F396548

General Info

Members Datasets Scaffolds Average Seq Length
302 156 604 141

Family's Representative Sequence

Representative Sequence 3300026075|Ga0207708_10584654|Ga0207708_105846541
Length 157
Sequence VSTLTVRCHVVNWQRNLLTNSTEIAILLKETRTIAVLGIKTEAQAGQPAFYVPSYLQAAGFQIIPVPVYYPKATRILDQPVYRRLLDVPIDVDLVNVFRRSEDIPPHVEDILAKMPKAVWLQSGIRNDAVAETLAKAGIKVVQDRCLMVDHRRWKRK

Samples

Sample ID Description Type Environment
1 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
122 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
130 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
137 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
145 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
146 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
147 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.32
Rhizosphere 98.34
Stem 0
Stem Tuber 0
Unclassified 28.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207708_10584654 3300026075 Bacteria 944
2 MBSR1b_contig_7228720 2162886012 Bacteria 2311
3 LJQas_1000028 3300000549 Bacteria 22506
4 JGI24034J14986_100193 3300001432 Bacteria 3173
5 JGI24748J21848_1000014 3300002074 Bacteria 147126
6 JGI24034J26672_10000012 3300002239 Bacteria 146139
7 JGI24742J22300_10046548 3300002244 Bacteria 780
8 rootL2_10027889 3300003322 Unclassified 1872
9 Ga0065704_10474273 3300005289 Unclassified 687
10 Ga0065715_10002211 3300005293 Bacteria 5720
11 Ga0070676_10515207 3300005328 Bacteria 851
12 Ga0070690_100014111 3300005330 Bacteria 4736
13 Ga0070670_100077836 3300005331 Bacteria 2849
14 Ga0068869_100121044 3300005334 Bacteria 2002
15 Ga0070682_100054418 3300005337 Bacteria 2511
16 Ga0068868_100236779 3300005338 Unclassified 1533
17 Ga0068868_100362174 3300005338 Unclassified 1244
18 Ga0070689_100292578 3300005340 Bacteria 1354
19 Ga0070691_10944039 3300005341 Bacteria 535
20 Ga0070687_100005965 3300005343 Bacteria 4958
21 Ga0070669_100062898 3300005353 Bacteria 2730
22 Ga0070669_100341523 3300005353 Bacteria 1213
23 Ga0070669_100634777 3300005353 Unclassified 897
24 Ga0070669_100842287 3300005353 Unclassified 781
25 Ga0070675_101447895 3300005354 Unclassified 633
26 Ga0070671_100016570 3300005355 Bacteria 5957
27 Ga0070673_100022304 3300005364 Bacteria 4606
28 Ga0070673_100638184 3300005364 Bacteria 974
29 Ga0070673_100871064 3300005364 Bacteria 834
30 Ga0070688_100481288 3300005365 Bacteria 933
31 Ga0070688_100971631 3300005365 Bacteria 673
32 Ga0070701_10068285 3300005438 Bacteria 1893
33 Ga0070705_100167489 3300005440 Bacteria 1475
34 Ga0070705_100539710 3300005440 Unclassified 892
35 Ga0070700_100161166 3300005441 Bacteria 1544
36 Ga0070700_101053007 3300005441 Bacteria 672
37 Ga0070694_100014170 3300005444 Unclassified 4989
38 Ga0070694_100351256 3300005444 Unclassified 1142
39 Ga0070694_100562405 3300005444 Bacteria 914
40 Ga0068867_100185789 3300005459 Bacteria 1655
41 Ga0068867_100300435 3300005459 Bacteria 1323
42 Ga0068867_100409089 3300005459 Unclassified 1146
43 Ga0070698_100033563 3300005471 Bacteria 5316
44 Ga0070699_100040543 3300005518 Bacteria 4032
45 Ga0070699_100176225 3300005518 Bacteria 1896
46 Ga0070697_100000211 3300005536 Bacteria 47665
47 Ga0068853_100595783 3300005539 Unclassified 1049
48 Ga0070672_100633214 3300005543 Unclassified 933
49 Ga0070686_100051998 3300005544 Bacteria 2610
50 Ga0070686_100244900 3300005544 Unclassified 1307
51 Ga0070686_100325759 3300005544 Bacteria 1147
52 Ga0070695_100058345 3300005545 Bacteria 2495
53 Ga0070695_100484444 3300005545 Unclassified 954
54 Ga0070695_100687899 3300005545 Unclassified 811
55 Ga0070696_100104948 3300005546 Bacteria 2029
56 Ga0070696_100412695 3300005546 Unclassified 1058
57 Ga0070704_100215620 3300005549 Bacteria 1558
58 Ga0070704_100237079 3300005549 Bacteria 1491
59 Ga0070704_100269638 3300005549 Bacteria 1406
60 Ga0070704_100436709 3300005549 Bacteria 1124
61 Ga0068854_100206735 3300005578 Unclassified 1546
62 Ga0068854_100244344 3300005578 Unclassified 1431
63 Ga0068854_100504716 3300005578 Unclassified 1019
64 Ga0070702_100805533 3300005615 Bacteria 727
65 Ga0068859_100313533 3300005617 Bacteria 1662
66 Ga0068859_101360237 3300005617 Unclassified 783
67 Ga0068864_100070651 3300005618 Bacteria 3038
68 Ga0068864_102502231 3300005618 Bacteria 522
69 Ga0068866_10191532 3300005718 Unclassified 1215
70 Ga0068861_100251391 3300005719 Bacteria 1508
71 Ga0068861_101121894 3300005719 Bacteria 757
72 Ga0068870_10028618 3300005840 Bacteria 2799
73 Ga0068870_10191415 3300005840 Bacteria 1234
74 Ga0068858_100000602 3300005842 Bacteria 37601
75 Ga0068858_100292696 3300005842 Unclassified 1552
76 Ga0068858_100466988 3300005842 Bacteria 1217
77 Ga0068860_100026217 3300005843 Bacteria 5620
78 Ga0068860_100033651 3300005843 Bacteria 4917
79 Ga0068860_100089055 3300005843 Bacteria 2938
80 Ga0068862_100294857 3300005844 Unclassified 1490
81 Ga0081539_10003894 3300005985 Bacteria 17398
82 Ga0097621_101318177 3300006237 Unclassified 682
83 Ga0075428_100001740 3300006844 Bacteria 23245
84 Ga0075428_100046917 3300006844 Bacteria 4745
85 Ga0075428_100923670 3300006844 Bacteria 925
86 Ga0075430_100045910 3300006846 Unclassified 3690
87 Ga0075430_100460129 3300006846 Unclassified 1050
88 Ga0075430_101230927 3300006846 Bacteria 616
89 Ga0075431_100144153 3300006847 Bacteria 2455
90 Ga0075431_100234279 3300006847 Bacteria 1870
91 Ga0075433_10020407 3300006852 Bacteria 5538
92 Ga0075433_10170439 3300006852 Bacteria 1937
93 Ga0075433_10171380 3300006852 Bacteria 1931
94 Ga0075433_10349757 3300006852 Bacteria 1306
95 Ga0075433_10403780 3300006852 Bacteria 1205
96 Ga0075434_100068028 3300006871 Bacteria 3548
97 Ga0075434_100726538 3300006871 Bacteria 1010
98 Ga0075429_100019910 3300006880 Bacteria 5819
99 Ga0068865_100260866 3300006881 Unclassified 1372
100 Ga0068865_100628863 3300006881 Bacteria 910
101 Ga0068865_101430125 3300006881 Bacteria 618
102 Ga0097620_100053747 3300006931 Bacteria 4051
103 Ga0097620_100313528 3300006931 Bacteria 1662
104 Ga0097620_101360345 3300006931 Unclassified 783
105 Ga0075435_100433301 3300007076 Bacteria 1133
106 Ga0105240_10457247 3300009093 Bacteria 1427
107 Ga0105240_10695255 3300009093 Bacteria 1110
108 Ga0111539_10004112 3300009094 Bacteria 19084
109 Ga0111539_10363199 3300009094 Bacteria 1685
110 Ga0111539_10982784 3300009094 Unclassified 981
111 Ga0105245_10712228 3300009098 Bacteria 1038
112 Ga0105247_10000050 3300009101 Bacteria 146183
113 Ga0105247_10574497 3300009101 Unclassified 832
114 Ga0114129_10042813 3300009147 Bacteria 6372
115 Ga0114129_10129986 3300009147 Bacteria 3460
116 Ga0114129_10544595 3300009147 Bacteria 1510
117 Ga0114129_10557862 3300009147 Bacteria 1489
118 Ga0114129_11007445 3300009147 Unclassified 1049
119 Ga0105243_10000429 3300009148 Bacteria 43901
120 Ga0105243_10116890 3300009148 Unclassified 2241
121 Ga0105243_10153744 3300009148 Bacteria 1976
122 Ga0105243_10176888 3300009148 Bacteria 1853
123 Ga0105241_10107554 3300009174 Bacteria 2228
124 Ga0105241_10276815 3300009174 Bacteria 1432
125 Ga0105241_11767784 3300009174 Unclassified 602
126 Ga0105242_10002790 3300009176 Bacteria 13681
127 Ga0105242_10019330 3300009176 Bacteria 5337
128 Ga0105242_10485887 3300009176 Bacteria 1171
129 Ga0105242_11136273 3300009176 Bacteria 797
130 Ga0105248_10423865 3300009177 Bacteria 1499
131 Ga0105248_10450214 3300009177 Unclassified 1451
132 Ga0105248_10586061 3300009177 Bacteria 1258
133 Ga0105248_12173809 3300009177 Unclassified 631
134 Ga0105249_10010787 3300009553 Bacteria 8029
135 Ga0105249_10116130 3300009553 Bacteria 2536
136 Ga0105249_10454358 3300009553 Bacteria 1320
137 Ga0105249_10632609 3300009553 Bacteria 1127
138 Ga0105239_10019903 3300010375 Bacteria 7407
139 Ga0105246_10208732 3300011119 Bacteria 1523
140 Ga0105246_10681308 3300011119 Bacteria 899
141 Ga0105246_10817370 3300011119 Bacteria 828
142 Ga0157373_10307651 3300013100 Bacteria 1126
143 Ga0157373_10766340 3300013100 Unclassified 710
144 Ga0157371_11519344 3300013102 Unclassified 523
145 Ga0157378_10000047 3300013297 Bacteria 104964
146 Ga0157378_10017724 3300013297 Bacteria 6252
147 Ga0157378_10018093 3300013297 Bacteria 6188
148 Ga0157378_10041730 3300013297 Bacteria 4071
149 Ga0157378_10044058 3300013297 Unclassified 3961
150 Ga0157378_10050626 3300013297 Bacteria 3696
151 Ga0157378_10276067 3300013297 Unclassified 1618
152 Ga0157378_10619373 3300013297 Bacteria 1095
153 Ga0163162_10018128 3300013306 Bacteria 6892
154 Ga0163162_10246800 3300013306 Bacteria 1917
155 Ga0157375_10087835 3300013308 Bacteria 3162
156 Ga0157375_10242946 3300013308 Bacteria 1960
157 Ga0157375_12916021 3300013308 Unclassified 571
158 Ga0163163_10128304 3300014325 Bacteria 2575
159 Ga0157380_10006200 3300014326 Bacteria 8392
160 Ga0157380_10098719 3300014326 Bacteria 2427
161 Ga0157380_10606808 3300014326 Bacteria 1084
162 Ga0157380_11021713 3300014326 Unclassified 861
163 Ga0157377_10281118 3300014745 Bacteria 1091
164 Ga0157377_10595951 3300014745 Bacteria 787
165 Ga0157379_10050445 3300014968 Bacteria 3715
166 Ga0163161_10018708 3300017792 Bacteria 4857
167 Ga0163161_10136201 3300017792 Bacteria 1857
168 Ga0163161_10430163 3300017792 Unclassified 1063
169 Ga0163161_10693424 3300017792 Unclassified 847
170 Ga0207672_1000004 3300025223 Bacteria 29738
171 Ga0207642_10157196 3300025899 Unclassified 1217
172 Ga0207710_10000003 3300025900 Bacteria 1071597
173 Ga0207645_10182978 3300025907 Bacteria 1375
174 Ga0207643_10002814 3300025908 Bacteria 9387
175 Ga0207643_10082452 3300025908 Bacteria 1865
176 Ga0207662_10555947 3300025918 Unclassified 795
177 Ga0207681_10120195 3300025923 Bacteria 1926
178 Ga0207681_10733716 3300025923 Unclassified 823
179 Ga0207681_10998076 3300025923 Unclassified 702
180 Ga0207650_10000005 3300025925 Bacteria 663190
181 Ga0207650_10543029 3300025925 Unclassified 974
182 Ga0207650_11410612 3300025925 Unclassified 592
183 Ga0207644_10004802 3300025931 Bacteria 8801
184 Ga0207686_10010415 3300025934 Bacteria 5063
185 Ga0207686_10011175 3300025934 Bacteria 4908
186 Ga0207709_10117979 3300025935 Unclassified 1787
187 Ga0207709_10157234 3300025935 Bacteria 1581
188 Ga0207704_10062685 3300025938 Bacteria 2313
189 Ga0207704_10600695 3300025938 Unclassified 901
190 Ga0207704_11281132 3300025938 Bacteria 626
191 Ga0207691_10570703 3300025940 Unclassified 959
192 Ga0207711_10324283 3300025941 Unclassified 1424
193 Ga0207711_10334690 3300025941 Bacteria 1400
194 Ga0207711_11417592 3300025941 Unclassified 637
195 Ga0207689_10069159 3300025942 Bacteria 2901
196 Ga0207689_10172515 3300025942 Bacteria 1783
197 Ga0207689_11402397 3300025942 Unclassified 585
198 Ga0207651_10018386 3300025960 Bacteria 4158
199 Ga0207651_10706246 3300025960 Unclassified 889
200 Ga0207712_10567009 3300025961 Bacteria 978
201 Ga0207712_11193001 3300025961 Unclassified 679
202 Ga0207640_10477814 3300025981 Unclassified 1033
203 Ga0207677_10060795 3300026023 Bacteria 2613
204 Ga0207703_10000355 3300026035 Bacteria 49221
205 Ga0207703_10055618 3300026035 Unclassified 3220
206 Ga0207703_10265481 3300026035 Unclassified 1553
207 Ga0207703_10469516 3300026035 Unclassified 1178
208 Ga0207639_10272050 3300026041 Unclassified 1486
209 Ga0207708_10015134 3300026075 Bacteria 5779
210 Ga0207708_10040828 3300026075 Unclassified 3538
211 Ga0207641_10028173 3300026088 Bacteria 4640
212 Ga0207648_10054749 3300026089 Unclassified 3483
213 Ga0207648_10063303 3300026089 Bacteria 3224
214 Ga0207648_10195299 3300026089 Bacteria 1794
215 Ga0207648_10250775 3300026089 Bacteria 1578
216 Ga0207648_10361644 3300026089 Bacteria 1309
217 Ga0207676_10009343 3300026095 Bacteria 6977
218 Ga0207676_10550009 3300026095 Bacteria 1103
219 Ga0207675_100002096 3300026118 Bacteria 19789
220 Ga0207675_100037152 3300026118 Bacteria 4543
221 Ga0207698_11256265 3300026142 Unclassified 755
222 Ga0207428_10028285 3300027907 Bacteria 4658
223 Ga0268265_10124970 3300028380 Unclassified 2127
224 Ga0268265_11060724 3300028380 Bacteria 803
225 Ga0268265_11132232 3300028380 Bacteria 778
226 Ga0268265_12226318 3300028380 Bacteria 555
227 Ga0268264_10007184 3300028381 Bacteria 9329
228 Ga0268264_10024586 3300028381 Bacteria 4918
229 Ga0268264_10025234 3300028381 Bacteria 4856
230 Ga0268264_10028706 3300028381 Bacteria 4553
231 Ga0268264_10326019 3300028381 Bacteria 1454
232 Ga0265338_10053372 3300028800 Bacteria 3616
233 Ga0307408_100220313 3300031548 Bacteria 1548
234 Ga0307408_100442919 3300031548 Bacteria 1125
235 Ga0307405_10236396 3300031731 Bacteria 1350
236 Ga0307413_10034518 3300031824 Bacteria 2892
237 Ga0307410_10036089 3300031852 Bacteria 3216
238 Ga0307410_10350858 3300031852 Bacteria 1179
239 Ga0307406_10715742 3300031901 Unclassified 837
240 Ga0307407_11100711 3300031903 Bacteria 617
241 Ga0307412_10094048 3300031911 Unclassified 2104
242 Ga0307409_100058888 3300031995 Bacteria 2986
243 Ga0307409_102018278 3300031995 Bacteria 606
244 Ga0307416_100033164 3300032002 Bacteria 3912
245 Ga0307416_100248827 3300032002 Bacteria 1728
246 Ga0307416_100401214 3300032002 Bacteria 1409
247 Ga0307416_100824307 3300032002 Bacteria 1025
248 Ga0307414_10727948 3300032004 Bacteria 900
249 Ga0307411_10229430 3300032005 Bacteria 1446
250 Ga0307415_100417656 3300032126 Bacteria 1150
251 Ga0307415_100632490 3300032126 Bacteria 957
252 Ga0373949_0173752 3300035090 Unclassified 635
253 Ga0373941_0014464 3300035115 Bacteria 2109
254 Ga0373943_0380624 3300035170 Bacteria 812
255 Ga0395900_1430558 3300037418 Unclassified 604
256 Ga0395901_0231682 3300038443 Bacteria 1928
257 Ga0439434_0266126 3300042435 Unclassified 588
258 Ga0466966_0187310 3300044684 Bacteria 1255
259 Ga0451576_0384824 3300045051 Bacteria 1470
260 Ga0451576_0889284 3300045051 Bacteria 935
261 Ga0451576_1286214 3300045051 Unclassified 763
262 Ga0466967_0966388 3300045976 Unclassified 848
263 Ga0495582_0398919 3300046473 Bacteria 793
264 Ga0495598_0005649 3300046537 Bacteria 2785
265 Ga0495621_0149867 3300046539 Unclassified 917
266 Ga0495668_0000925 3300046616 Bacteria 32756
267 Ga0495659_0107479 3300046664 Unclassified 1087
268 Ga0496100_0096260 3300048903 Bacteria 2031
269 Ga0496106_0005963 3300048909 Bacteria 9000
270 Ga0496107_0313351 3300048910 Bacteria 1168
271 Ga0496108_1458041 3300048911 Unclassified 571
272 Ga0501071_0764322 3300049587 Bacteria 745
273 Ga0501076_0503073 3300049592 Bacteria 999
274 Ga0501202_046802 3300049652 Unclassified 949
275 Ga0501235_031709 3300049669 Bacteria 1194
276 Ga0501239_015398 3300049672 Bacteria 894
277 Ga0501225_0018297 3300049705 Bacteria 1942
278 Ga0501225_0217001 3300049705 Unclassified 614
279 nmdc:mga05p37_107259_c1 3300050507 Bacteria 3436
280 nmdc:mga05p37_184380_c1 3300050507 Unclassified 2538
281 nmdc:mga05p37_435975_c1 3300050507 Bacteria 1521
282 nmdc:mga05p37_532095_c1 3300050507 Bacteria 1342
283 nmdc:mga09592_16704_c1 3300050508 Bacteria 6007
284 nmdc:mga09592_56198_c1 3300050508 Unclassified 3326
285 nmdc:mga09592_743710_c1 3300050508 Unclassified 832
286 nmdc:mga0qj67_47306_c1 3300050509 Unclassified 3398
287 nmdc:mga0qj67_95350_c1 3300050509 Bacteria 2395
288 nmdc:mga06r32_1832268_c1 3300050510 Unclassified 542
289 nmdc:mga06r32_211712_c1 3300050510 Bacteria 1926
290 nmdc:mga06r32_218301_c1 3300050510 Bacteria 1895
291 nmdc:mga06r32_351329_c1 3300050510 Bacteria 1459
292 nmdc:mga06r32_3871_c1 3300050510 Bacteria 13399
293 nmdc:mga06r32_660677_c1 3300050510 Bacteria 1013
294 nmdc:mga08y16_8724_c1 3300050511 Bacteria 10633
295 nmdc:mga0n895_116145_c1 3300050512 Bacteria 2695
296 nmdc:mga0n895_32484_c1 3300050512 Bacteria 5010
297 nmdc:mga0rr50_360211_c1 3300050513 Bacteria 1224
298 nmdc:mga0rr50_718010_c1 3300050513 Unclassified 853
299 nmdc:mga0a205_197579_c1 3300050515 Bacteria 1902
300 nmdc:mga0a205_50175_c1 3300050515 Bacteria 4028
301 nmdc:mga0a205_802960_c1 3300050515 Unclassified 789
302 Ga0501082_1350009 3300060353 Bacteria 623
303 Ga0207708_10584654
304 MBSR1b_contig_7228720
305 LJQas_1000028
306 JGI24034J14986_100193
307 JGI24748J21848_1000014
308 JGI24034J26672_10000012
309 JGI24742J22300_10046548
310 rootL2_10027889
311 Ga0065704_10474273
312 Ga0065715_10002211
313 Ga0070676_10515207
314 Ga0070690_100014111
315 Ga0070670_100077836
316 Ga0068869_100121044
317 Ga0070682_100054418
318 Ga0068868_100236779
319 Ga0068868_100362174
320 Ga0070689_100292578
321 Ga0070691_10944039
322 Ga0070687_100005965
323 Ga0070669_100062898
324 Ga0070669_100341523
325 Ga0070669_100634777
326 Ga0070669_100842287
327 Ga0070675_101447895
328 Ga0070671_100016570
329 Ga0070673_100022304
330 Ga0070673_100638184
331 Ga0070673_100871064
332 Ga0070688_100481288
333 Ga0070688_100971631
334 Ga0070701_10068285
335 Ga0070705_100167489
336 Ga0070705_100539710
337 Ga0070700_100161166
338 Ga0070700_101053007
339 Ga0070694_100014170
340 Ga0070694_100351256
341 Ga0070694_100562405
342 Ga0068867_100185789
343 Ga0068867_100300435
344 Ga0068867_100409089
345 Ga0070698_100033563
346 Ga0070699_100040543
347 Ga0070699_100176225
348 Ga0070697_100000211
349 Ga0068853_100595783
350 Ga0070672_100633214
351 Ga0070686_100051998
352 Ga0070686_100244900
353 Ga0070686_100325759
354 Ga0070695_100058345
355 Ga0070695_100484444
356 Ga0070695_100687899
357 Ga0070696_100104948
358 Ga0070696_100412695
359 Ga0070704_100215620
360 Ga0070704_100237079
361 Ga0070704_100269638
362 Ga0070704_100436709
363 Ga0068854_100206735
364 Ga0068854_100244344
365 Ga0068854_100504716
366 Ga0070702_100805533
367 Ga0068859_100313533
368 Ga0068859_101360237
369 Ga0068864_100070651
370 Ga0068864_102502231
371 Ga0068866_10191532
372 Ga0068861_100251391
373 Ga0068861_101121894
374 Ga0068870_10028618
375 Ga0068870_10191415
376 Ga0068858_100000602
377 Ga0068858_100292696
378 Ga0068858_100466988
379 Ga0068860_100026217
380 Ga0068860_100033651
381 Ga0068860_100089055
382 Ga0068862_100294857
383 Ga0081539_10003894
384 Ga0097621_101318177
385 Ga0075428_100001740
386 Ga0075428_100046917
387 Ga0075428_100923670
388 Ga0075430_100045910
389 Ga0075430_100460129
390 Ga0075430_101230927
391 Ga0075431_100144153
392 Ga0075431_100234279
393 Ga0075433_10020407
394 Ga0075433_10170439
395 Ga0075433_10171380
396 Ga0075433_10349757
397 Ga0075433_10403780
398 Ga0075434_100068028
399 Ga0075434_100726538
400 Ga0075429_100019910
401 Ga0068865_100260866
402 Ga0068865_100628863
403 Ga0068865_101430125
404 Ga0097620_100053747
405 Ga0097620_100313528
406 Ga0097620_101360345
407 Ga0075435_100433301
408 Ga0105240_10457247
409 Ga0105240_10695255
410 Ga0111539_10004112
411 Ga0111539_10363199
412 Ga0111539_10982784
413 Ga0105245_10712228
414 Ga0105247_10000050
415 Ga0105247_10574497
416 Ga0114129_10042813
417 Ga0114129_10129986
418 Ga0114129_10544595
419 Ga0114129_10557862
420 Ga0114129_11007445
421 Ga0105243_10000429
422 Ga0105243_10116890
423 Ga0105243_10153744
424 Ga0105243_10176888
425 Ga0105241_10107554
426 Ga0105241_10276815
427 Ga0105241_11767784
428 Ga0105242_10002790
429 Ga0105242_10019330
430 Ga0105242_10485887
431 Ga0105242_11136273
432 Ga0105248_10423865
433 Ga0105248_10450214
434 Ga0105248_10586061
435 Ga0105248_12173809
436 Ga0105249_10010787
437 Ga0105249_10116130
438 Ga0105249_10454358
439 Ga0105249_10632609
440 Ga0105239_10019903
441 Ga0105246_10208732
442 Ga0105246_10681308
443 Ga0105246_10817370
444 Ga0157373_10307651
445 Ga0157373_10766340
446 Ga0157371_11519344
447 Ga0157378_10000047
448 Ga0157378_10017724
449 Ga0157378_10018093
450 Ga0157378_10041730
451 Ga0157378_10044058
452 Ga0157378_10050626
453 Ga0157378_10276067
454 Ga0157378_10619373
455 Ga0163162_10018128
456 Ga0163162_10246800
457 Ga0157375_10087835
458 Ga0157375_10242946
459 Ga0157375_12916021
460 Ga0163163_10128304
461 Ga0157380_10006200
462 Ga0157380_10098719
463 Ga0157380_10606808
464 Ga0157380_11021713
465 Ga0157377_10281118
466 Ga0157377_10595951
467 Ga0157379_10050445
468 Ga0163161_10018708
469 Ga0163161_10136201
470 Ga0163161_10430163
471 Ga0163161_10693424
472 Ga0207672_1000004
473 Ga0207642_10157196
474 Ga0207710_10000003
475 Ga0207645_10182978
476 Ga0207643_10002814
477 Ga0207643_10082452
478 Ga0207662_10555947
479 Ga0207681_10120195
480 Ga0207681_10733716
481 Ga0207681_10998076
482 Ga0207650_10000005
483 Ga0207650_10543029
484 Ga0207650_11410612
485 Ga0207644_10004802
486 Ga0207686_10010415
487 Ga0207686_10011175
488 Ga0207709_10117979
489 Ga0207709_10157234
490 Ga0207704_10062685
491 Ga0207704_10600695
492 Ga0207704_11281132
493 Ga0207691_10570703
494 Ga0207711_10324283
495 Ga0207711_10334690
496 Ga0207711_11417592
497 Ga0207689_10069159
498 Ga0207689_10172515
499 Ga0207689_11402397
500 Ga0207651_10018386
501 Ga0207651_10706246
502 Ga0207712_10567009
503 Ga0207712_11193001
504 Ga0207640_10477814
505 Ga0207677_10060795
506 Ga0207703_10000355
507 Ga0207703_10055618
508 Ga0207703_10265481
509 Ga0207703_10469516
510 Ga0207639_10272050
511 Ga0207708_10015134
512 Ga0207708_10040828
513 Ga0207641_10028173
514 Ga0207648_10054749
515 Ga0207648_10063303
516 Ga0207648_10195299
517 Ga0207648_10250775
518 Ga0207648_10361644
519 Ga0207676_10009343
520 Ga0207676_10550009
521 Ga0207675_100002096
522 Ga0207675_100037152
523 Ga0207698_11256265
524 Ga0207428_10028285
525 Ga0268265_10124970
526 Ga0268265_11060724
527 Ga0268265_11132232
528 Ga0268265_12226318
529 Ga0268264_10007184
530 Ga0268264_10024586
531 Ga0268264_10025234
532 Ga0268264_10028706
533 Ga0268264_10326019
534 Ga0265338_10053372
535 Ga0307408_100220313
536 Ga0307408_100442919
537 Ga0307405_10236396
538 Ga0307413_10034518
539 Ga0307410_10036089
540 Ga0307410_10350858
541 Ga0307406_10715742
542 Ga0307407_11100711
543 Ga0307412_10094048
544 Ga0307409_100058888
545 Ga0307409_102018278
546 Ga0307416_100033164
547 Ga0307416_100248827
548 Ga0307416_100401214
549 Ga0307416_100824307
550 Ga0307414_10727948
551 Ga0307411_10229430
552 Ga0307415_100417656
553 Ga0307415_100632490
554 Ga0373949_0173752
555 Ga0373941_0014464
556 Ga0373943_0380624
557 Ga0395900_1430558
558 Ga0395901_0231682
559 Ga0439434_0266126
560 Ga0466966_0187310
561 Ga0451576_0384824
562 Ga0451576_0889284
563 Ga0451576_1286214
564 Ga0466967_0966388
565 Ga0495582_0398919
566 Ga0495598_0005649
567 Ga0495621_0149867
568 Ga0495668_0000925
569 Ga0495659_0107479
570 Ga0496100_0096260
571 Ga0496106_0005963
572 Ga0496107_0313351
573 Ga0496108_1458041
574 Ga0501071_0764322
575 Ga0501076_0503073
576 Ga0501202_046802
577 Ga0501235_031709
578 Ga0501239_015398
579 Ga0501225_0018297
580 Ga0501225_0217001
581 nmdc:mga05p37_107259_c1
582 nmdc:mga05p37_184380_c1
583 nmdc:mga05p37_435975_c1
584 nmdc:mga05p37_532095_c1
585 nmdc:mga09592_16704_c1
586 nmdc:mga09592_56198_c1
587 nmdc:mga09592_743710_c1
588 nmdc:mga0qj67_47306_c1
589 nmdc:mga0qj67_95350_c1
590 nmdc:mga06r32_1832268_c1
591 nmdc:mga06r32_211712_c1
592 nmdc:mga06r32_218301_c1
593 nmdc:mga06r32_351329_c1
594 nmdc:mga06r32_3871_c1
595 nmdc:mga06r32_660677_c1
596 nmdc:mga08y16_8724_c1
597 nmdc:mga0n895_116145_c1
598 nmdc:mga0n895_32484_c1
599 nmdc:mga0rr50_360211_c1
600 nmdc:mga0rr50_718010_c1
601 nmdc:mga0a205_197579_c1
602 nmdc:mga0a205_50175_c1
603 nmdc:mga0a205_802960_c1
604 Ga0501082_1350009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

32

152

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9362 9 145
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9306 9 144
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9276 8 147
3q9u-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9232 8 147
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9173 9 144
ID Description Score Start End Superfamily
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9306 9 144 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9173 9 144 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8952 20 142 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8818 9 145 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.878 22 139 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V6T1N2-F1-model_v4 CoA-binding protein 1.003 1 135
AF-A0A352FQP4-F1-model_v4 CoA-binding protein 1.002 1 144
AF-A0A7W1W8Z4-F1-model_v4 CoA-binding protein 1.002 1 143
AF-I7ZGR8-F1-model_v4 CoA-binding domain-containing protein 0.9984 1 143
AF-A0A1M3NI74-F1-model_v4 CoA-binding protein 0.9976 6 146

Map