F396681
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 193 | 302 | 1016 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0006734|Ga0495672_0006734_4498_7830 |
| Length | 1090 |
| Sequence | MSEDRHINFKLMRERVLAEQGGGMSGKSYWRSLEELADSPEFREFVEREYPQHAEEWHDPVERRTFLKLMGASMALAGLSGCAFQPAEKIVPNVKQSEDSVPGKALFFATASSLGGIATPLLARSNEGRPTKLEGNPDHPNSRNADXEDRGSSATDIFSQASVLSLYDPDRSQIPLFREESRTWSTFVGELRTALDEQRPKQGAGIRFLTETITSPTLAAQLKGILTEFPQAKWHQYEPVNNDNARAGAMMAFGQPVNTTYDFTKADRILALDADFLSAHPGMLKYARDFASRRRPPKDPGNVDIGGIPDGYLWMNRLYVIETTPTTTGAAADHHWAVKPSEFERVARDLAGGIVSLGSSTGTPEGQSSTEVKPDGTTVEKRQIVSVGTAQPGELSLQDVLSLTSDLREHKGTSIVIAGREAPPQVHALAHAMNNALGNVGKTVFYTDSLEANSVDQRQSLQELLKDIDDGHVEMLLIIGGNPVYNTPADLKLNQERMFKPKLRVHLSQYRDETSSFCHWHIPESHYLETWSDTRAYDGTVSIVQPLIEPLYQSKSAHEFLAVFTPQYDKKPYEIVRDCWRSQQSAVPKPAATPSPDFESWWRKCVHDGFVPGTALVPKSVTPTQNQPAINYNVQASTTGPFEIVFRTDPTIYDGRFANNGWLQELPKPLSKLTWDNAALISPNTAKQLGITKTIGKKGGDIYVDTLKITHQGRTFEDMVPTWITPGQPDGVVTIHLGYGRTHAGNTGNGHGFNAYQIRTSDSPWSAGGVQVEKGSGQALVAVTQLHFLLEDRDFSKEDRDILRSQTLDEYMKGTPAGESHDPAADDTLYQPFDYKNQGNGLDYAWGMAIDLNNCIGCNACTIACQSENNIPVVGKEQVVRSREMHWIRIDTYFKGEDANQPEATNFMPVPCMHCENAPCEPVCPVHATVHSAEGLNDMVYNRCVGTKYCQNNCPYKVRRFNFFLYQDWEKPTYQLMRNPEVSIRSRGVMEKCTYCVQRIQGAKIQAEIRSETEGKQVRVRDGDIVTACQAVCPTEAIVFGDINDPNSRVSQLKADRRDYSLLAELNTKPRTTYLTALRNPNPEIKKQEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 66 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 67 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 143 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 144 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 145 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 146 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 152 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 153 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 154 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 155 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 156 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 157 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 158 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 159 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 160 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 161 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 173 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 182 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 185 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.01 |
| Metatranscriptomes | 0.99 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.32 |
| Nodule | 0 |
| Rhizoplane | 1.99 |
| Rhizosphere | 95.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1000052 | 3300000532 | Bacteria | 8245 |
| 2 | JGI24741J21665_1000465 | 3300001915 | Bacteria | 12341 |
| 3 | JGI24740J21852_10000530 | 3300001979 | Bacteria | 16298 |
| 4 | JGI24751J29686_10000013 | 3300002459 | Bacteria | 113565 |
| 5 | rootH2_10005673 | 3300003320 | Bacteria | 75939 |
| 6 | Ga0058862_10061456 | 3300004803 | Bacteria | 7933 |
| 7 | Ga0065714_10002186 | 3300005288 | Bacteria | 191932 |
| 8 | Ga0065712_10000113 | 3300005290 | Bacteria | 191931 |
| 9 | Ga0065715_10091322 | 3300005293 | Bacteria | 5887 |
| 10 | Ga0070658_10021364 | 3300005327 | Bacteria | 5188 |
| 11 | Ga0070676_10004427 | 3300005328 | Bacteria | 7391 |
| 12 | Ga0070683_100000033 | 3300005329 | Bacteria | 135305 |
| 13 | Ga0070690_100001847 | 3300005330 | Bacteria | 11237 |
| 14 | Ga0070690_100010235 | 3300005330 | Bacteria | 5452 |
| 15 | Ga0070670_100001988 | 3300005331 | Bacteria | 16709 |
| 16 | Ga0070670_100003304 | 3300005331 | Bacteria | 13344 |
| 17 | Ga0070670_100008319 | 3300005331 | Bacteria | 8842 |
| 18 | Ga0070670_100013213 | 3300005331 | Bacteria | 7073 |
| 19 | Ga0068869_100003009 | 3300005334 | Bacteria | 10251 |
| 20 | Ga0068869_100023343 | 3300005334 | Bacteria | 4270 |
| 21 | Ga0070666_10002924 | 3300005335 | Bacteria | 10330 |
| 22 | Ga0070666_10020274 | 3300005335 | Bacteria | 4297 |
| 23 | Ga0070680_100005143 | 3300005336 | Bacteria | 9886 |
| 24 | Ga0070680_100008934 | 3300005336 | Bacteria | 7682 |
| 25 | Ga0070680_100026058 | 3300005336 | Bacteria | 4676 |
| 26 | Ga0070682_100000076 | 3300005337 | Bacteria | 90097 |
| 27 | Ga0070682_100005775 | 3300005337 | Bacteria | 6906 |
| 28 | Ga0068868_100006831 | 3300005338 | Bacteria | 8101 |
| 29 | Ga0068868_100012560 | 3300005338 | Bacteria | 6193 |
| 30 | Ga0068868_100037182 | 3300005338 | Bacteria | 3773 |
| 31 | Ga0070689_100012981 | 3300005340 | Bacteria | 6018 |
| 32 | Ga0070691_10001388 | 3300005341 | Bacteria | 10341 |
| 33 | Ga0070687_100001292 | 3300005343 | Bacteria | 8733 |
| 34 | Ga0070661_100006901 | 3300005344 | Bacteria | 7832 |
| 35 | Ga0070692_10012961 | 3300005345 | Bacteria | 3876 |
| 36 | Ga0070668_100001118 | 3300005347 | Bacteria | 18921 |
| 37 | Ga0070669_100001323 | 3300005353 | Bacteria | 17869 |
| 38 | Ga0070669_100001921 | 3300005353 | Bacteria | 15002 |
| 39 | Ga0070669_100023755 | 3300005353 | Bacteria | 4393 |
| 40 | Ga0070675_100002457 | 3300005354 | Bacteria | 13856 |
| 41 | Ga0070671_100005941 | 3300005355 | Bacteria | 9725 |
| 42 | Ga0070673_100001253 | 3300005364 | Bacteria | 14749 |
| 43 | Ga0070688_100005362 | 3300005365 | Bacteria | 6743 |
| 44 | Ga0070659_100036886 | 3300005366 | Bacteria | 3811 |
| 45 | Ga0070667_100004354 | 3300005367 | Bacteria | 11944 |
| 46 | Ga0070700_100012795 | 3300005441 | Bacteria | 4698 |
| 47 | Ga0070694_100007992 | 3300005444 | Bacteria | 6463 |
| 48 | Ga0070694_100019113 | 3300005444 | Bacteria | 4356 |
| 49 | Ga0070708_100000137 | 3300005445 | Bacteria | 50233 |
| 50 | Ga0070662_100021258 | 3300005457 | Bacteria | 4429 |
| 51 | Ga0070681_10000273 | 3300005458 | Bacteria | 41372 |
| 52 | Ga0070681_10001057 | 3300005458 | Bacteria | 23417 |
| 53 | Ga0070681_10002209 | 3300005458 | Bacteria | 17745 |
| 54 | Ga0070681_10007055 | 3300005458 | Bacteria | 10939 |
| 55 | Ga0070681_10017990 | 3300005458 | Bacteria | 7062 |
| 56 | Ga0070706_100000019 | 3300005467 | Bacteria | 166483 |
| 57 | Ga0070706_100001324 | 3300005467 | Bacteria | 26322 |
| 58 | Ga0070706_100005412 | 3300005467 | Bacteria | 12159 |
| 59 | Ga0070707_100000651 | 3300005468 | Bacteria | 34704 |
| 60 | Ga0070698_100000902 | 3300005471 | Bacteria | 32626 |
| 61 | Ga0070698_100002590 | 3300005471 | Bacteria | 19918 |
| 62 | Ga0070698_100005088 | 3300005471 | Bacteria | 14398 |
| 63 | Ga0070699_100000439 | 3300005518 | Bacteria | 39981 |
| 64 | Ga0070699_100006382 | 3300005518 | Bacteria | 10278 |
| 65 | Ga0070679_100000737 | 3300005530 | Bacteria | 28290 |
| 66 | Ga0070679_100001215 | 3300005530 | Bacteria | 22690 |
| 67 | Ga0070679_100006475 | 3300005530 | Bacteria | 10916 |
| 68 | Ga0070679_100006834 | 3300005530 | Bacteria | 10637 |
| 69 | Ga0070684_100029772 | 3300005535 | Bacteria | 4631 |
| 70 | Ga0070697_100000265 | 3300005536 | Bacteria | 42493 |
| 71 | Ga0070697_100000983 | 3300005536 | Bacteria | 21549 |
| 72 | Ga0070697_100004343 | 3300005536 | Bacteria | 10874 |
| 73 | Ga0068853_100002977 | 3300005539 | Bacteria | 12913 |
| 74 | Ga0068853_100022256 | 3300005539 | Bacteria | 5292 |
| 75 | Ga0070672_100000166 | 3300005543 | Bacteria | 36328 |
| 76 | Ga0070693_100001971 | 3300005547 | Bacteria | 9391 |
| 77 | Ga0070665_100006963 | 3300005548 | Bacteria | 11495 |
| 78 | Ga0068855_100037615 | 3300005563 | Bacteria | 5753 |
| 79 | Ga0070664_100003396 | 3300005564 | Bacteria | 12856 |
| 80 | Ga0070664_100005118 | 3300005564 | Bacteria | 10524 |
| 81 | Ga0068857_100000993 | 3300005577 | Bacteria | 21789 |
| 82 | Ga0068856_100028036 | 3300005614 | Bacteria | 5495 |
| 83 | Ga0070702_100016193 | 3300005615 | Bacteria | 3822 |
| 84 | Ga0068852_100007405 | 3300005616 | Bacteria | 8011 |
| 85 | Ga0068859_100024990 | 3300005617 | Bacteria | 5996 |
| 86 | Ga0068859_100043757 | 3300005617 | Bacteria | 4500 |
| 87 | Ga0068864_100007825 | 3300005618 | Bacteria | 8807 |
| 88 | Ga0068864_100032135 | 3300005618 | Bacteria | 4457 |
| 89 | Ga0068861_100005638 | 3300005719 | Bacteria | 8490 |
| 90 | Ga0068870_10000136 | 3300005840 | Bacteria | 25517 |
| 91 | Ga0068858_100012079 | 3300005842 | Bacteria | 8138 |
| 92 | Ga0068858_100013352 | 3300005842 | Bacteria | 7748 |
| 93 | Ga0068858_100034462 | 3300005842 | Bacteria | 4696 |
| 94 | Ga0068862_100002024 | 3300005844 | Bacteria | 18363 |
| 95 | Ga0068862_100010229 | 3300005844 | Bacteria | 7740 |
| 96 | Ga0081455_10030785 | 3300005937 | Bacteria | 4870 |
| 97 | Ga0081539_10001769 | 3300005985 | Bacteria | 34433 |
| 98 | Ga0081539_10005899 | 3300005985 | Bacteria | 12114 |
| 99 | Ga0075365_10000761 | 3300006038 | Bacteria | 13103 |
| 100 | Ga0097621_100007866 | 3300006237 | Bacteria | 7647 |
| 101 | Ga0075370_10003796 | 3300006353 | Bacteria | 7232 |
| 102 | Ga0068871_100009123 | 3300006358 | Bacteria | 7167 |
| 103 | Ga0068871_100017546 | 3300006358 | Bacteria | 5420 |
| 104 | Ga0075428_100045998 | 3300006844 | Bacteria | 4795 |
| 105 | Ga0075431_100002296 | 3300006847 | Bacteria | 18361 |
| 106 | Ga0075434_100007662 | 3300006871 | Bacteria | 9989 |
| 107 | Ga0075434_100013687 | 3300006871 | Bacteria | 7733 |
| 108 | Ga0075436_100009702 | 3300006914 | Bacteria | 6586 |
| 109 | Ga0097620_100024991 | 3300006931 | Bacteria | 5996 |
| 110 | Ga0097620_100043763 | 3300006931 | Bacteria | 4500 |
| 111 | Ga0075435_100005050 | 3300007076 | Bacteria | 9168 |
| 112 | Ga0105240_10000137 | 3300009093 | Bacteria | 149925 |
| 113 | Ga0105240_10074435 | 3300009093 | Bacteria | 4192 |
| 114 | Ga0111539_10001481 | 3300009094 | Bacteria | 31365 |
| 115 | Ga0111539_10001618 | 3300009094 | Bacteria | 30088 |
| 116 | Ga0111539_10033885 | 3300009094 | Bacteria | 6196 |
| 117 | Ga0105245_10000052 | 3300009098 | Bacteria | 126402 |
| 118 | Ga0105245_10021981 | 3300009098 | Bacteria | 5598 |
| 119 | Ga0114129_10029864 | 3300009147 | Bacteria | 7720 |
| 120 | Ga0114129_10032605 | 3300009147 | Bacteria | 7361 |
| 121 | Ga0105243_10015118 | 3300009148 | Bacteria | 5842 |
| 122 | Ga0105248_10008939 | 3300009177 | Bacteria | 11017 |
| 123 | Ga0105248_10042976 | 3300009177 | Bacteria | 5067 |
| 124 | Ga0105237_10001605 | 3300009545 | Bacteria | 29357 |
| 125 | Ga0105237_10006838 | 3300009545 | Bacteria | 12570 |
| 126 | Ga0105238_10009924 | 3300009551 | Bacteria | 9546 |
| 127 | Ga0105238_10012970 | 3300009551 | Bacteria | 8414 |
| 128 | Ga0105249_10000480 | 3300009553 | Bacteria | 37106 |
| 129 | Ga0105249_10014783 | 3300009553 | Bacteria | 6899 |
| 130 | Ga0105239_10044152 | 3300010375 | Bacteria | 4886 |
| 131 | Ga0157373_10024168 | 3300013100 | Bacteria | 4403 |
| 132 | Ga0157370_10010055 | 3300013104 | Bacteria | 10004 |
| 133 | Ga0157370_10021172 | 3300013104 | Bacteria | 6483 |
| 134 | Ga0157378_10007811 | 3300013297 | Bacteria | 9338 |
| 135 | Ga0157378_10049300 | 3300013297 | Bacteria | 3746 |
| 136 | Ga0163162_10000477 | 3300013306 | Bacteria | 37086 |
| 137 | Ga0163162_10000539 | 3300013306 | Bacteria | 34986 |
| 138 | Ga0163162_10001294 | 3300013306 | Bacteria | 23375 |
| 139 | Ga0163162_10017227 | 3300013306 | Bacteria | 7069 |
| 140 | Ga0157375_10000059 | 3300013308 | Bacteria | 118614 |
| 141 | Ga0157375_10000396 | 3300013308 | Bacteria | 39655 |
| 142 | Ga0157375_10003903 | 3300013308 | Bacteria | 12930 |
| 143 | Ga0157375_10053048 | 3300013308 | Bacteria | 3988 |
| 144 | Ga0163163_10001169 | 3300014325 | Bacteria | 22322 |
| 145 | Ga0163163_10002277 | 3300014325 | Bacteria | 16189 |
| 146 | Ga0163163_10002445 | 3300014325 | Bacteria | 15711 |
| 147 | Ga0163163_10008771 | 3300014325 | Bacteria | 8999 |
| 148 | Ga0157380_10001478 | 3300014326 | Bacteria | 15379 |
| 149 | Ga0157379_10043236 | 3300014968 | Bacteria | 4022 |
| 150 | Ga0157376_10011154 | 3300014969 | Bacteria | 6612 |
| 151 | Ga0206353_10537404 | 3300020082 | Bacteria | 5881 |
| 152 | Ga0224712_10005442 | 3300022467 | Bacteria | 3546 |
| 153 | Ga0207697_10008801 | 3300025315 | Bacteria | 4394 |
| 154 | Ga0207653_10001391 | 3300025885 | Bacteria | 7838 |
| 155 | Ga0207710_10002109 | 3300025900 | Bacteria | 9404 |
| 156 | Ga0207688_10007346 | 3300025901 | Bacteria | 5997 |
| 157 | Ga0207647_10000240 | 3300025904 | Bacteria | 44855 |
| 158 | Ga0207647_10000801 | 3300025904 | Bacteria | 24373 |
| 159 | Ga0207645_10015529 | 3300025907 | Bacteria | 5057 |
| 160 | Ga0207705_10001704 | 3300025909 | Bacteria | 17461 |
| 161 | Ga0207705_10001799 | 3300025909 | Bacteria | 16906 |
| 162 | Ga0207684_10000079 | 3300025910 | Bacteria | 179842 |
| 163 | Ga0207684_10024329 | 3300025910 | Bacteria | 5164 |
| 164 | Ga0207707_10000008 | 3300025912 | Bacteria | 330313 |
| 165 | Ga0207707_10000295 | 3300025912 | Bacteria | 53118 |
| 166 | Ga0207707_10000627 | 3300025912 | Bacteria | 35031 |
| 167 | Ga0207707_10001295 | 3300025912 | Bacteria | 23292 |
| 168 | Ga0207707_10004620 | 3300025912 | Bacteria | 12097 |
| 169 | Ga0207707_10006114 | 3300025912 | Bacteria | 10523 |
| 170 | Ga0207671_10009323 | 3300025914 | Bacteria | 8216 |
| 171 | Ga0207660_10000464 | 3300025917 | Bacteria | 26807 |
| 172 | Ga0207660_10000525 | 3300025917 | Bacteria | 25613 |
| 173 | Ga0207660_10005981 | 3300025917 | Bacteria | 7901 |
| 174 | Ga0207662_10000900 | 3300025918 | Bacteria | 13738 |
| 175 | Ga0207662_10010604 | 3300025918 | Bacteria | 5095 |
| 176 | Ga0207657_10004931 | 3300025919 | Bacteria | 14032 |
| 177 | Ga0207649_10004211 | 3300025920 | Bacteria | 7835 |
| 178 | Ga0207652_10000065 | 3300025921 | Bacteria | 111252 |
| 179 | Ga0207652_10000148 | 3300025921 | Bacteria | 75801 |
| 180 | Ga0207652_10001216 | 3300025921 | Bacteria | 23078 |
| 181 | Ga0207652_10006259 | 3300025921 | Bacteria | 9608 |
| 182 | Ga0207646_10000494 | 3300025922 | Bacteria | 52791 |
| 183 | Ga0207681_10000879 | 3300025923 | Bacteria | 19782 |
| 184 | Ga0207681_10002712 | 3300025923 | Bacteria | 11216 |
| 185 | Ga0207681_10023287 | 3300025923 | Bacteria | 3959 |
| 186 | Ga0207694_10028592 | 3300025924 | Bacteria | 4250 |
| 187 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 188 | Ga0207650_10002322 | 3300025925 | Bacteria | 13255 |
| 189 | Ga0207659_10005272 | 3300025926 | Bacteria | 7833 |
| 190 | Ga0207687_10000005 | 3300025927 | Bacteria | 770649 |
| 191 | Ga0207687_10008058 | 3300025927 | Bacteria | 6894 |
| 192 | Ga0207706_10005693 | 3300025933 | Bacteria | 11608 |
| 193 | Ga0207709_10003272 | 3300025935 | Bacteria | 9718 |
| 194 | Ga0207670_10002555 | 3300025936 | Bacteria | 9555 |
| 195 | Ga0207691_10011098 | 3300025940 | Bacteria | 8649 |
| 196 | Ga0207691_10013097 | 3300025940 | Bacteria | 7939 |
| 197 | Ga0207691_10017673 | 3300025940 | Bacteria | 6760 |
| 198 | Ga0207711_10005158 | 3300025941 | Bacteria | 11066 |
| 199 | Ga0207711_10017510 | 3300025941 | Bacteria | 5952 |
| 200 | Ga0207689_10002833 | 3300025942 | Bacteria | 16002 |
| 201 | Ga0207689_10020541 | 3300025942 | Bacteria | 5556 |
| 202 | Ga0207661_10000006 | 3300025944 | Bacteria | 537727 |
| 203 | Ga0207679_10003732 | 3300025945 | Bacteria | 9443 |
| 204 | Ga0207667_10047913 | 3300025949 | Bacteria | 4520 |
| 205 | Ga0207712_10000164 | 3300025961 | Bacteria | 68361 |
| 206 | Ga0207668_10001056 | 3300025972 | Bacteria | 16429 |
| 207 | Ga0207677_10009822 | 3300026023 | Bacteria | 5393 |
| 208 | Ga0207703_10015752 | 3300026035 | Bacteria | 5897 |
| 209 | Ga0207639_10005198 | 3300026041 | Bacteria | 8780 |
| 210 | Ga0207678_10003106 | 3300026067 | Bacteria | 15041 |
| 211 | Ga0207678_10018949 | 3300026067 | Bacteria | 6048 |
| 212 | Ga0207708_10009878 | 3300026075 | Bacteria | 7086 |
| 213 | Ga0207702_10014693 | 3300026078 | Bacteria | 6496 |
| 214 | Ga0207702_10038934 | 3300026078 | Bacteria | 3982 |
| 215 | Ga0207676_10007589 | 3300026095 | Bacteria | 7698 |
| 216 | Ga0207676_10027345 | 3300026095 | Bacteria | 4247 |
| 217 | Ga0207676_10030114 | 3300026095 | Bacteria | 4070 |
| 218 | Ga0207674_10000079 | 3300026116 | Bacteria | 102085 |
| 219 | Ga0207674_10003058 | 3300026116 | Bacteria | 20694 |
| 220 | Ga0207674_10024833 | 3300026116 | Bacteria | 6397 |
| 221 | Ga0207698_10004107 | 3300026142 | Bacteria | 8841 |
| 222 | Ga0207428_10004803 | 3300027907 | Bacteria | 12761 |
| 223 | Ga0207428_10007605 | 3300027907 | Bacteria | 9871 |
| 224 | Ga0207428_10021261 | 3300027907 | Bacteria | 5495 |
| 225 | Ga0268266_10013170 | 3300028379 | Bacteria | 7132 |
| 226 | Ga0268265_10009096 | 3300028380 | Bacteria | 6716 |
| 227 | Ga0265330_10000765 | 3300031235 | Bacteria | 20208 |
| 228 | Ga0307408_100018415 | 3300031548 | Bacteria | 4688 |
| 229 | Ga0307405_10007108 | 3300031731 | Bacteria | 5566 |
| 230 | Ga0307406_10002329 | 3300031901 | Bacteria | 10323 |
| 231 | Ga0307409_100013674 | 3300031995 | Bacteria | 5239 |
| 232 | Ga0307416_100002993 | 3300032002 | Bacteria | 9858 |
| 233 | Ga0307416_100017367 | 3300032002 | Bacteria | 5033 |
| 234 | Ga0307414_10002257 | 3300032004 | Bacteria | 10072 |
| 235 | Ga0307414_10018953 | 3300032004 | Bacteria | 4253 |
| 236 | Ga0373954_0004342 | 3300035118 | Bacteria | 6095 |
| 237 | Ga0373924_0000284 | 3300035410 | Bacteria | 15573 |
| 238 | Ga0373924_0008956 | 3300035410 | Bacteria | 3657 |
| 239 | Ga0373937_0000340 | 3300036401 | Bacteria | 44240 |
| 240 | Ga0373937_0005772 | 3300036401 | Bacteria | 10641 |
| 241 | Ga0373937_0009459 | 3300036401 | Bacteria | 8472 |
| 242 | Ga0373925_0004331 | 3300037068 | Bacteria | 10742 |
| 243 | Ga0395900_0000013 | 3300037418 | Bacteria | 388765 |
| 244 | Ga0395900_0000735 | 3300037418 | Bacteria | 43503 |
| 245 | Ga0395898_0030568 | 3300037466 | Bacteria | 5389 |
| 246 | Ga0395905_0000065 | 3300037471 | Bacteria | 184928 |
| 247 | Ga0395905_0048396 | 3300037471 | Bacteria | 3985 |
| 248 | Ga0395901_0066272 | 3300038443 | Bacteria | 3761 |
| 249 | Ga0436365_0051833 | 3300039437 | Bacteria | 32975 |
| 250 | Ga0436365_0776493 | 3300039437 | Bacteria | 5435 |
| 251 | Ga0436365_1238698 | 3300039437 | Bacteria | 6628 |
| 252 | Ga0436361_0085822 | 3300039447 | Bacteria | 6255 |
| 253 | Ga0439458_0003721 | 3300042157 | Bacteria | 3537 |
| 254 | Ga0439434_0006038 | 3300042435 | Bacteria | 3533 |
| 255 | Ga0466966_0003650 | 3300044684 | Bacteria | 10160 |
| 256 | Ga0466966_0009452 | 3300044684 | Bacteria | 6458 |
| 257 | Ga0466964_0015785 | 3300044706 | Bacteria | 2875 |
| 258 | Ga0466957_0003501 | 3300044842 | Bacteria | 8626 |
| 259 | Ga0451576_0009423 | 3300045051 | Bacteria | 11317 |
| 260 | Ga0451576_0059789 | 3300045051 | Bacteria | 3977 |
| 261 | Ga0495584_0010813 | 3300046491 | Bacteria | 4685 |
| 262 | Ga0495663_0000189 | 3300046525 | Bacteria | 24645 |
| 263 | Ga0495598_0001001 | 3300046537 | Bacteria | 5419 |
| 264 | Ga0495609_0000697 | 3300046538 | Bacteria | 25847 |
| 265 | Ga0495604_0023584 | 3300047317 | Bacteria | 4909 |
| 266 | Ga0495672_0006734 | 3300047320 | Bacteria | 8820 |
| 267 | Ga0496104_0009333 | 3300048907 | Bacteria | 8725 |
| 268 | Ga0496105_0007596 | 3300048908 | Bacteria | 8405 |
| 269 | Ga0496106_0024782 | 3300048909 | Bacteria | 4461 |
| 270 | Ga0496109_0001048 | 3300048912 | Bacteria | 22875 |
| 271 | Ga0496112_0013708 | 3300048915 | Bacteria | 7493 |
| 272 | Ga0496115_0022841 | 3300048918 | Bacteria | 4850 |
| 273 | Ga0501034_0006563 | 3300049571 | Bacteria | 12495 |
| 274 | Ga0501034_0019471 | 3300049571 | Bacteria | 6941 |
| 275 | Ga0501034_0043131 | 3300049571 | Bacteria | 4566 |
| 276 | Ga0501038_0012043 | 3300049574 | Bacteria | 7897 |
| 277 | Ga0501039_0007746 | 3300049575 | Bacteria | 8194 |
| 278 | Ga0501040_0013516 | 3300049576 | Bacteria | 5367 |
| 279 | Ga0501042_0017435 | 3300049578 | Bacteria | 4952 |
| 280 | Ga0501072_0019889 | 3300049588 | Bacteria | 5196 |
| 281 | Ga0501075_0007748 | 3300049591 | Bacteria | 7450 |
| 282 | Ga0501077_0009671 | 3300049593 | Bacteria | 5994 |
| 283 | Ga0501234_000821 | 3300049707 | Bacteria | 4868 |
| 284 | Ga0501081_0005536 | 3300049743 | Bacteria | 8151 |
| 285 | Ga0501035_0002249 | 3300049822 | Bacteria | 19116 |
| 286 | nmdc:mga0k408_3255_c1 | 3300050493 | Bacteria | 8593 |
| 287 | nmdc:mga07m45_2089_c1 | 3300050496 | Bacteria | 9274 |
| 288 | nmdc:mga05p37_22080_c1 | 3300050507 | Bacteria | 6711 |
| 289 | nmdc:mga06r32_24427_c1 | 3300050510 | Bacteria | 5609 |
| 290 | nmdc:mga06r32_4306_c1 | 3300050510 | Bacteria | 12739 |
| 291 | nmdc:mga08y16_26948_c1 | 3300050511 | Bacteria | 6057 |
| 292 | nmdc:mga0n895_2321_c1 | 3300050512 | Bacteria | 14818 |
| 293 | nmdc:mga0rr50_110_c2 | 3300050513 | Bacteria | 25403 |
| 294 | nmdc:mga0a205_131_c1 | 3300050515 | Bacteria | 46472 |
| 295 | nmdc:mga0a205_1555_c1 | 3300050515 | Bacteria | 19642 |
| 296 | nmdc:mga0a205_20112_c1 | 3300050515 | Bacteria | 6298 |
| 297 | nmdc:mga0a205_24292_c1 | 3300050515 | Bacteria | 5761 |
| 298 | nmdc:mga0a205_51983_c2 | 3300050515 | Bacteria | 2988 |
| 299 | nmdc:mga0a205_85684_c1 | 3300050515 | Bacteria | 3042 |
| 300 | Ga0501084_0022976 | 3300054114 | Bacteria | 5205 |
| 301 | Ga0530510_0003979 | 3300061734 | Bacteria | 10196 |
| 302 | Ga0530510_0037123 | 3300061734 | Bacteria | 3512 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044706 | Ga0466964_0015785 | Ga0466964_0015785_66_2840 | 847 |
| 2 | 3300037471 | Ga0395905_0000065 | Ga0395905_0000065_24321_27047 | 865 |
| 3 | 3300001915 | JGI24741J21665_1000465 | JGI24741J21665_10004653 | 878 |
| 4 | 3300050515 | nmdc:mga0a205_85684_c1 | nmdc:mga0a205_85684_c1_36_2921 | 882 |
| 5 | 3300025927 | Ga0207687_10008058 | Ga0207687_100080586 | 885 |
| 6 | 3300039437 | Ga0436365_0776493 | Ga0436365_0776493_1570_4434 | 889 |
| 7 | 3300046491 | Ga0495584_0010813 | Ga0495584_0010813_829_3651 | 895 |
| 8 | 3300046538 | Ga0495609_0000697 | Ga0495609_0000697_5906_8728 | 895 |
| 9 | 3300044684 | Ga0466966_0003650 | Ga0466966_0003650_3530_6388 | 897 |
| 10 | 3300025920 | Ga0207649_10004211 | Ga0207649_100042116 | 900 |
| 11 | 3300025945 | Ga0207679_10003732 | Ga0207679_100037325 | 900 |
| 12 | 3300039437 | Ga0436365_0051833 | Ga0436365_0051833_6989_9871 | 903 |
| 13 | 3300022467 | Ga0224712_10005442 | Ga0224712_100054421 | 908 |
| 14 | 3300039437 | Ga0436365_1238698 | Ga0436365_1238698_402_3320 | 909 |
| 15 | 3300014969 | Ga0157376_10011154 | Ga0157376_100111545 | 913 |
| 16 | 3300003320 | rootH2_10005673 | rootH2_1000567379 | 916 |
| 17 | 3300005344 | Ga0070661_100006901 | Ga0070661_1000069016 | 916 |
| 18 | 3300005458 | Ga0070681_10001057 | Ga0070681_100010577 | 916 |
| 19 | 3300005539 | Ga0068853_100002977 | Ga0068853_1000029775 | 916 |
| 20 | 3300025912 | Ga0207707_10004620 | Ga0207707_100046202 | 916 |
| 21 | 3300026041 | Ga0207639_10005198 | Ga0207639_100051984 | 916 |
| 22 | 3300026116 | Ga0207674_10024833 | Ga0207674_100248333 | 917 |
| 23 | 3300050515 | nmdc:mga0a205_51983_c2 | nmdc:mga0a205_51983_c2_74_2938 | 917 |
| 24 | 3300005336 | Ga0070680_100008934 | Ga0070680_1000089344 | 919 |
| 25 | 3300005458 | Ga0070681_10017990 | Ga0070681_100179904 | 919 |
| 26 | 3300005530 | Ga0070679_100006834 | Ga0070679_1000068345 | 919 |
| 27 | 3300005563 | Ga0068855_100037615 | Ga0068855_1000376152 | 919 |
| 28 | 3300013104 | Ga0157370_10021172 | Ga0157370_100211722 | 919 |
| 29 | 3300025912 | Ga0207707_10006114 | Ga0207707_100061145 | 919 |
| 30 | 3300025917 | Ga0207660_10005981 | Ga0207660_100059812 | 919 |
| 31 | 3300025921 | Ga0207652_10006259 | Ga0207652_100062594 | 919 |
| 32 | 3300026067 | Ga0207678_10018949 | Ga0207678_100189494 | 919 |
| 33 | 3300049571 | Ga0501034_0006563 | Ga0501034_0006563_3500_6517 | 919 |
| 34 | 3300009093 | Ga0105240_10000137 | Ga0105240_1000013765 | 920 |
| 35 | 3300035410 | Ga0373924_0008956 | Ga0373924_0008956_529_3549 | 921 |
| 36 | 3300050493 | nmdc:mga0k408_3255_c1 | nmdc:mga0k408_3255_c1_3130_6186 | 921 |
| 37 | 3300049571 | Ga0501034_0019471 | Ga0501034_0019471_2072_4963 | 926 |
| 38 | 3300061734 | Ga0530510_0003979 | Ga0530510_0003979_6760_9678 | 926 |
| 39 | 3300006871 | Ga0075434_100013687 | Ga0075434_1000136876 | 928 |
| 40 | 3300005341 | Ga0070691_10001388 | Ga0070691_100013882 | 929 |
| 41 | 3300005614 | Ga0068856_100028036 | Ga0068856_1000280362 | 930 |
| 42 | 3300013104 | Ga0157370_10010055 | Ga0157370_100100556 | 930 |
| 43 | 3300026078 | Ga0207702_10014693 | Ga0207702_100146932 | 930 |
| 44 | 3300037418 | Ga0395900_0000735 | Ga0395900_0000735_14867_17998 | 930 |
| 45 | 3300005336 | Ga0070680_100026058 | Ga0070680_1000260582 | 931 |
| 46 | 3300005458 | Ga0070681_10007055 | Ga0070681_100070552 | 931 |
| 47 | 3300005530 | Ga0070679_100006475 | Ga0070679_1000064759 | 931 |
| 48 | 3300025912 | Ga0207707_10000295 | Ga0207707_1000029542 | 931 |
| 49 | 3300025921 | Ga0207652_10000148 | Ga0207652_1000014845 | 931 |
| 50 | 3300005366 | Ga0070659_100036886 | Ga0070659_1000368862 | 933 |
| 51 | 3300009545 | Ga0105237_10006838 | Ga0105237_100068386 | 936 |
| 52 | 3300025914 | Ga0207671_10009323 | Ga0207671_100093234 | 936 |
| 53 | 3300049575 | Ga0501039_0007746 | Ga0501039_0007746_3007_6018 | 936 |
| 54 | 3300049578 | Ga0501042_0017435 | Ga0501042_0017435_735_3746 | 936 |
| 55 | 3300049591 | Ga0501075_0007748 | Ga0501075_0007748_3542_6553 | 936 |
| 56 | 3300005331 | Ga0070670_100008319 | Ga0070670_1000083195 | 937 |
| 57 | 3300005335 | Ga0070666_10002924 | Ga0070666_100029249 | 937 |
| 58 | 3300005367 | Ga0070667_100004354 | Ga0070667_1000043549 | 937 |
| 59 | 3300005564 | Ga0070664_100003396 | Ga0070664_1000033966 | 937 |
| 60 | 3300005618 | Ga0068864_100007825 | Ga0068864_1000078255 | 937 |
| 61 | 3300009177 | Ga0105248_10008939 | Ga0105248_100089396 | 937 |
| 62 | 3300013308 | Ga0157375_10003903 | Ga0157375_100039038 | 937 |
| 63 | 3300014325 | Ga0163163_10008771 | Ga0163163_100087716 | 937 |
| 64 | 3300025940 | Ga0207691_10013097 | Ga0207691_100130975 | 937 |
| 65 | 3300025941 | Ga0207711_10005158 | Ga0207711_100051586 | 937 |
| 66 | 3300026095 | Ga0207676_10030114 | Ga0207676_100301141 | 937 |
| 67 | 3300035118 | Ga0373954_0004342 | Ga0373954_0004342_2766_5786 | 938 |
| 68 | 3300049588 | Ga0501072_0019889 | Ga0501072_0019889_1412_4441 | 940 |
| 69 | 3300006353 | Ga0075370_10003796 | Ga0075370_100037965 | 941 |
| 70 | 3300049593 | Ga0501077_0009671 | Ga0501077_0009671_720_3818 | 941 |
| 71 | 3300050496 | nmdc:mga07m45_2089_c1 | nmdc:mga07m45_2089_c1_5194_8223 | 941 |
| 72 | 3300001979 | JGI24740J21852_10000530 | JGI24740J21852_100005305 | 943 |
| 73 | 3300005337 | Ga0070682_100005775 | Ga0070682_1000057753 | 943 |
| 74 | 3300020082 | Ga0206353_10537404 | Ga0206353_105374045 | 943 |
| 75 | 3300025904 | Ga0207647_10000240 | Ga0207647_1000024036 | 943 |
| 76 | 3300025909 | Ga0207705_10001704 | Ga0207705_1000170411 | 943 |
| 77 | 3300025909 | Ga0207705_10001799 | Ga0207705_1000179911 | 943 |
| 78 | 3300025912 | Ga0207707_10000627 | Ga0207707_1000062730 | 943 |
| 79 | 3300025912 | Ga0207707_10001295 | Ga0207707_100012955 | 943 |
| 80 | 3300025917 | Ga0207660_10000464 | Ga0207660_1000046421 | 943 |
| 81 | 3300025917 | Ga0207660_10000525 | Ga0207660_100005257 | 943 |
| 82 | 3300025919 | Ga0207657_10004931 | Ga0207657_100049314 | 943 |
| 83 | 3300025921 | Ga0207652_10001216 | Ga0207652_1000121617 | 943 |
| 84 | 3300025949 | Ga0207667_10047913 | Ga0207667_100479132 | 943 |
| 85 | 3300026067 | Ga0207678_10003106 | Ga0207678_100031065 | 943 |
| 86 | 3300026116 | Ga0207674_10003058 | Ga0207674_1000305810 | 943 |
| 87 | 3300026142 | Ga0207698_10004107 | Ga0207698_100041073 | 943 |
| 88 | 3300038443 | Ga0395901_0066272 | Ga0395901_0066272_216_3290 | 943 |
| 89 | 3300049822 | Ga0501035_0002249 | Ga0501035_0002249_15055_18087 | 943 |
| 90 | 3300005444 | Ga0070694_100019113 | Ga0070694_1000191132 | 944 |
| 91 | 3300006038 | Ga0075365_10000761 | Ga0075365_1000076112 | 944 |
| 92 | 3300050510 | nmdc:mga06r32_24427_c1 | nmdc:mga06r32_24427_c1_2459_5572 | 945 |
| 93 | 3300009094 | Ga0111539_10001481 | Ga0111539_1000148129 | 946 |
| 94 | 3300027907 | Ga0207428_10021261 | Ga0207428_100212613 | 946 |
| 95 | 3300037418 | Ga0395900_0000013 | Ga0395900_0000013_131311_134463 | 946 |
| 96 | 3300037466 | Ga0395898_0030568 | Ga0395898_0030568_1299_4451 | 946 |
| 97 | 3300050511 | nmdc:mga08y16_26948_c1 | nmdc:mga08y16_26948_c1_2059_5196 | 946 |
| 98 | 3300044684 | Ga0466966_0009452 | Ga0466966_0009452_2074_5067 | 948 |
| 99 | 3300031548 | Ga0307408_100018415 | Ga0307408_1000184152 | 949 |
| 100 | 3300036401 | Ga0373937_0005772 | Ga0373937_0005772_1857_4955 | 949 |
| 101 | 3300031995 | Ga0307409_100013674 | Ga0307409_1000136743 | 950 |
| 102 | 3300032002 | Ga0307416_100017367 | Ga0307416_1000173673 | 950 |
| 103 | 3300045051 | Ga0451576_0059789 | Ga0451576_0059789_655_3654 | 950 |
| 104 | 3300049576 | Ga0501040_0013516 | Ga0501040_0013516_195_3446 | 953 |
| 105 | 3300006358 | Ga0068871_100017546 | Ga0068871_1000175464 | 954 |
| 106 | 3300013306 | Ga0163162_10001294 | Ga0163162_100012949 | 954 |
| 107 | 3300014325 | Ga0163163_10002445 | Ga0163163_100024455 | 954 |
| 108 | 3300013308 | Ga0157375_10000396 | Ga0157375_1000039621 | 955 |
| 109 | 3300005327 | Ga0070658_10021364 | Ga0070658_100213642 | 956 |
| 110 | 3300005345 | Ga0070692_10012961 | Ga0070692_100129612 | 956 |
| 111 | 3300009093 | Ga0105240_10074435 | Ga0105240_100744351 | 956 |
| 112 | 3300009098 | Ga0105245_10000052 | Ga0105245_1000005283 | 956 |
| 113 | 3300013308 | Ga0157375_10000059 | Ga0157375_1000005930 | 956 |
| 114 | 3300025927 | Ga0207687_10000005 | Ga0207687_1000000534 | 956 |
| 115 | 3300036401 | Ga0373937_0000340 | Ga0373937_0000340_14843_17950 | 956 |
| 116 | 3300010375 | Ga0105239_10044152 | Ga0105239_100441523 | 957 |
| 117 | 3300049571 | Ga0501034_0043131 | Ga0501034_0043131_286_3249 | 957 |
| 118 | 3300049743 | Ga0501081_0005536 | Ga0501081_0005536_4794_7844 | 957 |
| 119 | 3300005329 | Ga0070683_100000033 | Ga0070683_10000003312 | 958 |
| 120 | 3300025944 | Ga0207661_10000006 | Ga0207661_10000006378 | 958 |
| 121 | 3300031235 | Ga0265330_10000765 | Ga0265330_1000076510 | 959 |
| 122 | 3300048915 | Ga0496112_0013708 | Ga0496112_0013708_4350_7454 | 959 |
| 123 | 3300048909 | Ga0496106_0024782 | Ga0496106_0024782_1438_4446 | 960 |
| 124 | 3300004803 | Ga0058862_10061456 | Ga0058862_100614562 | 962 |
| 125 | 3300005338 | Ga0068868_100006831 | Ga0068868_1000068312 | 962 |
| 126 | 3300005535 | Ga0070684_100029772 | Ga0070684_1000297721 | 962 |
| 127 | 3300005539 | Ga0068853_100022256 | Ga0068853_1000222562 | 962 |
| 128 | 3300005616 | Ga0068852_100007405 | Ga0068852_1000074056 | 962 |
| 129 | 3300009551 | Ga0105238_10012970 | Ga0105238_100129706 | 962 |
| 130 | 3300025924 | Ga0207694_10028592 | Ga0207694_100285922 | 962 |
| 131 | 3300032002 | Ga0307416_100002993 | Ga0307416_1000029933 | 962 |
| 132 | 3300006871 | Ga0075434_100007662 | Ga0075434_1000076627 | 963 |
| 133 | 3300007076 | Ga0075435_100005050 | Ga0075435_1000050502 | 963 |
| 134 | 3300050512 | nmdc:mga0n895_2321_c1 | nmdc:mga0n895_2321_c1_4463_7495 | 963 |
| 135 | 3300050513 | nmdc:mga0rr50_110_c2 | nmdc:mga0rr50_110_c2_4832_7864 | 963 |
| 136 | 3300050515 | nmdc:mga0a205_131_c1 | nmdc:mga0a205_131_c1_18515_21547 | 963 |
| 137 | 3300006844 | Ga0075428_100045998 | Ga0075428_1000459983 | 966 |
| 138 | 3300006847 | Ga0075431_100002296 | Ga0075431_10000229615 | 966 |
| 139 | 3300050510 | nmdc:mga06r32_4306_c1 | nmdc:mga06r32_4306_c1_4657_7689 | 966 |
| 140 | 3300005338 | Ga0068868_100012560 | Ga0068868_1000125603 | 968 |
| 141 | 3300005445 | Ga0070708_100000137 | Ga0070708_10000013727 | 968 |
| 142 | 3300005467 | Ga0070706_100001324 | Ga0070706_10000132415 | 968 |
| 143 | 3300005468 | Ga0070707_100000651 | Ga0070707_1000006519 | 968 |
| 144 | 3300005471 | Ga0070698_100000902 | Ga0070698_1000009025 | 968 |
| 145 | 3300005518 | Ga0070699_100000439 | Ga0070699_10000043911 | 968 |
| 146 | 3300005536 | Ga0070697_100000265 | Ga0070697_10000026538 | 968 |
| 147 | 3300005548 | Ga0070665_100006963 | Ga0070665_1000069632 | 968 |
| 148 | 3300005842 | Ga0068858_100013352 | Ga0068858_1000133524 | 968 |
| 149 | 3300009177 | Ga0105248_10042976 | Ga0105248_100429762 | 968 |
| 150 | 3300014968 | Ga0157379_10043236 | Ga0157379_100432361 | 968 |
| 151 | 3300025922 | Ga0207646_10000494 | Ga0207646_1000049411 | 968 |
| 152 | 3300026023 | Ga0207677_10009822 | Ga0207677_100098222 | 968 |
| 153 | 3300028379 | Ga0268266_10013170 | Ga0268266_100131703 | 968 |
| 154 | 3300048918 | Ga0496115_0022841 | Ga0496115_0022841_1268_4327 | 968 |
| 155 | 3300047317 | Ga0495604_0023584 | Ga0495604_0023584_650_3790 | 969 |
| 156 | 3300042435 | Ga0439434_0006038 | Ga0439434_0006038_243_3476 | 971 |
| 157 | 3300037471 | Ga0395905_0048396 | Ga0395905_0048396_645_3695 | 972 |
| 158 | 3300039447 | Ga0436361_0085822 | Ga0436361_0085822_2324_5395 | 972 |
| 159 | 3300048908 | Ga0496105_0007596 | Ga0496105_0007596_2880_5987 | 972 |
| 160 | 3300005328 | Ga0070676_10004427 | Ga0070676_100044275 | 973 |
| 161 | 3300005330 | Ga0070690_100001847 | Ga0070690_1000018479 | 973 |
| 162 | 3300005334 | Ga0068869_100003009 | Ga0068869_1000030096 | 973 |
| 163 | 3300005335 | Ga0070666_10020274 | Ga0070666_100202742 | 973 |
| 164 | 3300005340 | Ga0070689_100012981 | Ga0070689_1000129812 | 973 |
| 165 | 3300005353 | Ga0070669_100001921 | Ga0070669_1000019217 | 973 |
| 166 | 3300005354 | Ga0070675_100002457 | Ga0070675_10000245712 | 973 |
| 167 | 3300005364 | Ga0070673_100001253 | Ga0070673_10000125313 | 973 |
| 168 | 3300005365 | Ga0070688_100005362 | Ga0070688_1000053623 | 973 |
| 169 | 3300005457 | Ga0070662_100021258 | Ga0070662_1000212582 | 973 |
| 170 | 3300005543 | Ga0070672_100000166 | Ga0070672_1000001663 | 973 |
| 171 | 3300005617 | Ga0068859_100024990 | Ga0068859_1000249903 | 973 |
| 172 | 3300005840 | Ga0068870_10000136 | Ga0068870_100001369 | 973 |
| 173 | 3300005844 | Ga0068862_100002024 | Ga0068862_10000202412 | 973 |
| 174 | 3300006931 | Ga0097620_100024991 | Ga0097620_1000249913 | 973 |
| 175 | 3300009094 | Ga0111539_10001618 | Ga0111539_100016183 | 973 |
| 176 | 3300025315 | Ga0207697_10008801 | Ga0207697_100088012 | 973 |
| 177 | 3300025901 | Ga0207688_10007346 | Ga0207688_100073463 | 973 |
| 178 | 3300025907 | Ga0207645_10015529 | Ga0207645_100155292 | 973 |
| 179 | 3300025923 | Ga0207681_10002712 | Ga0207681_100027122 | 973 |
| 180 | 3300025926 | Ga0207659_10005272 | Ga0207659_100052727 | 973 |
| 181 | 3300025933 | Ga0207706_10005693 | Ga0207706_1000569311 | 973 |
| 182 | 3300025940 | Ga0207691_10017673 | Ga0207691_100176734 | 973 |
| 183 | 3300025942 | Ga0207689_10002833 | Ga0207689_1000283312 | 973 |
| 184 | 3300026035 | Ga0207703_10015752 | Ga0207703_100157522 | 973 |
| 185 | 3300027907 | Ga0207428_10004803 | Ga0207428_100048033 | 973 |
| 186 | 3300045051 | Ga0451576_0009423 | Ga0451576_0009423_5951_9016 | 973 |
| 187 | 3300050515 | nmdc:mga0a205_1555_c1 | nmdc:mga0a205_1555_c1_9299_12355 | 973 |
| 188 | 3300036401 | Ga0373937_0009459 | Ga0373937_0009459_3571_6675 | 974 |
| 189 | 3300037068 | Ga0373925_0004331 | Ga0373925_0004331_5803_8907 | 974 |
| 190 | 3300035410 | Ga0373924_0000284 | Ga0373924_0000284_12451_15549 | 975 |
| 191 | 3300044842 | Ga0466957_0003501 | Ga0466957_0003501_178_3294 | 975 |
| 192 | 3300032004 | Ga0307414_10018953 | Ga0307414_100189532 | 976 |
| 193 | 3300005467 | Ga0070706_100005412 | Ga0070706_1000054129 | 977 |
| 194 | 3300025910 | Ga0207684_10024329 | Ga0207684_100243293 | 977 |
| 195 | 3300005471 | Ga0070698_100002590 | Ga0070698_10000259011 | 983 |
| 196 | 3300061734 | Ga0530510_0037123 | Ga0530510_0037123_367_3438 | 986 |
| 197 | 3300005334 | Ga0068869_100023343 | Ga0068869_1000233432 | 987 |
| 198 | 3300025942 | Ga0207689_10020541 | Ga0207689_100205412 | 987 |
| 199 | 3300005331 | Ga0070670_100003304 | Ga0070670_10000330413 | 989 |
| 200 | 3300005353 | Ga0070669_100001323 | Ga0070669_10000132310 | 989 |
| 201 | 3300025923 | Ga0207681_10000879 | Ga0207681_1000087914 | 989 |
| 202 | 3300025925 | Ga0207650_10002322 | Ga0207650_1000232210 | 989 |
| 203 | 3300005937 | Ga0081455_10030785 | Ga0081455_100307853 | 993 |
| 204 | 3300054114 | Ga0501084_0022976 | Ga0501084_0022976_215_3391 | 993 |
| 205 | 3300046525 | Ga0495663_0000189 | Ga0495663_0000189_3765_7019 | 994 |
| 206 | 3300005337 | Ga0070682_100000076 | Ga0070682_10000007645 | 996 |
| 207 | 3300009094 | Ga0111539_10033885 | Ga0111539_100338853 | 996 |
| 208 | 3300027907 | Ga0207428_10007605 | Ga0207428_100076057 | 996 |
| 209 | 3300047320 | Ga0495672_0006734 | Ga0495672_0006734_4498_7830 | 999 |
| 210 | 3300048912 | Ga0496109_0001048 | Ga0496109_0001048_13509_16652 | 1000 |
| 211 | 3300005615 | Ga0070702_100016193 | Ga0070702_1000161932 | 1002 |
| 212 | 3300025885 | Ga0207653_10001391 | Ga0207653_100013916 | 1002 |
| 213 | 3300005985 | Ga0081539_10001769 | Ga0081539_1000176931 | 1003 |
| 214 | 3300005347 | Ga0070668_100001118 | Ga0070668_1000011189 | 1004 |
| 215 | 3300009553 | Ga0105249_10000480 | Ga0105249_1000048010 | 1004 |
| 216 | 3300013306 | Ga0163162_10000477 | Ga0163162_1000047711 | 1004 |
| 217 | 3300025961 | Ga0207712_10000164 | Ga0207712_1000016430 | 1004 |
| 218 | 3300025972 | Ga0207668_10001056 | Ga0207668_100010568 | 1004 |
| 219 | 3300005293 | Ga0065715_10091322 | Ga0065715_100913222 | 1005 |
| 220 | 3300046537 | Ga0495598_0001001 | Ga0495598_0001001_2067_5321 | 1005 |
| 221 | 3300005343 | Ga0070687_100001292 | Ga0070687_1000012926 | 1006 |
| 222 | 3300006237 | Ga0097621_100007866 | Ga0097621_1000078662 | 1006 |
| 223 | 3300006358 | Ga0068871_100009123 | Ga0068871_1000091234 | 1006 |
| 224 | 3300009098 | Ga0105245_10021981 | Ga0105245_100219812 | 1006 |
| 225 | 3300009148 | Ga0105243_10015118 | Ga0105243_100151182 | 1006 |
| 226 | 3300025918 | Ga0207662_10000900 | Ga0207662_100009002 | 1006 |
| 227 | 3300025935 | Ga0207709_10003272 | Ga0207709_100032729 | 1006 |
| 228 | 3300025940 | Ga0207691_10011098 | Ga0207691_100110986 | 1006 |
| 229 | 3300005441 | Ga0070700_100012795 | Ga0070700_1000127952 | 1007 |
| 230 | 3300014325 | Ga0163163_10002277 | Ga0163163_100022775 | 1007 |
| 231 | 3300026075 | Ga0207708_10009878 | Ga0207708_100098783 | 1007 |
| 232 | 3300042157 | Ga0439458_0003721 | Ga0439458_0003721_131_3433 | 1007 |
| 233 | 3300025900 | Ga0207710_10002109 | Ga0207710_100021098 | 1008 |
| 234 | 3300005353 | Ga0070669_100023755 | Ga0070669_1000237552 | 1009 |
| 235 | 3300005330 | Ga0070690_100010235 | Ga0070690_1000102353 | 1010 |
| 236 | 3300005338 | Ga0068868_100037182 | Ga0068868_1000371822 | 1010 |
| 237 | 3300005536 | Ga0070697_100000983 | Ga0070697_1000009832 | 1010 |
| 238 | 3300025936 | Ga0207670_10002555 | Ga0207670_100025559 | 1011 |
| 239 | 3300005471 | Ga0070698_100005088 | Ga0070698_1000050889 | 1012 |
| 240 | 3300009147 | Ga0114129_10032605 | Ga0114129_100326054 | 1013 |
| 241 | 3300013308 | Ga0157375_10053048 | Ga0157375_100530482 | 1013 |
| 242 | 3300031731 | Ga0307405_10007108 | Ga0307405_100071081 | 1013 |
| 243 | 3300031901 | Ga0307406_10002329 | Ga0307406_100023295 | 1013 |
| 244 | 3300032004 | Ga0307414_10002257 | Ga0307414_100022575 | 1013 |
| 245 | 3300049707 | Ga0501234_000821 | Ga0501234_000821_1145_4366 | 1013 |
| 246 | 3300050507 | nmdc:mga05p37_22080_c1 | nmdc:mga05p37_22080_c1_2248_5505 | 1013 |
| 247 | 3300005331 | Ga0070670_100013213 | Ga0070670_1000132134 | 1014 |
| 248 | 3300005547 | Ga0070693_100001971 | Ga0070693_1000019717 | 1014 |
| 249 | 3300005719 | Ga0068861_100005638 | Ga0068861_1000056385 | 1014 |
| 250 | 3300005842 | Ga0068858_100034462 | Ga0068858_1000344622 | 1014 |
| 251 | 3300005844 | Ga0068862_100010229 | Ga0068862_1000102291 | 1014 |
| 252 | 3300006914 | Ga0075436_100009702 | Ga0075436_1000097023 | 1014 |
| 253 | 3300009545 | Ga0105237_10001605 | Ga0105237_1000160514 | 1014 |
| 254 | 3300009553 | Ga0105249_10014783 | Ga0105249_100147831 | 1014 |
| 255 | 3300028380 | Ga0268265_10009096 | Ga0268265_100090963 | 1014 |
| 256 | 3300005336 | Ga0070680_100005143 | Ga0070680_1000051439 | 1015 |
| 257 | 3300009147 | Ga0114129_10029864 | Ga0114129_100298643 | 1015 |
| 258 | 3300025904 | Ga0207647_10000801 | Ga0207647_1000080122 | 1015 |
| 259 | 3300050515 | nmdc:mga0a205_24292_c1 | nmdc:mga0a205_24292_c1_1558_4773 | 1015 |
| 260 | 3300005288 | Ga0065714_10002186 | Ga0065714_1000218643 | 1016 |
| 261 | 3300005290 | Ga0065712_10000113 | Ga0065712_1000011343 | 1016 |
| 262 | 3300005842 | Ga0068858_100012079 | Ga0068858_1000120792 | 1016 |
| 263 | 3300013297 | Ga0157378_10007811 | Ga0157378_100078112 | 1016 |
| 264 | 3300014326 | Ga0157380_10001478 | Ga0157380_1000147812 | 1016 |
| 265 | 3300025923 | Ga0207681_10023287 | Ga0207681_100232872 | 1016 |
| 266 | 3300026095 | Ga0207676_10007589 | Ga0207676_100075894 | 1016 |
| 267 | 3300005355 | Ga0070671_100005941 | Ga0070671_1000059417 | 1017 |
| 268 | 3300005518 | Ga0070699_100006382 | Ga0070699_1000063829 | 1017 |
| 269 | 3300005617 | Ga0068859_100043757 | Ga0068859_1000437573 | 1017 |
| 270 | 3300006931 | Ga0097620_100043763 | Ga0097620_1000437633 | 1017 |
| 271 | 3300013306 | Ga0163162_10000539 | Ga0163162_1000053917 | 1017 |
| 272 | 3300005536 | Ga0070697_100004343 | Ga0070697_1000043435 | 1018 |
| 273 | 3300009551 | Ga0105238_10009924 | Ga0105238_100099242 | 1018 |
| 274 | 3300013306 | Ga0163162_10017227 | Ga0163162_100172276 | 1018 |
| 275 | 3300049574 | Ga0501038_0012043 | Ga0501038_0012043_873_4064 | 1018 |
| 276 | 3300005444 | Ga0070694_100007992 | Ga0070694_1000079922 | 1019 |
| 277 | 3300005467 | Ga0070706_100000019 | Ga0070706_100000019134 | 1020 |
| 278 | 3300013100 | Ga0157373_10024168 | Ga0157373_100241682 | 1020 |
| 279 | 3300025910 | Ga0207684_10000079 | Ga0207684_1000007996 | 1020 |
| 280 | 3300025918 | Ga0207662_10010604 | Ga0207662_100106043 | 1020 |
| 281 | 3300050515 | nmdc:mga0a205_20112_c1 | nmdc:mga0a205_20112_c1_2036_5257 | 1020 |
| 282 | 3300013297 | Ga0157378_10049300 | Ga0157378_100493001 | 1021 |
| 283 | 3300002459 | JGI24751J29686_10000013 | JGI24751J29686_1000001389 | 1022 |
| 284 | 3300005331 | Ga0070670_100001988 | Ga0070670_1000019884 | 1022 |
| 285 | 3300005985 | Ga0081539_10005899 | Ga0081539_100058992 | 1022 |
| 286 | 3300014325 | Ga0163163_10001169 | Ga0163163_100011699 | 1022 |
| 287 | 3300025925 | Ga0207650_10000001 | Ga0207650_10000001139 | 1022 |
| 288 | 3300025941 | Ga0207711_10017510 | Ga0207711_100175104 | 1024 |
| 289 | 3300005458 | Ga0070681_10000273 | Ga0070681_1000027327 | 1027 |
| 290 | 3300005530 | Ga0070679_100001215 | Ga0070679_10000121514 | 1027 |
| 291 | 3300025912 | Ga0207707_10000008 | Ga0207707_10000008149 | 1027 |
| 292 | 3300025921 | Ga0207652_10000065 | Ga0207652_1000006549 | 1027 |
| 293 | 3300005458 | Ga0070681_10002209 | Ga0070681_100022095 | 1028 |
| 294 | 3300005530 | Ga0070679_100000737 | Ga0070679_10000073713 | 1028 |
| 295 | 3300005564 | Ga0070664_100005118 | Ga0070664_1000051189 | 1028 |
| 296 | 3300005577 | Ga0068857_100000993 | Ga0068857_10000099315 | 1028 |
| 297 | 3300005618 | Ga0068864_100032135 | Ga0068864_1000321352 | 1028 |
| 298 | 3300026095 | Ga0207676_10027345 | Ga0207676_100273452 | 1028 |
| 299 | 3300026116 | Ga0207674_10000079 | Ga0207674_1000007918 | 1028 |
| 300 | 3300026078 | Ga0207702_10038934 | Ga0207702_100389342 | 1032 |
| 301 | 3300048907 | Ga0496104_0009333 | Ga0496104_0009333_5078_8302 | 1032 |
| 302 | 3300000532 | CNAas_1000052 | CNAas_10000521 | 1061 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lod-assembly1.cif.gz_B | cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii | 0.8727 | 86 | 1061 |
| 6lod-assembly1.cif.gz_B | cryo-em structure of the air-oxidized photosynthetic alternative complex iii from roseiflexus castenholzii | 0.8673 | 86 | 1061 |
| 6f0k-assembly1.cif.gz_B | alternative complex iii | 0.8311 | 87 | 1060 |
| 6f0k-assembly1.cif.gz_B | alternative complex iii | 0.8278 | 87 | 1060 |
| 6btm-assembly1.cif.gz_B | structure of alternative complex iii from flavobacterium johnsoniae (wild type) | 0.8076 | 87 | 1055 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q60314_222_377_3.40.50.740 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7996 | 396 | 506 | 3.40.50.740 |
| 2vpwA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.745 | 404 | 512 | 3.40.50.740 |
| af_P77783_422_617_3.40.50.740 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7164 | 409 | 536 | 3.40.50.740 |
| af_P33602_508_691_3.40.50.740 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7094 | 406 | 534 | 3.40.50.740 |
| 1qcsA01 | Mainly Beta;Beta Barrel;Barwin-like endoglucanases; | 0.695 | 654 | 714 | 2.40.40.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8NH63-F1-model_v4 | Molybdopterin oxidoreductase | 0.9718 | 207 | 497 |
|
| AF-A0A2M8NH63-F1-model_v4 | Molybdopterin oxidoreductase | 0.9189 | 207 | 497 |
|
| AF-A0A832GK12-F1-model_v4 | Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein | 0.9187 | 204 | 351 |
|
| AF-A0A2V7YCY0-F1-model_v4 | Molybdopterin oxidoreductase | 0.8996 | 203 | 1061 |
GO:0051539
|
| AF-A0A2V7YCY0-F1-model_v4 | Molybdopterin oxidoreductase | 0.8953 | 203 | 1061 |
GO:0051539
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar