F396387

General Info

Members Datasets Scaffolds Average Seq Length
302 221 604 240

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100054585|Ga0068855_1000545853
Length 242
Sequence MVDKQYDFTGLKALFFNGTLTKSPEKSHTETLINISKTIMEKHGVRTELIRTIDHDIATGVWPDMREHGWNTDEWPALFKQVMEADILVIAGPIWLGDNSSQTKKLIERLYACSGILNKQGQYAFYGKVGGCLITGNEDGIKHCAMNVLYSLQHLGYVIPPQADAGWIGEAGPGPSYGDQKKDGGKVGLDNDFTNRNTTFMTWNLMHLAQLLKANGGIPAYGNQRSEWDAGSRFDFSNPEYR

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
16 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
75 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
76 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
77 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
78 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
79 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
80 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
85 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
86 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
87 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
90 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
91 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
92 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
93 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
98 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
101 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
110 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
118 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
119 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
122 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
123 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
124 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
125 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
126 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
131 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
134 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
137 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
138 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
139 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
142 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
143 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
170 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
189 2643221576 Nocardioides sp. Root614 Isolate Unclassified
190 2643221590 Nocardioides sp. Root682 Isolate Unclassified
191 2643221617 Nocardioides sp. Root79 Isolate Unclassified
192 2643221620 Nocardioides sp. Root240 Isolate Unclassified
193 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
194 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
195 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
196 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
197 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
198 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
199 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
200 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
201 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
202 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
203 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
204 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
205 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
206 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
207 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
208 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
209 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
210 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
211 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
212 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
213 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
214 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
215 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
216 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
217 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
218 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
219 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
220 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
221 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.41
Metatranscriptomes 0.66
Isolates 10.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.95
Nodule 0
Rhizoplane 6.62
Rhizosphere 80.46
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100054585 3300005563 Bacteria 4696
2 JGI25152J39213_1000243 3300002773 Bacteria 36351
3 JGI25151J46595_10034679 3300003187 Bacteria 1927
4 Ga0065714_10123872 3300005288 Bacteria 1317
5 Ga0070658_10463242 3300005327 Bacteria 1093
6 Ga0070666_10049731 3300005335 Bacteria 2818
7 Ga0070673_100147942 3300005364 Bacteria 1987
8 Ga0070667_100000001 3300005367 Bacteria 1108638
9 Ga0070684_100154718 3300005535 Bacteria 2079
10 Ga0068854_100002466 3300005578 Bacteria 11446
11 Ga0068856_101068028 3300005614 Bacteria 825
12 Ga0068859_100985563 3300005617 Bacteria 925
13 Ga0068860_100014612 3300005843 Bacteria 7683
14 Ga0081455_10000287 3300005937 Bacteria 66731
15 Ga0081538_10036776 3300005981 Bacteria 3188
16 Ga0081539_10100174 3300005985 Bacteria 1478
17 Ga0075365_10486942 3300006038 Bacteria 872
18 Ga0075368_10128296 3300006042 Bacteria 1053
19 Ga0075363_100145082 3300006048 Bacteria 1338
20 Ga0075364_10119590 3300006051 Bacteria 1763
21 Ga0075432_10001528 3300006058 Bacteria 7581
22 Ga0075432_10021928 3300006058 Bacteria 2183
23 Ga0075362_10007819 3300006177 Unclassified 4066
24 Ga0075367_10354544 3300006178 Bacteria 926
25 Ga0075369_10000001 3300006186 Bacteria 299616
26 Ga0075366_10026994 3300006195 Bacteria 3367
27 Ga0075370_10328867 3300006353 Bacteria 911
28 Ga0075428_100039458 3300006844 Bacteria 5197
29 Ga0075431_100008287 3300006847 Bacteria 10391
30 Ga0075431_100031358 3300006847 Bacteria 5475
31 Ga0075433_10085984 3300006852 Bacteria 2777
32 Ga0075429_100020577 3300006880 Bacteria 5726
33 Ga0097620_100985296 3300006931 Bacteria 925
34 Ga0105244_10033386 3300009036 Bacteria 2714
35 Ga0105244_10106878 3300009036 Bacteria 1365
36 Ga0111539_10116436 3300009094 Bacteria 3134
37 Ga0105245_10235149 3300009098 Bacteria 1774
38 Ga0114129_10017154 3300009147 Bacteria 10312
39 Ga0105241_10000225 3300009174 Bacteria 42642
40 Ga0105237_10006962 3300009545 Bacteria 12462
41 Ga0105238_10314241 3300009551 Bacteria 1552
42 Ga0105238_10358085 3300009551 Bacteria 1448
43 Ga0105033_100100 3300009986 Bacteria 6669
44 Ga0105239_10046124 3300010375 Bacteria 4776
45 Ga0105246_10001614 3300011119 Bacteria 13425
46 Ga0105246_10182830 3300011119 Bacteria 1616
47 Ga0105246_10185063 3300011119 Bacteria 1607
48 Ga0105246_10379397 3300011119 Bacteria 1168
49 Ga0157373_10022137 3300013100 Bacteria 4612
50 Ga0157373_10119750 3300013100 Bacteria 1850
51 Ga0157370_10310321 3300013104 Bacteria 1456
52 Ga0157369_10000024 3300013105 Bacteria 225851
53 Ga0157369_10106350 3300013105 Bacteria 2986
54 Ga0157378_10110080 3300013297 Bacteria 2524
55 Ga0157378_10278569 3300013297 Bacteria 1611
56 Ga0157372_10750745 3300013307 Bacteria 1135
57 Ga0157375_10253295 3300013308 Bacteria 1921
58 Ga0157377_10328233 3300014745 Bacteria 1019
59 Ga0206353_11821658 3300020082 Bacteria 1247
60 Ga0209129_1000047 3300025258 Bacteria 270566
61 Ga0209025_1001093 3300025294 Bacteria 39190
62 Ga0209051_1029770 3300025303 Bacteria 2131
63 Ga0207697_10024796 3300025315 Bacteria 2454
64 Ga0207655_1009332 3300025728 Bacteria 6103
65 Ga0207655_1082029 3300025728 Bacteria 1160
66 Ga0207692_10352235 3300025898 Bacteria 908
67 Ga0207710_10111085 3300025900 Bacteria 1301
68 Ga0207688_10116000 3300025901 Bacteria 1559
69 Ga0207654_10002921 3300025911 Bacteria 8666
70 Ga0207671_10426154 3300025914 Bacteria 1056
71 Ga0207694_10623861 3300025924 Bacteria 907
72 Ga0207687_10187715 3300025927 Bacteria 1606
73 Ga0207664_10335446 3300025929 Bacteria 1336
74 Ga0207709_10022781 3300025935 Bacteria 3556
75 Ga0207709_10059013 3300025935 Bacteria 2387
76 Ga0207661_10399111 3300025944 Bacteria 1247
77 Ga0207667_10024899 3300025949 Bacteria 6562
78 Ga0207640_10001451 3300025981 Bacteria 12821
79 Ga0207658_10000003 3300025986 Bacteria 1151934
80 Ga0207702_10646546 3300026078 Bacteria 1040
81 Ga0207683_10247963 3300026121 Bacteria 1625
82 Ga0207428_10015349 3300027907 Bacteria 6628
83 Ga0207428_10017973 3300027907 Bacteria 6055
84 Ga0268264_10004246 3300028381 Bacteria 12231
85 Ga0307408_100015192 3300031548 Bacteria 5124
86 Ga0307408_100041760 3300031548 Bacteria 3253
87 Ga0307408_100085077 3300031548 Bacteria 2373
88 Ga0307408_100311081 3300031548 Bacteria 1323
89 Ga0307405_10057671 3300031731 Bacteria 2440
90 Ga0307405_10071991 3300031731 Bacteria 2226
91 Ga0307413_10107141 3300031824 Bacteria 1862
92 Ga0307413_10134977 3300031824 Bacteria 1695
93 Ga0307410_10040142 3300031852 Bacteria 3078
94 Ga0307410_10043414 3300031852 Bacteria 2979
95 Ga0307410_10056427 3300031852 Bacteria 2671
96 Ga0307410_10057206 3300031852 Bacteria 2654
97 Ga0307410_10074544 3300031852 Bacteria 2363
98 Ga0307410_10288756 3300031852 Bacteria 1290
99 Ga0307410_10330242 3300031852 Bacteria 1212
100 Ga0307406_10071389 3300031901 Bacteria 2276
101 Ga0307407_10003235 3300031903 Bacteria 6623
102 Ga0307407_10160550 3300031903 Bacteria 1470
103 Ga0307412_10011987 3300031911 Bacteria 5035
104 Ga0307412_10025152 3300031911 Bacteria 3684
105 Ga0307412_10026850 3300031911 Bacteria 3584
106 Ga0307412_10081403 3300031911 Bacteria 2239
107 Ga0307412_10140830 3300031911 Bacteria 1766
108 Ga0307412_10150890 3300031911 Bacteria 1714
109 Ga0307409_100002076 3300031995 Bacteria 10299
110 Ga0307409_100038293 3300031995 Bacteria 3545
111 Ga0307409_100047972 3300031995 Bacteria 3246
112 Ga0307409_100194872 3300031995 Bacteria 1807
113 Ga0307416_100075205 3300032002 Bacteria 2825
114 Ga0307416_100457219 3300032002 Bacteria 1331
115 Ga0307416_100639522 3300032002 Bacteria 1147
116 Ga0307414_10301658 3300032004 Bacteria 1355
117 Ga0307411_10021064 3300032005 Bacteria 3806
118 Ga0307411_10065186 3300032005 Bacteria 2442
119 Ga0307411_10072592 3300032005 Bacteria 2337
120 Ga0307415_100216218 3300032126 Bacteria 1533
121 Ga0395899_0229771 3300037312 Bacteria 1281
122 Ga0395900_0010538 3300037418 Bacteria 9456
123 Ga0395900_0037065 3300037418 Bacteria 5028
124 Ga0395900_0146614 3300037418 Bacteria 2413
125 Ga0395898_0021777 3300037466 Bacteria 6495
126 Ga0395905_0345137 3300037471 Bacteria 1380
127 Ga0395901_0680536 3300038443 Bacteria 1028
128 Ga0439436_0011977 3300041404 Bacteria 2633
129 Ga0439466_0008191 3300041411 Bacteria 3940
130 Ga0439466_0011095 3300041411 Bacteria 3338
131 Ga0439465_0005652 3300041413 Bacteria 3982
132 Ga0439433_0005579 3300041999 Bacteria 2701
133 Ga0439433_0009500 3300041999 Bacteria 2120
134 Ga0439433_0027626 3300041999 Bacteria 1288
135 Ga0439442_000050 3300042002 Bacteria 26935
136 Ga0439442_000170 3300042002 Bacteria 16536
137 Ga0439449_0001493 3300042007 Bacteria 9168
138 Ga0439449_0008188 3300042007 Bacteria 3974
139 Ga0439449_0076711 3300042007 Bacteria 1232
140 Ga0439452_028028 3300042010 Bacteria 1409
141 Ga0439462_0020575 3300042015 Bacteria 1721
142 Ga0450920_000347 3300042122 Bacteria 7105
143 Ga0450907_000103 3300042146 Bacteria 32604
144 Ga0439434_0000050 3300042435 Bacteria 28880
145 Ga0439434_0012814 3300042435 Bacteria 2485
146 Ga0450918_000206 3300042531 Bacteria 13400
147 Ga0466967_0894741 3300045976 Bacteria 883
148 Ga0495629_0044763 3300046459 Bacteria 3106
149 Ga0495638_0000557 3300046460 Bacteria 42474
150 Ga0495653_0004336 3300046463 Bacteria 11475
151 Ga0495580_0033331 3300046472 Bacteria 3713
152 Ga0495582_0097985 3300046473 Bacteria 1640
153 Ga0495662_0004760 3300046476 Bacteria 6803
154 Ga0495664_0005892 3300046477 Bacteria 6744
155 Ga0495630_0071286 3300046517 Bacteria 2615
156 Ga0495631_0042590 3300046518 Bacteria 2006
157 Ga0495665_0009458 3300046531 Bacteria 5275
158 Ga0495665_0083068 3300046531 Bacteria 1684
159 Ga0495586_0002636 3300046535 Bacteria 9702
160 Ga0495586_0014161 3300046535 Bacteria 4237
161 Ga0495587_0000659 3300046536 Bacteria 23107
162 Ga0495645_0003079 3300046543 Bacteria 11297
163 Ga0495633_0118320 3300046558 Bacteria 1227
164 Ga0495667_0003775 3300046559 Bacteria 10175
165 Ga0495656_0033099 3300046615 Bacteria 2107
166 Ga0495588_0136600 3300046674 Bacteria 1294
167 Ga0495623_0009916 3300046679 Bacteria 6169
168 Ga0495670_0000473 3300046691 Bacteria 19093
169 Ga0495600_0003927 3300046809 Bacteria 8832
170 Ga0495581_0003977 3300047315 Bacteria 8515
171 Ga0495581_0008036 3300047315 Bacteria 6109
172 Ga0495604_0146255 3300047317 Bacteria 1684
173 Ga0495636_0010357 3300047318 Bacteria 3681
174 Ga0495674_0263001 3300047319 Bacteria 1417
175 Ga0495680_0014287 3300047322 Bacteria 6884
176 Ga0495675_0009576 3300047444 Bacteria 6034
177 Ga0495685_071295 3300047447 Bacteria 1163
178 Ga0495681_0117664 3300047470 Bacteria 1144
179 Ga0495593_0024740 3300047673 Bacteria 3325
180 Ga0496101_0098404 3300048904 Bacteria 2185
181 Ga0496101_0161304 3300048904 Bacteria 1719
182 Ga0496102_0039569 3300048905 Bacteria 4260
183 Ga0496102_0047058 3300048905 Bacteria 3918
184 Ga0496102_0075102 3300048905 Bacteria 3107
185 Ga0496102_0147930 3300048905 Bacteria 2205
186 Ga0496102_0300548 3300048905 Bacteria 1513
187 Ga0496103_0009023 3300048906 Bacteria 5905
188 Ga0496104_0336113 3300048907 Bacteria 1423
189 Ga0496104_0531208 3300048907 Bacteria 1087
190 Ga0496106_0026334 3300048909 Bacteria 4330
191 Ga0496106_0198446 3300048909 Bacteria 1596
192 Ga0496108_0403323 3300048911 Bacteria 1194
193 Ga0496109_0251739 3300048912 Bacteria 1663
194 Ga0496110_0025156 3300048913 Bacteria 5084
195 Ga0496110_0260124 3300048913 Bacteria 1579
196 Ga0496112_0237251 3300048915 Bacteria 1777
197 Ga0496113_0102628 3300048916 Bacteria 2218
198 Ga0496114_0005205 3300048917 Bacteria 10157
199 Ga0496114_0417330 3300048917 Bacteria 1188
200 Ga0501291_002312 3300049514 Bacteria 2271
201 Ga0501311_018275 3300049527 Bacteria 930
202 Ga0501031_0022375 3300049568 Bacteria 4120
203 Ga0501032_0001602 3300049569 Bacteria 18047
204 Ga0501032_0072659 3300049569 Bacteria 2293
205 Ga0501033_0028148 3300049570 Bacteria 4224
206 Ga0501036_0030328 3300049572 Bacteria 4570
207 Ga0501036_0518991 3300049572 Bacteria 991
208 Ga0501037_0027690 3300049573 Bacteria 4188
209 Ga0501037_0071115 3300049573 Bacteria 2531
210 Ga0501037_0106971 3300049573 Bacteria 2015
211 Ga0501038_0019894 3300049574 Bacteria 6042
212 Ga0501038_0039749 3300049574 Bacteria 4114
213 Ga0501038_0117495 3300049574 Bacteria 2196
214 Ga0501039_0019163 3300049575 Bacteria 5250
215 Ga0501039_0108882 3300049575 Bacteria 2165
216 Ga0501040_0020770 3300049576 Bacteria 4379
217 Ga0501040_0328482 3300049576 Bacteria 1094
218 Ga0501041_0048284 3300049577 Bacteria 2592
219 Ga0501041_0107944 3300049577 Bacteria 1726
220 Ga0501042_0034836 3300049578 Bacteria 3571
221 Ga0501043_0048280 3300049579 Bacteria 3347
222 Ga0501043_0112431 3300049579 Bacteria 2138
223 Ga0501046_0034711 3300049580 Bacteria 4068
224 Ga0501048_0008105 3300049582 Bacteria 7951
225 Ga0501068_0145984 3300049584 Bacteria 1485
226 Ga0501070_0012873 3300049586 Bacteria 7048
227 Ga0501070_0090005 3300049586 Bacteria 2540
228 Ga0501070_0439984 3300049586 Bacteria 1052
229 Ga0501071_0124077 3300049587 Bacteria 1915
230 Ga0501072_0071815 3300049588 Bacteria 2735
231 Ga0501073_0142168 3300049589 Bacteria 1663
232 Ga0501075_0040260 3300049591 Bacteria 3499
233 Ga0501076_0023542 3300049592 Bacteria 4749
234 Ga0501076_0069929 3300049592 Bacteria 2805
235 Ga0501077_0053427 3300049593 Bacteria 2565
236 Ga0501079_0018295 3300049741 Bacteria 5354
237 Ga0501080_0020642 3300049742 Bacteria 6102
238 Ga0501080_0048036 3300049742 Bacteria 3974
239 Ga0501081_0021306 3300049743 Bacteria 4324
240 Ga0501083_0033902 3300049744 Bacteria 3494
241 Ga0501276_000717 3300049773 Bacteria 2079
242 Ga0501035_0059173 3300049822 Bacteria 3412
243 Ga0501035_0110506 3300049822 Bacteria 2409
244 Ga0501044_0009869 3300049823 Bacteria 10377
245 Ga0501044_0067126 3300049823 Bacteria 3655
246 Ga0501045_0019101 3300049824 Bacteria 4882
247 Ga0501045_0142488 3300049824 Bacteria 1782
248 Ga0501045_0667256 3300049824 Bacteria 768
249 nmdc:mga03683_4423_c1 3300050489 Bacteria 4662
250 nmdc:mga00v17_50393_c1 3300050491 Bacteria 2529
251 nmdc:mga0k408_3053_c1 3300050493 Bacteria 8883
252 nmdc:mga07m45_130297_c1 3300050496 Bacteria 1455
253 nmdc:mga07m45_313832_c1 3300050496 Bacteria 911
254 nmdc:mga05p37_1627_c1 3300050507 Bacteria 26035
255 nmdc:mga05p37_729933_c1 3300050507 Bacteria 1095
256 nmdc:mga09592_361_c1 3300050508 Bacteria 33195
257 nmdc:mga0qj67_37997_c1 3300050509 Bacteria 3775
258 nmdc:mga0qj67_522951_c1 3300050509 Bacteria 953
259 nmdc:mga06r32_424_c1 3300050510 Bacteria 35538
260 nmdc:mga06r32_7232_c1 3300050510 Bacteria 10006
261 nmdc:mga08y16_157577_c1 3300050511 Bacteria 2360
262 nmdc:mga0a205_97547_c1 3300050515 Bacteria 2838
263 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
264 Ga0495601_0074997 3300053077 Bacteria 2165
265 Ga0500620_006904 3300053155 Unclassified 2763
266 Ga0501084_0092926 3300054114 Bacteria 2532
267 Ga0501084_0093310 3300054114 Bacteria 2527
268 Ga0501082_0215295 3300060353 Bacteria 1671
269 Ga0530510_0003798 3300061734 Bacteria 10401
270 2643891046 2643221576 Bacteria 5214352
271 2643960102 2643221590 Bacteria 5214697
272 2644101141 2643221617 Bacteria 5139111
273 2644118022 2643221620 Bacteria 5134593
274 2738705263 2738541274 Bacteria 6909446
275 2739334827 2738543028 Bacteria 6917070
276 2775654801 2775506735 Bacteria 4556596
277 2808827969 2808606357 Bacteria 4466944
278 2808892219 2808606370 Bacteria 4942454
279 2812320265 2811994871 Bacteria 4497550
280 2812330195 2811994874 Bacteria 5367947
281 2816509103 2816332139 Bacteria 9138787
282 2839990250 2839989709 Bacteria 3773432
283 2844849841 2844849076 Bacteria 4091819
284 2857741052 2857740372 Bacteria 4782044
285 2904500286 2904497146 Bacteria 4731781
286 2910813126 2910809715 Bacteria 4982797
287 2919036456 2919034639 Bacteria 4763403
288 2919059531 2919059106 Bacteria 4991624
289 2919392892 2919391150 Bacteria 4884741
290 2919540915 2919538618 Bacteria 4677069
291 2932398493 2932398195 Bacteria 3847976
292 2932427050 2932426870 Bacteria 4547726
293 2933419680 2933418574 Bacteria 4476724
294 2939649921 2939647034 Bacteria 4681660
295 2939677370 2939674588 Bacteria 4844420
296 2945918012 2945916053 Bacteria 4555517
297 2945942085 2945941187 Bacteria 4682474
298 2946061852 2946059875 Bacteria 4386623
299 2953999344 2953998280 Bacteria 4812144
300 2956941108 2956939328 Bacteria 3474458
301 2974306051 2974302888 Bacteria 4369871
302 3001120798 3001119090 Bacteria 3449530
303 Ga0068855_100054585
304 JGI25152J39213_1000243
305 JGI25151J46595_10034679
306 Ga0065714_10123872
307 Ga0070658_10463242
308 Ga0070666_10049731
309 Ga0070673_100147942
310 Ga0070667_100000001
311 Ga0070684_100154718
312 Ga0068854_100002466
313 Ga0068856_101068028
314 Ga0068859_100985563
315 Ga0068860_100014612
316 Ga0081455_10000287
317 Ga0081538_10036776
318 Ga0081539_10100174
319 Ga0075365_10486942
320 Ga0075368_10128296
321 Ga0075363_100145082
322 Ga0075364_10119590
323 Ga0075432_10001528
324 Ga0075432_10021928
325 Ga0075362_10007819
326 Ga0075367_10354544
327 Ga0075369_10000001
328 Ga0075366_10026994
329 Ga0075370_10328867
330 Ga0075428_100039458
331 Ga0075431_100008287
332 Ga0075431_100031358
333 Ga0075433_10085984
334 Ga0075429_100020577
335 Ga0097620_100985296
336 Ga0105244_10033386
337 Ga0105244_10106878
338 Ga0111539_10116436
339 Ga0105245_10235149
340 Ga0114129_10017154
341 Ga0105241_10000225
342 Ga0105237_10006962
343 Ga0105238_10314241
344 Ga0105238_10358085
345 Ga0105033_100100
346 Ga0105239_10046124
347 Ga0105246_10001614
348 Ga0105246_10182830
349 Ga0105246_10185063
350 Ga0105246_10379397
351 Ga0157373_10022137
352 Ga0157373_10119750
353 Ga0157370_10310321
354 Ga0157369_10000024
355 Ga0157369_10106350
356 Ga0157378_10110080
357 Ga0157378_10278569
358 Ga0157372_10750745
359 Ga0157375_10253295
360 Ga0157377_10328233
361 Ga0206353_11821658
362 Ga0209129_1000047
363 Ga0209025_1001093
364 Ga0209051_1029770
365 Ga0207697_10024796
366 Ga0207655_1009332
367 Ga0207655_1082029
368 Ga0207692_10352235
369 Ga0207710_10111085
370 Ga0207688_10116000
371 Ga0207654_10002921
372 Ga0207671_10426154
373 Ga0207694_10623861
374 Ga0207687_10187715
375 Ga0207664_10335446
376 Ga0207709_10022781
377 Ga0207709_10059013
378 Ga0207661_10399111
379 Ga0207667_10024899
380 Ga0207640_10001451
381 Ga0207658_10000003
382 Ga0207702_10646546
383 Ga0207683_10247963
384 Ga0207428_10015349
385 Ga0207428_10017973
386 Ga0268264_10004246
387 Ga0307408_100015192
388 Ga0307408_100041760
389 Ga0307408_100085077
390 Ga0307408_100311081
391 Ga0307405_10057671
392 Ga0307405_10071991
393 Ga0307413_10107141
394 Ga0307413_10134977
395 Ga0307410_10040142
396 Ga0307410_10043414
397 Ga0307410_10056427
398 Ga0307410_10057206
399 Ga0307410_10074544
400 Ga0307410_10288756
401 Ga0307410_10330242
402 Ga0307406_10071389
403 Ga0307407_10003235
404 Ga0307407_10160550
405 Ga0307412_10011987
406 Ga0307412_10025152
407 Ga0307412_10026850
408 Ga0307412_10081403
409 Ga0307412_10140830
410 Ga0307412_10150890
411 Ga0307409_100002076
412 Ga0307409_100038293
413 Ga0307409_100047972
414 Ga0307409_100194872
415 Ga0307416_100075205
416 Ga0307416_100457219
417 Ga0307416_100639522
418 Ga0307414_10301658
419 Ga0307411_10021064
420 Ga0307411_10065186
421 Ga0307411_10072592
422 Ga0307415_100216218
423 Ga0395899_0229771
424 Ga0395900_0010538
425 Ga0395900_0037065
426 Ga0395900_0146614
427 Ga0395898_0021777
428 Ga0395905_0345137
429 Ga0395901_0680536
430 Ga0439436_0011977
431 Ga0439466_0008191
432 Ga0439466_0011095
433 Ga0439465_0005652
434 Ga0439433_0005579
435 Ga0439433_0009500
436 Ga0439433_0027626
437 Ga0439442_000050
438 Ga0439442_000170
439 Ga0439449_0001493
440 Ga0439449_0008188
441 Ga0439449_0076711
442 Ga0439452_028028
443 Ga0439462_0020575
444 Ga0450920_000347
445 Ga0450907_000103
446 Ga0439434_0000050
447 Ga0439434_0012814
448 Ga0450918_000206
449 Ga0466967_0894741
450 Ga0495629_0044763
451 Ga0495638_0000557
452 Ga0495653_0004336
453 Ga0495580_0033331
454 Ga0495582_0097985
455 Ga0495662_0004760
456 Ga0495664_0005892
457 Ga0495630_0071286
458 Ga0495631_0042590
459 Ga0495665_0009458
460 Ga0495665_0083068
461 Ga0495586_0002636
462 Ga0495586_0014161
463 Ga0495587_0000659
464 Ga0495645_0003079
465 Ga0495633_0118320
466 Ga0495667_0003775
467 Ga0495656_0033099
468 Ga0495588_0136600
469 Ga0495623_0009916
470 Ga0495670_0000473
471 Ga0495600_0003927
472 Ga0495581_0003977
473 Ga0495581_0008036
474 Ga0495604_0146255
475 Ga0495636_0010357
476 Ga0495674_0263001
477 Ga0495680_0014287
478 Ga0495675_0009576
479 Ga0495685_071295
480 Ga0495681_0117664
481 Ga0495593_0024740
482 Ga0496101_0098404
483 Ga0496101_0161304
484 Ga0496102_0039569
485 Ga0496102_0047058
486 Ga0496102_0075102
487 Ga0496102_0147930
488 Ga0496102_0300548
489 Ga0496103_0009023
490 Ga0496104_0336113
491 Ga0496104_0531208
492 Ga0496106_0026334
493 Ga0496106_0198446
494 Ga0496108_0403323
495 Ga0496109_0251739
496 Ga0496110_0025156
497 Ga0496110_0260124
498 Ga0496112_0237251
499 Ga0496113_0102628
500 Ga0496114_0005205
501 Ga0496114_0417330
502 Ga0501291_002312
503 Ga0501311_018275
504 Ga0501031_0022375
505 Ga0501032_0001602
506 Ga0501032_0072659
507 Ga0501033_0028148
508 Ga0501036_0030328
509 Ga0501036_0518991
510 Ga0501037_0027690
511 Ga0501037_0071115
512 Ga0501037_0106971
513 Ga0501038_0019894
514 Ga0501038_0039749
515 Ga0501038_0117495
516 Ga0501039_0019163
517 Ga0501039_0108882
518 Ga0501040_0020770
519 Ga0501040_0328482
520 Ga0501041_0048284
521 Ga0501041_0107944
522 Ga0501042_0034836
523 Ga0501043_0048280
524 Ga0501043_0112431
525 Ga0501046_0034711
526 Ga0501048_0008105
527 Ga0501068_0145984
528 Ga0501070_0012873
529 Ga0501070_0090005
530 Ga0501070_0439984
531 Ga0501071_0124077
532 Ga0501072_0071815
533 Ga0501073_0142168
534 Ga0501075_0040260
535 Ga0501076_0023542
536 Ga0501076_0069929
537 Ga0501077_0053427
538 Ga0501079_0018295
539 Ga0501080_0020642
540 Ga0501080_0048036
541 Ga0501081_0021306
542 Ga0501083_0033902
543 Ga0501276_000717
544 Ga0501035_0059173
545 Ga0501035_0110506
546 Ga0501044_0009869
547 Ga0501044_0067126
548 Ga0501045_0019101
549 Ga0501045_0142488
550 Ga0501045_0667256
551 nmdc:mga03683_4423_c1
552 nmdc:mga00v17_50393_c1
553 nmdc:mga0k408_3053_c1
554 nmdc:mga07m45_130297_c1
555 nmdc:mga07m45_313832_c1
556 nmdc:mga05p37_1627_c1
557 nmdc:mga05p37_729933_c1
558 nmdc:mga09592_361_c1
559 nmdc:mga0qj67_37997_c1
560 nmdc:mga0qj67_522951_c1
561 nmdc:mga06r32_424_c1
562 nmdc:mga06r32_7232_c1
563 nmdc:mga08y16_157577_c1
564 nmdc:mga0a205_97547_c1
565 nmdc:mga0sz30_2_c1
566 Ga0495601_0074997
567 Ga0500620_006904
568 Ga0501084_0092926
569 Ga0501084_0093310
570 Ga0501082_0215295
571 Ga0530510_0003798
572 2643891046
573 2643960102
574 2644101141
575 2644118022
576 2738705263
577 2739334827
578 2775654801
579 2808827969
580 2808892219
581 2812320265
582 2812330195
583 2816509103
584 2839990250
585 2844849841
586 2857741052
587 2904500286
588 2910813126
589 2919036456
590 2919059531
591 2919392892
592 2919540915
593 2932398493
594 2932427050
595 2933419680
596 2939649921
597 2939677370
598 2945918012
599 2945942085
600 2946061852
601 2953999344
602 2956941108
603 2974306051
604 3001120798

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03358

FMN_red

NADPH-dependent FMN reductase

11

167

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mji-assembly1.cif.gz_A crystal structure of rosb with bound intermediate ohc-rp (8-demethyl-8-formylriboflavin-5'-phosphate) 0.8291 13 240
5lji-assembly2.cif.gz_C streptococcus pneumonia tigr4 flavodoxin: structural and biophysical characterization of a novel drug target 0.7935 13 206
5mji-assembly1.cif.gz_A crystal structure of rosb with bound intermediate ohc-rp (8-demethyl-8-formylriboflavin-5'-phosphate) 0.7866 13 240
5lji-assembly2.cif.gz_C streptococcus pneumonia tigr4 flavodoxin: structural and biophysical characterization of a novel drug target 0.7788 13 206
3fvw-assembly1.cif.gz_A crystal structure of the q8dwd8_strmu protein from streptococcus mutans. northeast structural genomics consortium target smr99. 0.7619 14 208
ID Description Score Start End Superfamily
af_I6Y946_20_176_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9663 16 171 3.40.50.360
af_I6Y946_20_176_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.9543 16 171 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7965 15 211 3.40.50.360
af_Q2G135_1_177_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7811 15 211 3.40.50.360
5ljiC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7651 13 206 3.40.50.360
ID Description Score Start End GO Terms
AF-A0A327TLY4-F1-model_v4 NADPH-dependent FMN reductase 0.972 10 95
AF-A0A838JS90-F1-model_v4 NAD(P)H-dependent oxidoreductase 0.9662 10 109 GO:0016491
AF-A0A6C1NKH4-F1-model_v4 NADPH-dependent FMN reductase-like domain-containing protein 0.9605 13 113 GO:0016491
AF-A0A3D2LIX7-F1-model_v4 deleted 0.9587 13 140
AF-A0A2N6DIA4-F1-model_v4 Flavodoxin 0.9581 13 218 GO:0016491

Map