
280 Ga0501072_0019889 3300049588 Bacteria 5196
281 Ga0501075_0007748 3300049591 Bacteria 7450
282 Ga0501077_0009671 3300049593 Bacteria 5994
283 Ga0501234_000821 3300049707 Bacteria 4868
284 Ga0501081_0005536 3300049743 Bacteria 8151
285 Ga0501035_0002249 3300049822 Bacteria 19116
286 nmdc:mga0k408_3255_c1 3300050493 Bacteria 8593
287 nmdc:mga07m45_2089_c1 3300050496 Bacteria 9274
288 nmdc:mga05p37_22080_c1 3300050507 Bacteria 6711
289 nmdc:mga06r32_24427_c1 3300050510 Bacteria 5609
290 nmdc:mga06r32_4306_c1 3300050510 Bacteria 12739
291 nmdc:mga08y16_26948_c1 3300050511 Bacteria 6057
292 nmdc:mga0n895_2321_c1 3300050512 Bacteria 14818
293 nmdc:mga0rr50_110_c2 3300050513 Bacteria 25403
294 nmdc:mga0a205_131_c1 3300050515 Bacteria 46472
295 nmdc:mga0a205_1555_c1 3300050515 Bacteria 19642
296 nmdc:mga0a205_20112_c1 3300050515 Bacteria 6298
297 nmdc:mga0a205_24292_c1 3300050515 Bacteria 5761
298 nmdc:mga0a205_51983_c2 3300050515 Bacteria 2988
299 nmdc:mga0a205_85684_c1 3300050515 Bacteria 3042
300 Ga0501084_0022976 3300054114 Bacteria 5205
301 Ga0530510_0003979 3300061734 Bacteria 10196
302 Ga0530510_0037123 3300061734 Bacteria 3512

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0015785 Ga0466964_0015785_66_2840 847
2 3300037471 Ga0395905_0000065 Ga0395905_0000065_24321_27047 865
3 3300001915 JGI24741J21665_1000465 JGI24741J21665_10004653 878
4 3300050515 nmdc:mga0a205_85684_c1 nmdc:mga0a205_85684_c1_36_2921 882
5 3300025927 Ga0207687_10008058 Ga0207687_100080586 885
6 3300039437 Ga0436365_0776493 Ga0436365_0776493_1570_4434 889
7 3300046491 Ga0495584_0010813 Ga0495584_0010813_829_3651 895
8 3300046538 Ga0495609_0000697 Ga0495609_0000697_5906_8728 895
9 3300044684 Ga0466966_0003650 Ga0466966_0003650_3530_6388 897
10 3300025920 Ga0207649_10004211 Ga0207649_100042116 900
11 3300025945 Ga0207679_10003732 Ga0207679_100037325 900
12 3300039437 Ga0436365_0051833 Ga0436365_0051833_6989_9871 903
13 3300022467 Ga0224712_10005442 Ga0224712_100054421 908
14 3300039437 Ga0436365_1238698 Ga0436365_1238698_402_3320 909
15 3300014969 Ga0157376_10011154 Ga0157376_100111545 913
16 3300003320 rootH2_10005673 rootH2_1000567379 916
17 3300005344 Ga0070661_100006901 Ga0070661_1000069016 916
18 3300005458 Ga0070681_10001057 Ga0070681_100010577 916
19 3300005539 Ga0068853_100002977 Ga0068853_1000029775 916
20 3300025912 Ga0207707_10004620 Ga0207707_100046202 916
21 3300026041 Ga0207639_10005198 Ga0207639_100051984 916
22 3300026116 Ga0207674_10024833 Ga0207674_100248333 917
23 3300050515 nmdc:mga0a205_51983_c2 nmdc:mga0a205_51983_c2_74_2938 917
24 3300005336 Ga0070680_100008934 Ga0070680_1000089344 919
25 3300005458 Ga0070681_10017990 Ga0070681_100179904 919
26 3300005530 Ga0070679_100006834 Ga0070679_1000068345 919
27 3300005563 Ga0068855_100037615 Ga0068855_1000376152 919
28 3300013104 Ga0157370_10021172 Ga0157370_100211722 919
29 3300025912 Ga0207707_10006114 Ga0207707_100061145 919
30 3300025917 Ga0207660_10005981 Ga0207660_100059812 919
31 3300025921 Ga0207652_10006259 Ga0207652_100062594 919
32 3300026067 Ga0207678_10018949 Ga0207678_100189494 919
33 3300049571 Ga0501034_0006563 Ga0501034_0006563_3500_6517 919
34 3300009093 Ga0105240_10000137 Ga0105240_1000013765 920
35 3300035410 Ga0373924_0008956 Ga0373924_0008956_529_3549 921
36 3300050493 nmdc:mga0k408_3255_c1 nmdc:mga0k408_3255_c1_3130_6186 921
37 3300049571 Ga0501034_0019471 Ga0501034_0019471_2072_4963 926
38 3300061734 Ga0530510_0003979 Ga0530510_0003979_6760_9678 926
39 3300006871 Ga0075434_100013687 Ga0075434_1000136876 928
40 3300005341 Ga0070691_10001388 Ga0070691_100013882 929
41 3300005614 Ga0068856_100028036 Ga0068856_1000280362 930
42 3300013104 Ga0157370_10010055 Ga0157370_100100556 930
43 3300026078 Ga0207702_10014693 Ga0207702_100146932 930
44 3300037418 Ga0395900_0000735 Ga0395900_0000735_14867_17998 930
45 3300005336 Ga0070680_100026058 Ga0070680_1000260582 931
46 3300005458 Ga0070681_10007055 Ga0070681_100070552 931
47 3300005530 Ga0070679_100006475 Ga0070679_1000064759 931
48 3300025912 Ga0207707_10000295 Ga0207707_1000029542 931
49 3300025921 Ga0207652_10000148 Ga0207652_1000014845 931
50 3300005366 Ga0070659_100036886 Ga0070659_1000368862 933
51 3300009545 Ga0105237_10006838 Ga0105237_100068386 936
52 3300025914 Ga0207671_10009323 Ga0207671_100093234 936
53 3300049575 Ga0501039_0007746 Ga0501039_0007746_3007_6018 936
54 3300049578 Ga0501042_0017435 Ga0501042_0017435_735_3746 936
55 3300049591 Ga0501075_0007748 Ga0501075_0007748_3542_6553 936
56 3300005331 Ga0070670_100008319 Ga0070670_1000083195 937
57 3300005335 Ga0070666_10002924 Ga0070666_100029249 937
58 3300005367 Ga0070667_100004354 Ga0070667_1000043549 937
59 3300005564 Ga0070664_100003396 Ga0070664_1000033966 937
60 3300005618 Ga0068864_100007825 Ga0068864_1000078255 937
61 3300009177 Ga0105248_10008939 Ga0105248_100089396 937
62 3300013308 Ga0157375_10003903 Ga0157375_100039038 937
63 3300014325 Ga0163163_10008771 Ga0163163_100087716 937
64 3300025940 Ga0207691_10013097 Ga0207691_100130975 937
65 3300025941 Ga0207711_10005158 Ga0207711_100051586 937
66 3300026095 Ga0207676_10030114 Ga0207676_100301141 937
67 3300035118 Ga0373954_0004342 Ga0373954_0004342_2766_5786 938
68 3300049588 Ga0501072_0019889 Ga0501072_0019889_1412_4441 940
69 3300006353 Ga0075370_10003796 Ga0075370_100037965 941
70 3300049593 Ga0501077_0009671 Ga0501077_0009671_720_3818 941
71 3300050496 nmdc:mga07m45_2089_c1 nmdc:mga07m45_2089_c1_5194_8223 941
72 3300001979 JGI24740J21852_10000530 JGI24740J21852_100005305 943
73 3300005337 Ga0070682_100005775 Ga0070682_1000057753 943
74 3300020082 Ga0206353_10537404 Ga0206353_105374045 943
75 3300025904 Ga0207647_10000240 Ga0207647_1000024036 943
76 3300025909 Ga0207705_10001704 Ga0207705_1000170411 943
77 3300025909 Ga0207705_10001799 Ga0207705_1000179911 943
78 3300025912 Ga0207707_10000627 Ga0207707_1000062730 943
79 3300025912 Ga0207707_10001295 Ga0207707_100012955 943
80 3300025917 Ga0207660_10000464 Ga0207660_1000046421 943
81 3300025917 Ga0207660_10000525 Ga0207660_100005257 943
82 3300025919 Ga0207657_10004931 Ga0207657_100049314 943
83 3300025921 Ga0207652_10001216 Ga0207652_1000121617 943
84 3300025949 Ga0207667_10047913 Ga0207667_100479132 943
85 3300026067 Ga0207678_10003106 Ga0207678_100031065 943
86 3300026116 Ga0207674_10003058 Ga0207674_1000305810 943
87 3300026142 Ga0207698_10004107 Ga0207698_100041073 943
88 3300038443 Ga0395901_0066272 Ga0395901_0066272_216_3290 943
89 3300049822 Ga0501035_0002249 Ga0501035_0002249_15055_18087 943
90 3300005444 Ga0070694_100019113 Ga0070694_1000191132 944
91 3300006038 Ga0075365_10000761 Ga0075365_1000076112 944
92 3300050510 nmdc:mga06r32_24427_c1 nmdc:mga06r32_24427_c1_2459_5572 945
93 3300009094 Ga0111539_10001481 Ga0111539_1000148129 946
94 3300027907 Ga0207428_10021261 Ga0207428_100212613 946
95 3300037418 Ga0395900_0000013 Ga0395900_0000013_131311_134463 946
96 3300037466 Ga0395898_0030568 Ga0395898_0030568_1299_4451 946
97 3300050511 nmdc:mga08y16_26948_c1 nmdc:mga08y16_26948_c1_2059_5196 946
98 3300044684 Ga0466966_0009452 Ga0466966_0009452_2074_5067 948
99 3300031548 Ga0307408_100018415 Ga0307408_1000184152 949
100 3300036401 Ga0373937_0005772 Ga0373937_0005772_1857_4955 949
101 3300031995 Ga0307409_100013674 Ga0307409_1000136743 950
102 3300032002 Ga0307416_100017367 Ga0307416_1000173673 950
103 3300045051 Ga0451576_0059789 Ga0451576_0059789_655_3654 950
104 3300049576 Ga0501040_0013516 Ga0501040_0013516_195_3446 953
105 3300006358 Ga0068871_100017546 Ga0068871_1000175464 954
106 3300013306 Ga0163162_10001294 Ga0163162_100012949 954
107 3300014325 Ga0163163_10002445 Ga0163163_100024455 954
108 3300013308 Ga0157375_10000396 Ga0157375_1000039621 955
109 3300005327 Ga0070658_10021364 Ga0070658_100213642 956
110 3300005345 Ga0070692_10012961 Ga0070692_100129612 956
111 3300009093 Ga0105240_10074435 Ga0105240_100744351 956
112 3300009098 Ga0105245_10000052 Ga0105245_1000005283 956
113 3300013308 Ga0157375_10000059 Ga0157375_1000005930 956
114 3300025927 Ga0207687_10000005 Ga0207687_1000000534 956
115 3300036401 Ga0373937_0000340 Ga0373937_0000340_14843_17950 956
116 3300010375 Ga0105239_10044152 Ga0105239_100441523 957
117 3300049571 Ga0501034_0043131 Ga0501034_0043131_286_3249 957
118 3300049743 Ga0501081_0005536 Ga0501081_0005536_4794_7844 957
119 3300005329 Ga0070683_100000033 Ga0070683_10000003312 958
120 3300025944 Ga0207661_10000006 Ga0207661_10000006378 958
121 3300031235 Ga0265330_10000765 Ga0265330_1000076510 959
122 3300048915 Ga0496112_0013708 Ga0496112_0013708_4350_7454 959
123 3300048909 Ga0496106_0024782 Ga0496106_0024782_1438_4446 960
124 3300004803 Ga0058862_10061456 Ga0058862_100614562 962
125 3300005338 Ga0068868_100006831 Ga0068868_1000068312 962
126 3300005535 Ga0070684_100029772 Ga0070684_1000297721 962
127 3300005539 Ga0068853_100022256 Ga0068853_1000222562 962
128 3300005616 Ga0068852_100007405 Ga0068852_1000074056 962
129 3300009551 Ga0105238_10012970 Ga0105238_100129706 962
130 3300025924 Ga0207694_10028592 Ga0207694_100285922 962
131 3300032002 Ga0307416_100002993 Ga0307416_1000029933 962
132 3300006871 Ga0075434_100007662 Ga0075434_1000076627 963
133 3300007076 Ga0075435_100005050 Ga0075435_1000050502 963
134 3300050512 nmdc:mga0n895_2321_c1 nmdc:mga0n895_2321_c1_4463_7495 963
135 3300050513 nmdc:mga0rr50_110_c2 nmdc:mga0rr50_110_c2_4832_7864 963
136 3300050515 nmdc:mga0a205_131_c1 nmdc:mga0a205_131_c1_18515_21547 963
137 3300006844 Ga0075428_100045998 Ga0075428_1000459983 966
138 3300006847 Ga0075431_100002296 Ga0075431_10000229615 966
139 3300050510 nmdc:mga06r32_4306_c1 nmdc:mga06r32_4306_c1_4657_7689 966
140 3300005338 Ga0068868_100012560 Ga0068868_1000125603 968
141 3300005445 Ga0070708_100000137 Ga0070708_10000013727 968
142 3300005467 Ga0070706_100001324 Ga0070706_10000132415 968
143 3300005468 Ga0070707_100000651 Ga0070707_1000006519 968
144 3300005471 Ga0070698_100000902 Ga0070698_1000009025 968
145 3300005518 Ga0070699_100000439 Ga0070699_10000043911 968
146 3300005536 Ga0070697_100000265 Ga0070697_10000026538 968
147 3300005548 Ga0070665_100006963 Ga0070665_1000069632 968
148 3300005842 Ga0068858_100013352 Ga0068858_1000133524 968
149 3300009177 Ga0105248_10042976 Ga0105248_100429762 968
150 3300014968 Ga0157379_10043236 Ga0157379_100432361 968
151 3300025922 Ga0207646_10000494 Ga0207646_1000049411 968
152 3300026023 Ga0207677_10009822 Ga0207677_100098222 968
153 3300028379 Ga0268266_10013170 Ga0268266_100131703 968
154 3300048918 Ga0496115_0022841 Ga0496115_0022841_1268_4327 968
155 3300047317 Ga0495604_0023584 Ga0495604_0023584_650_3790 969
156 3300042435 Ga0439434_0006038 Ga0439434_0006038_243_3476 971
157 3300037471 Ga0395905_0048396 Ga0395905_0048396_645_3695 972
158 3300039447 Ga0436361_0085822 Ga0436361_0085822_2324_5395 972
159 3300048908 Ga0496105_0007596 Ga0496105_0007596_2880_5987 972
160 3300005328 Ga0070676_10004427 Ga0070676_100044275 973
161 3300005330 Ga0070690_100001847 Ga0070690_1000018479 973
162 3300005334 Ga0068869_100003009 Ga0068869_1000030096 973
163 3300005335 Ga0070666_10020274 Ga0070666_100202742 973
164 3300005340 Ga0070689_100012981 Ga0070689_1000129812 973
165 3300005353 Ga0070669_100001921 Ga0070669_1000019217 973
166 3300005354 Ga0070675_100002457 Ga0070675_10000245712 973
167 3300005364 Ga0070673_100001253 Ga0070673_10000125313 973
168 3300005365 Ga0070688_100005362 Ga0070688_1000053623 973
169 3300005457 Ga0070662_100021258 Ga0070662_1000212582 973
170 3300005543 Ga0070672_100000166 Ga0070672_1000001663 973
171 3300005617 Ga0068859_100024990 Ga0068859_1000249903 973
172 3300005840 Ga0068870_10000136 Ga0068870_100001369 973
173 3300005844 Ga0068862_100002024 Ga0068862_10000202412 973
174 3300006931 Ga0097620_100024991 Ga0097620_1000249913 973
175 3300009094 Ga0111539_10001618 Ga0111539_100016183 973
176 3300025315 Ga0207697_10008801 Ga0207697_100088012 973
177 3300025901 Ga0207688_10007346 Ga0207688_100073463 973
178 3300025907 Ga0207645_10015529 Ga0207645_100155292 973
179 3300025923 Ga0207681_10002712 Ga0207681_100027122 973
180 3300025926 Ga0207659_10005272 Ga0207659_100052727 973
181 3300025933 Ga0207706_10005693 Ga0207706_1000569311 973
182 3300025940 Ga0207691_10017673 Ga0207691_100176734 973
183 3300025942 Ga0207689_10002833 Ga0207689_1000283312 973
184 3300026035 Ga0207703_10015752 Ga0207703_100157522 973
185 3300027907 Ga0207428_10004803 Ga0207428_100048033 973
186 3300045051 Ga0451576_0009423 Ga0451576_0009423_5951_9016 973
187 3300050515 nmdc:mga0a205_1555_c1 nmdc:mga0a205_1555_c1_9299_12355 973
188 3300036401 Ga0373937_0009459 Ga0373937_0009459_3571_6675 974
189 3300037068 Ga0373925_0004331 Ga0373925_0004331_5803_8907 974
190 3300035410 Ga0373924_0000284 Ga0373924_0000284_12451_15549 975
191 3300044842 Ga0466957_0003501 Ga0466957_0003501_178_3294 975
192 3300032004 Ga0307414_10018953 Ga0307414_100189532 976
193 3300005467 Ga0070706_100005412 Ga0070706_1000054129 977
194 3300025910 Ga0207684_10024329 Ga0207684_100243293 977
195 3300005471 Ga0070698_100002590 Ga0070698_10000259011 983
196 3300061734 Ga0530510_0037123 Ga0530510_0037123_367_3438 986
197 3300005334 Ga0068869_100023343 Ga0068869_1000233432 987
198 3300025942 Ga0207689_10020541 Ga0207689_100205412 987
199 3300005331 Ga0070670_100003304 Ga0070670_10000330413 989
200 3300005353 Ga0070669_100001323 Ga0070669_10000132310 989
201 3300025923 Ga0207681_10000879 Ga0207681_1000087914 989
202 3300025925 Ga0207650_10002322 Ga0207650_1000232210 989
203 3300005937 Ga0081455_10030785 Ga0081455_100307853 993
204 3300054114 Ga0501084_0022976 Ga0501084_0022976_215_3391 993
205 3300046525 Ga0495663_0000189 Ga0495663_0000189_3765_7019 994
206 3300005337 Ga0070682_100000076 Ga0070682_10000007645 996
207 3300009094 Ga0111539_10033885 Ga0111539_100338853 996
208 3300027907 Ga0207428_10007605 Ga0207428_100076057 996
209 3300047320 Ga0495672_0006734 Ga0495672_0006734_4498_7830 999
210 3300048912 Ga0496109_0001048 Ga0496109_0001048_13509_16652 1000
211 3300005615 Ga0070702_100016193 Ga0070702_1000161932 1002
212 3300025885 Ga0207653_10001391 Ga0207653_100013916 1002
213 3300005985 Ga0081539_10001769 Ga0081539_1000176931 1003
214 3300005347 Ga0070668_100001118 Ga0070668_1000011189 1004
215 3300009553 Ga0105249_10000480 Ga0105249_1000048010 1004
216 3300013306 Ga0163162_10000477 Ga0163162_1000047711 1004
217 3300025961 Ga0207712_10000164 Ga0207712_1000016430 1004
218 3300025972 Ga0207668_10001056 Ga0207668_100010568 1004
219 3300005293 Ga0065715_10091322 Ga0065715_100913222 1005
220 3300046537 Ga0495598_0001001 Ga0495598_0001001_2067_5321 1005
221 3300005343 Ga0070687_100001292 Ga0070687_1000012926 1006
222 3300006237 Ga0097621_100007866 Ga0097621_1000078662 1006
223 3300006358 Ga0068871_100009123 Ga0068871_1000091234 1006
224 3300009098 Ga0105245_10021981 Ga0105245_100219812 1006
225 3300009148 Ga0105243_10015118 Ga0105243_100151182 1006
226 3300025918 Ga0207662_10000900 Ga0207662_100009002 1006
227 3300025935 Ga0207709_10003272 Ga0207709_100032729 1006
228 3300025940 Ga0207691_10011098 Ga0207691_100110986 1006
229 3300005441 Ga0070700_100012795 Ga0070700_1000127952 1007
230 3300014325 Ga0163163_10002277 Ga0163163_100022775 1007
231 3300026075 Ga0207708_10009878 Ga0207708_100098783 1007
232 3300042157 Ga0439458_0003721 Ga0439458_0003721_131_3433 1007
233 3300025900 Ga0207710_10002109 Ga0207710_100021098 1008
234 3300005353 Ga0070669_100023755 Ga0070669_1000237552 1009
235 3300005330 Ga0070690_100010235 Ga0070690_1000102353 1010
236 3300005338 Ga0068868_100037182 Ga0068868_1000371822 1010
237 3300005536 Ga0070697_100000983 Ga0070697_1000009832 1010
238 3300025936 Ga0207670_10002555 Ga0207670_100025559 1011
239 3300005471 Ga0070698_100005088 Ga0070698_1000050889 1012
240 3300009147 Ga0114129_10032605 Ga0114129_100326054 1013
241 3300013308 Ga0157375_10053048 Ga0157375_100530482 1013
242 3300031731 Ga0307405_10007108 Ga0307405_100071081 1013
243 3300031901 Ga0307406_10002329 Ga0307406_100023295 1013
244 3300032004 Ga0307414_10002257 Ga0307414_100022575 1013
245 3300049707 Ga0501234_000821 Ga0501234_000821_1145_4366 1013
246 3300050507 nmdc:mga05p37_22080_c1 nmdc:mga05p37_22080_c1_2248_5505 1013
247 3300005331 Ga0070670_100013213 Ga0070670_1000132134 1014
248 3300005547 Ga0070693_100001971 Ga0070693_1000019717 1014
249 3300005719 Ga0068861_100005638 Ga0068861_1000056385 1014
250 3300005842 Ga0068858_100034462 Ga0068858_1000344622 1014
251 3300005844 Ga0068862_100010229 Ga0068862_1000102291 1014
252 3300006914 Ga0075436_100009702 Ga0075436_1000097023 1014
253 3300009545 Ga0105237_10001605 Ga0105237_1000160514 1014
254 3300009553 Ga0105249_10014783 Ga0105249_100147831 1014
255 3300028380 Ga0268265_10009096 Ga0268265_100090963 1014
256 3300005336 Ga0070680_100005143 Ga0070680_1000051439 1015
257 3300009147 Ga0114129_10029864 Ga0114129_100298643 1015
258 3300025904 Ga0207647_10000801 Ga0207647_1000080122 1015
259 3300050515 nmdc:mga0a205_24292_c1 nmdc:mga0a205_24292_c1_1558_4773 1015
260 3300005288 Ga0065714_10002186 Ga0065714_1000218643 1016
261 3300005290 Ga0065712_10000113 Ga0065712_1000011343 1016
262 3300005842 Ga0068858_100012079 Ga0068858_1000120792 1016
263 3300013297 Ga0157378_10007811 Ga0157378_100078112 1016
264 3300014326 Ga0157380_10001478 Ga0157380_1000147812 1016
265 3300025923 Ga0207681_10023287 Ga0207681_100232872 1016
266 3300026095 Ga0207676_10007589 Ga0207676_100075894 1016
267 3300005355 Ga0070671_100005941 Ga0070671_1000059417 1017
268 3300005518 Ga0070699_100006382 Ga0070699_1000063829 1017
269 3300005617 Ga0068859_100043757 Ga0068859_1000437573 1017
270 3300006931 Ga0097620_100043763 Ga0097620_1000437633 1017
271 3300013306 Ga0163162_10000539 Ga0163162_1000053917 1017
272 3300005536 Ga0070697_100004343 Ga0070697_1000043435 1018
273 3300009551 Ga0105238_10009924 Ga0105238_100099242 1018
274 3300013306 Ga0163162_10017227 Ga0163162_100172276 1018
275 3300049574 Ga0501038_0012043 Ga0501038_0012043_873_4064 1018
276 3300005444 Ga0070694_100007992 Ga0070694_1000079922 1019
277 3300005467 Ga0070706_100000019 Ga0070706_100000019134 1020
278 3300013100 Ga0157373_10024168 Ga0157373_100241682 1020
279 3300025910 Ga0207684_10000079 Ga0207684_1000007996 1020
280 3300025918 Ga0207662_10010604 Ga0207662_100106043 1020
281 3300050515 nmdc:mga0a205_20112_c1 nmdc:mga0a205_20112_c1_2036_5257 1020
282 3300013297 Ga0157378_10049300 Ga0157378_100493001 1021
283 3300002459 JGI24751J29686_10000013 JGI24751J29686_1000001389 1022
284 3300005331 Ga0070670_100001988 Ga0070670_1000019884 1022
285 3300005985 Ga0081539_10005899 Ga0081539_100058992 1022
286 3300014325 Ga0163163_10001169 Ga0163163_100011699 1022
287 3300025925 Ga0207650_10000001 Ga0207650_10000001139 1022
288 3300025941 Ga0207711_10017510 Ga0207711_100175104 1024
289 3300005458 Ga0070681_10000273 Ga0070681_1000027327 1027
290 3300005530 Ga0070679_100001215 Ga0070679_10000121514 1027
291 3300025912 Ga0207707_10000008 Ga0207707_10000008149 1027
292 3300025921 Ga0207652_10000065 Ga0207652_1000006549 1027
293 3300005458 Ga0070681_10002209 Ga0070681_100022095 1028
294 3300005530 Ga0070679_100000737 Ga0070679_10000073713 1028
295 3300005564 Ga0070664_100005118 Ga0070664_1000051189 1028
296 3300005577 Ga0068857_100000993 Ga0068857_10000099315 1028
297 3300005618 Ga0068864_100032135 Ga0068864_1000321352 1028
298 3300026095 Ga0207676_10027345 Ga0207676_100273452 1028
299 3300026116 Ga0207674_10000079 Ga0207674_1000007918 1028
300 3300026078 Ga0207702_10038934 Ga0207702_100389342 1032
301 3300048907 Ga0496104_0009333 Ga0496104_0009333_5078_8302 1032
302 3300000532 CNAas_1000052 CNAas_10000521 1061

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12838

Fer4_7

4Fe-4S dicluster domain

854

928

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lod-assembly1.cif.gz_B cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.8727 86 1061
6lod-assembly1.cif.gz_B cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii 0.8673 86 1061
6f0k-assembly1.cif.gz_B alternative complex iii 0.8311 87 1060
6f0k-assembly1.cif.gz_B alternative complex iii 0.8278 87 1060
6btm-assembly1.cif.gz_B structure of alternative complex iii from flavobacterium johnsoniae (wild type) 0.8076 87 1055
ID Description Score Start End Superfamily
af_Q60314_222_377_3.40.50.740 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7996 396 506 3.40.50.740
2vpwA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.745 404 512 3.40.50.740
af_P77783_422_617_3.40.50.740 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7164 409 536 3.40.50.740
af_P33602_508_691_3.40.50.740 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7094 406 534 3.40.50.740
1qcsA01 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.695 654 714 2.40.40.20
ID Description Score Start End GO Terms
AF-A0A2M8NH63-F1-model_v4 Molybdopterin oxidoreductase 0.9718 207 497
AF-A0A2M8NH63-F1-model_v4 Molybdopterin oxidoreductase 0.9189 207 497
AF-A0A832GK12-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9187 204 351
AF-A0A2V7YCY0-F1-model_v4 Molybdopterin oxidoreductase 0.8996 203 1061 GO:0051539
AF-A0A2V7YCY0-F1-model_v4 Molybdopterin oxidoreductase 0.8953 203 1061 GO:0051539

Feature Viewer

pLDDT pTM Quality
78.05 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map