F396362

General Info

Members Datasets Scaffolds Average Seq Length
302 159 302 261

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100264671|Ga0070706_1002646712
Length 299
Sequence MAANQKRRQGAALQGIVSFGHLFEMRHNLRNLTTPFLVAALLFAAAASEHPGRAKQDGDSLLVPGEKHLRNLKQLSFAGENAEAYFSSDGKQLIFQSTRDRRQCDQIYTMNVDGSNVKLVSNGDGRTTCSYFFPNGRRILYSSTHLGGKECPPRPDFSKGYVWAVYPTFDIFTALPDGSDLKQLTNTVGYDAETTITRDGKHLVFTSMRDGDYHPQTEKEKSDYSDLLKQNLIRPTTLEIWVMNADGSNKRQVTHNGKANFGPYFFPDGRRIVFASNMDDPRGRAKPGDTNVFIADWVD

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
130 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
141 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
142 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
143 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
144 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
145 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
146 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
147 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
148 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
149 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
150 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.66
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10000010 3300002459 Bacteria 124816
2 rootL2_10047739 3300003322 Bacteria 1302
3 Ga0065714_10064605 3300005288 Bacteria 29427
4 Ga0065704_10005525 3300005289 Bacteria 4656
5 Ga0065704_10010901 3300005289 Unclassified 2151
6 Ga0065712_10002532 3300005290 Bacteria 6475
7 Ga0065712_10067817 3300005290 Bacteria 29447
8 Ga0065712_10106460 3300005290 Bacteria 1916
9 Ga0065715_10091139 3300005293 Bacteria 6073
10 Ga0065715_10183344 3300005293 Bacteria 1461
11 Ga0065715_10211925 3300005293 Unclassified 1310
12 Ga0065707_10094651 3300005295 Bacteria 3470
13 Ga0065707_10098569 3300005295 Bacteria 3075
14 Ga0070676_10034151 3300005328 Bacteria 2920
15 Ga0070690_100029550 3300005330 Bacteria 3400
16 Ga0070690_100274338 3300005330 Unclassified 1201
17 Ga0070670_100000380 3300005331 Bacteria 36942
18 Ga0070670_100081610 3300005331 Bacteria 2778
19 Ga0068869_100054682 3300005334 Bacteria 2907
20 Ga0068869_100061573 3300005334 Bacteria 2753
21 Ga0068869_100129096 3300005334 Bacteria 1941
22 Ga0068869_100165289 3300005334 Unclassified 1725
23 Ga0068869_100354475 3300005334 Bacteria 1197
24 Ga0070666_10096493 3300005335 Bacteria 2035
25 Ga0070680_100004028 3300005336 Bacteria 10996
26 Ga0070680_100062324 3300005336 Unclassified 3054
27 Ga0070680_100068866 3300005336 Bacteria 2905
28 Ga0070682_100006658 3300005337 Bacteria 6478
29 Ga0068868_100057771 3300005338 Bacteria 3066
30 Ga0070660_100077117 3300005339 Bacteria 2611
31 Ga0070689_100113120 3300005340 Bacteria 2161
32 Ga0070689_100199692 3300005340 Bacteria 1632
33 Ga0070669_100319205 3300005353 Bacteria 1254
34 Ga0070671_100000822 3300005355 Bacteria 22486
35 Ga0070671_100109601 3300005355 Bacteria 2319
36 Ga0070674_100085548 3300005356 Bacteria 2263
37 Ga0070673_100074804 3300005364 Bacteria 2730
38 Ga0070659_100043495 3300005366 Bacteria 3512
39 Ga0070701_10055812 3300005438 Bacteria 2064
40 Ga0070701_10142359 3300005438 Unclassified 1373
41 Ga0070700_100020737 3300005441 Bacteria 3813
42 Ga0070694_100197096 3300005444 Unclassified 1499
43 Ga0070708_100003169 3300005445 Bacteria 12826
44 Ga0070678_100106093 3300005456 Bacteria 2188
45 Ga0070678_100118137 3300005456 Bacteria 2086
46 Ga0070681_10000523 3300005458 Bacteria 31450
47 Ga0070681_10001765 3300005458 Bacteria 19390
48 Ga0070681_10022640 3300005458 Bacteria 6311
49 Ga0068867_100024527 3300005459 Bacteria 4322
50 Ga0068867_100091167 3300005459 Bacteria 2313
51 Ga0068867_100196601 3300005459 Unclassified 1612
52 Ga0070685_10016990 3300005466 Bacteria 3887
53 Ga0070706_100000138 3300005467 Bacteria 91724
54 Ga0070706_100016810 3300005467 Bacteria 6759
55 Ga0070706_100264671 3300005467 Bacteria 1605
56 Ga0070707_100084212 3300005468 Unclassified 3072
57 Ga0070698_100008698 3300005471 Bacteria 10936
58 Ga0070698_100133050 3300005471 Bacteria 2441
59 Ga0070698_100150534 3300005471 Unclassified 2274
60 Ga0070699_100023454 3300005518 Bacteria 5315
61 Ga0070699_100036747 3300005518 Bacteria 4237
62 Ga0070699_100170271 3300005518 Unclassified 1930
63 Ga0070699_100284889 3300005518 Unclassified 1480
64 Ga0070679_100001109 3300005530 Bacteria 23549
65 Ga0070679_100009165 3300005530 Bacteria 9344
66 Ga0068853_100034814 3300005539 Bacteria 4276
67 Ga0068853_100037988 3300005539 Bacteria 4100
68 Ga0068853_100204763 3300005539 Bacteria 1797
69 Ga0070695_100163622 3300005545 Bacteria 1564
70 Ga0070696_100019299 3300005546 Bacteria 4616
71 Ga0070696_100044746 3300005546 Bacteria 3065
72 Ga0070696_100048614 3300005546 Bacteria 2944
73 Ga0070693_100004027 3300005547 Bacteria 6912
74 Ga0070693_100054096 3300005547 Bacteria 2307
75 Ga0070693_100072307 3300005547 Bacteria 2034
76 Ga0070693_100178066 3300005547 Bacteria 1367
77 Ga0070665_100228060 3300005548 Bacteria 1862
78 Ga0070704_100047909 3300005549 Bacteria 2989
79 Ga0068855_100337640 3300005563 Bacteria 1662
80 Ga0070664_100001715 3300005564 Bacteria 17549
81 Ga0070664_100257332 3300005564 Bacteria 1570
82 Ga0068857_100013452 3300005577 Bacteria 7128
83 Ga0068856_100022591 3300005614 Bacteria 6115
84 Ga0068852_100084959 3300005616 Bacteria 2818
85 Ga0068852_100112464 3300005616 Bacteria 2478
86 Ga0068859_100011486 3300005617 Bacteria 8903
87 Ga0068859_100020147 3300005617 Bacteria 6696
88 Ga0068859_100029729 3300005617 Bacteria 5482
89 Ga0068859_100042975 3300005617 Bacteria 4541
90 Ga0068859_100077876 3300005617 Bacteria 3356
91 Ga0068859_100150606 3300005617 Bacteria 2402
92 Ga0068859_100171669 3300005617 Bacteria 2249
93 Ga0068859_100243981 3300005617 Bacteria 1886
94 Ga0068859_100304668 3300005617 Unclassified 1687
95 Ga0068864_100016132 3300005618 Bacteria 6216
96 Ga0068864_100021949 3300005618 Bacteria 5351
97 Ga0068864_100044378 3300005618 Unclassified 3810
98 Ga0068864_100121478 3300005618 Unclassified 2336
99 Ga0068866_10016712 3300005718 Bacteria 3286
100 Ga0068866_10114844 3300005718 Bacteria 1508
101 Ga0068870_10047565 3300005840 Bacteria 2255
102 Ga0068858_100043649 3300005842 Bacteria 4158
103 Ga0068858_100102456 3300005842 Bacteria 2670
104 Ga0068858_100131609 3300005842 Bacteria 2346
105 Ga0068858_100216366 3300005842 Bacteria 1814
106 Ga0068860_100031983 3300005843 Bacteria 5058
107 Ga0068860_100048156 3300005843 Bacteria 4063
108 Ga0068860_100051120 3300005843 Bacteria 3933
109 Ga0068860_100074102 3300005843 Bacteria 3236
110 Ga0068860_100088822 3300005843 Bacteria 2942
111 Ga0068862_100032812 3300005844 Unclassified 4386
112 Ga0068862_100133247 3300005844 Bacteria 2200
113 Ga0068862_100232058 3300005844 Bacteria 1675
114 Ga0068862_100449107 3300005844 Bacteria 1215
115 Ga0081539_10000279 3300005985 Bacteria 115766
116 Ga0081539_10057580 3300005985 Bacteria 2149
117 Ga0097621_100001987 3300006237 Bacteria 13937
118 Ga0068871_100063202 3300006358 Bacteria 3027
119 Ga0075428_100010817 3300006844 Bacteria 10142
120 Ga0075431_100192619 3300006847 Unclassified 2089
121 Ga0075433_10038684 3300006852 Bacteria 4121
122 Ga0075433_10130509 3300006852 Bacteria 2232
123 Ga0075434_100103051 3300006871 Bacteria 2861
124 Ga0075434_100245404 3300006871 Unclassified 1811
125 Ga0068865_100017990 3300006881 Bacteria 4554
126 Ga0075436_100000007 3300006914 Bacteria 288785
127 Ga0097620_100011487 3300006931 Bacteria 8903
128 Ga0097620_100020148 3300006931 Bacteria 6696
129 Ga0097620_100029724 3300006931 Bacteria 5482
130 Ga0097620_100042975 3300006931 Bacteria 4541
131 Ga0097620_100077881 3300006931 Bacteria 3356
132 Ga0097620_100150613 3300006931 Bacteria 2402
133 Ga0097620_100171670 3300006931 Bacteria 2249
134 Ga0097620_100243984 3300006931 Bacteria 1886
135 Ga0097620_100304632 3300006931 Unclassified 1687
136 Ga0075435_100000578 3300007076 Bacteria 22437
137 Ga0075435_100197345 3300007076 Bacteria 1704
138 Ga0105240_10091078 3300009093 Unclassified 3726
139 Ga0111539_10006864 3300009094 Bacteria 14627
140 Ga0111539_10125305 3300009094 Bacteria 3010
141 Ga0111539_10216007 3300009094 Bacteria 2234
142 Ga0111539_10605158 3300009094 Bacteria 1276
143 Ga0105245_10099496 3300009098 Unclassified 2688
144 Ga0114129_10011843 3300009147 Bacteria 12405
145 Ga0114129_10547010 3300009147 Bacteria 1506
146 Ga0105241_10085417 3300009174 Bacteria 2480
147 Ga0105241_10314080 3300009174 Bacteria 1349
148 Ga0105242_10060633 3300009176 Unclassified 3109
149 Ga0105248_10036086 3300009177 Bacteria 5530
150 Ga0105248_10076353 3300009177 Bacteria 3766
151 Ga0105248_10218163 3300009177 Bacteria 2148
152 Ga0105237_10065494 3300009545 Bacteria 3630
153 Ga0105237_10093964 3300009545 Bacteria 2988
154 Ga0105238_10153011 3300009551 Bacteria 2282
155 Ga0157373_10026553 3300013100 Bacteria 4181
156 Ga0157378_10010432 3300013297 Bacteria 8113
157 Ga0163162_10004174 3300013306 Bacteria 13880
158 Ga0163162_10019762 3300013306 Bacteria 6614
159 Ga0163162_10112897 3300013306 Bacteria 2816
160 Ga0157372_10006818 3300013307 Bacteria 12146
161 Ga0157372_10024822 3300013307 Bacteria 6515
162 Ga0157375_10025425 3300013308 Bacteria 5501
163 Ga0157375_10070012 3300013308 Bacteria 3516
164 Ga0157375_10110439 3300013308 Bacteria 2847
165 Ga0163163_10005683 3300014325 Bacteria 10812
166 Ga0163163_10030744 3300014325 Bacteria 5177
167 Ga0163163_10043665 3300014325 Bacteria 4395
168 Ga0163163_10044443 3300014325 Unclassified 4358
169 Ga0163163_10172950 3300014325 Bacteria 2206
170 Ga0157380_10033291 3300014326 Bacteria 3969
171 Ga0157380_10070139 3300014326 Bacteria 2831
172 Ga0157380_10103587 3300014326 Bacteria 2375
173 Ga0157380_10205247 3300014326 Bacteria 1752
174 Ga0157377_10035675 3300014745 Unclassified 2730
175 Ga0157379_10276636 3300014968 Bacteria 1527
176 Ga0157376_10077896 3300014969 Bacteria 2837
177 Ga0163161_10044122 3300017792 Bacteria 3211
178 Ga0163161_10287853 3300017792 Bacteria 1291
179 Ga0207710_10000360 3300025900 Bacteria 32103
180 Ga0207680_10143597 3300025903 Bacteria 1585
181 Ga0207647_10025645 3300025904 Bacteria 3869
182 Ga0207647_10083340 3300025904 Bacteria 1915
183 Ga0207643_10008153 3300025908 Bacteria 5620
184 Ga0207684_10000023 3300025910 Bacteria 334838
185 Ga0207684_10042741 3300025910 Bacteria 3843
186 Ga0207684_10074828 3300025910 Unclassified 2877
187 Ga0207684_10095810 3300025910 Bacteria 2533
188 Ga0207654_10019532 3300025911 Bacteria 3578
189 Ga0207654_10040221 3300025911 Bacteria 2633
190 Ga0207707_10000006 3300025912 Bacteria 374131
191 Ga0207707_10009795 3300025912 Bacteria 8311
192 Ga0207707_10010819 3300025912 Bacteria 7929
193 Ga0207695_10067169 3300025913 Unclassified 3679
194 Ga0207660_10000971 3300025917 Bacteria 18966
195 Ga0207662_10013770 3300025918 Bacteria 4526
196 Ga0207657_10075018 3300025919 Bacteria 2855
197 Ga0207652_10000216 3300025921 Bacteria 61049
198 Ga0207652_10016140 3300025921 Bacteria 6091
199 Ga0207694_10005775 3300025924 Bacteria 9482
200 Ga0207650_10000001 3300025925 Bacteria 1545726
201 Ga0207644_10022097 3300025931 Bacteria 4343
202 Ga0207690_10055498 3300025932 Bacteria 2668
203 Ga0207706_10060738 3300025933 Bacteria 3329
204 Ga0207706_10405922 3300025933 Bacteria 1181
205 Ga0207669_10215678 3300025937 Bacteria 1404
206 Ga0207704_10035226 3300025938 Bacteria 2866
207 Ga0207691_10283661 3300025940 Bacteria 1425
208 Ga0207711_10109148 3300025941 Bacteria 2459
209 Ga0207711_10130267 3300025941 Bacteria 2254
210 Ga0207689_10002977 3300025942 Bacteria 15628
211 Ga0207689_10097964 3300025942 Bacteria 2409
212 Ga0207689_10140096 3300025942 Bacteria 1992
213 Ga0207689_10358419 3300025942 Bacteria 1213
214 Ga0207679_10026276 3300025945 Bacteria 4013
215 Ga0207651_10038328 3300025960 Bacteria 3149
216 Ga0207651_10061866 3300025960 Bacteria 2606
217 Ga0207712_10006566 3300025961 Bacteria 7341
218 Ga0207712_10022142 3300025961 Unclassified 4182
219 Ga0207712_10028263 3300025961 Bacteria 3749
220 Ga0207677_10071687 3300026023 Bacteria 2446
221 Ga0207677_10087319 3300026023 Bacteria 2257
222 Ga0207703_10015260 3300026035 Bacteria 5994
223 Ga0207703_10045601 3300026035 Bacteria 3527
224 Ga0207703_10092625 3300026035 Unclassified 2544
225 Ga0207703_10099830 3300026035 Bacteria 2458
226 Ga0207639_10096367 3300026041 Bacteria 2380
227 Ga0207639_10322580 3300026041 Bacteria 1372
228 Ga0207639_10416819 3300026041 Bacteria 1213
229 Ga0207708_10031695 3300026075 Bacteria 4013
230 Ga0207708_10044097 3300026075 Unclassified 3398
231 Ga0207708_10083669 3300026075 Bacteria 2453
232 Ga0207648_10007763 3300026089 Bacteria 10479
233 Ga0207648_10115684 3300026089 Bacteria 2357
234 Ga0207648_10207215 3300026089 Bacteria 1740
235 Ga0207676_10024106 3300026095 Bacteria 4499
236 Ga0207676_10066690 3300026095 Unclassified 2872
237 Ga0207674_10000192 3300026116 Bacteria 75255
238 Ga0207675_100012170 3300026118 Bacteria 8038
239 Ga0207675_100370041 3300026118 Bacteria 1407
240 Ga0207675_100479206 3300026118 Bacteria 1236
241 Ga0207683_10107918 3300026121 Bacteria 2491
242 Ga0268265_10021379 3300028380 Bacteria 4532
243 Ga0268265_10066115 3300028380 Bacteria 2794
244 Ga0268265_10177468 3300028380 Bacteria 1827
245 Ga0268265_10464207 3300028380 Bacteria 1185
246 Ga0268264_10029917 3300028381 Bacteria 4464
247 Ga0268264_10091776 3300028381 Bacteria 2620
248 Ga0268264_10244033 3300028381 Bacteria 1665
249 Ga0307408_100024802 3300031548 Unclassified 4099
250 Ga0307405_10007673 3300031731 Bacteria 5417
251 Ga0307410_10032527 3300031852 Bacteria 3358
252 Ga0307412_10030476 3300031911 Bacteria 3397
253 Ga0307416_100180341 3300032002 Bacteria 1978
254 Ga0307416_100229444 3300032002 Bacteria 1788
255 Ga0307414_10003383 3300032004 Bacteria 8519
256 Ga0307411_10013000 3300032005 Bacteria 4573
257 Ga0307415_100011058 3300032126 Bacteria 5144
258 Ga0373937_0039738 3300036401 Bacteria 4287
259 Ga0373937_0154541 3300036401 Bacteria 2150
260 Ga0242420_003088 3300038996 Unclassified 2440
261 Ga0439448_0006017 3300042005 Bacteria 3476
262 Ga0451576_0018222 3300045051 Bacteria 7700
263 Ga0495600_0084253 3300046809 Unclassified 2075
264 Ga0495680_0026995 3300047322 Bacteria 4725
265 Ga0496104_0058907 3300048907 Bacteria 3636
266 Ga0496106_0026559 3300048909 Bacteria 4312
267 Ga0496108_0259518 3300048911 Unclassified 1512
268 Ga0496112_0115880 3300048915 Bacteria 2650
269 Ga0496113_0071654 3300048916 Bacteria 2636
270 Ga0501292_001124 3300049515 Bacteria 3265
271 Ga0501296_001024 3300049519 Bacteria 2792
272 Ga0501298_001045 3300049521 Bacteria 3971
273 Ga0501298_003778 3300049521 Unclassified 2361
274 Ga0501198_003505 3300049649 Bacteria 2146
275 Ga0501202_003683 3300049652 Unclassified 2640
276 Ga0501202_005068 3300049652 Bacteria 2325
277 Ga0501202_012546 3300049652 Bacteria 1601
278 Ga0501206_011391 3300049653 Viruses 1200
279 Ga0501227_010321 3300049665 Unclassified 2023
280 Ga0501230_001052 3300049667 Bacteria 3167
281 Ga0501240_003449 3300049673 Bacteria 1765
282 Ga0501234_003635 3300049707 Bacteria 2425
283 Ga0501266_005696 3300049763 Bacteria 1548
284 nmdc:mga05p37_20534_c1 3300050507 Bacteria 7991
285 nmdc:mga05p37_503627_c1 3300050507 Bacteria 1389
286 nmdc:mga0qj67_76094_c1 3300050509 Unclassified 2684
287 nmdc:mga06r32_290986_c1 3300050510 Bacteria 1620
288 nmdc:mga08y16_162757_c1 3300050511 Bacteria 2318
289 nmdc:mga08y16_292148_c1 3300050511 Bacteria 1680
290 nmdc:mga08y16_361672_c1 3300050511 Bacteria 1490
291 nmdc:mga08y16_462743_c1 3300050511 Bacteria 1292
292 nmdc:mga0n895_153425_c1 3300050512 Unclassified 2334
293 nmdc:mga0n895_331614_c1 3300050512 Bacteria 1541
294 nmdc:mga0n895_55020_c1 3300050512 Bacteria 3915
295 nmdc:mga0rr50_437_c1 3300050513 Bacteria 22424
296 nmdc:mga0rr50_85345_c1 3300050513 Bacteria 2447
297 nmdc:mga08x19_70_c1 3300050514 Bacteria 98848
298 nmdc:mga0a205_16862_c1 3300050515 Bacteria 6837
299 nmdc:mga0a205_18763_c1 3300050515 Bacteria 5888
300 nmdc:mga0a205_76610_c1 3300050515 Unclassified 3232
301 nmdc:mga0a205_8373_c1 3300050515 Bacteria 9409
302 Ga0495619_0051141 3300053085 Bacteria 2730

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_361672_c1 nmdc:mga08y16_361672_c1_527_1471 206
2 3300006358 Ga0068871_100063202 Ga0068871_1000632023 209
3 3300005355 Ga0070671_100000822 Ga0070671_1000008228 218
4 3300050515 nmdc:mga0a205_18763_c1 nmdc:mga0a205_18763_c1_1297_2265 223
5 3300006847 Ga0075431_100192619 Ga0075431_1001926192 226
6 3300009094 Ga0111539_10605158 Ga0111539_106051581 226
7 3300005844 Ga0068862_100133247 Ga0068862_1001332472 227
8 3300028380 Ga0268265_10177468 Ga0268265_101774682 227
9 3300005328 Ga0070676_10034151 Ga0070676_100341512 228
10 3300005459 Ga0068867_100091167 Ga0068867_1000911672 228
11 3300005549 Ga0070704_100047909 Ga0070704_1000479094 228
12 3300026089 Ga0207648_10115684 Ga0207648_101156842 228
13 3300005290 Ga0065712_10106460 Ga0065712_101064602 229
14 3300005338 Ga0068868_100057771 Ga0068868_1000577714 229
15 3300005456 Ga0070678_100106093 Ga0070678_1001060932 229
16 3300005564 Ga0070664_100257332 Ga0070664_1002573322 229
17 3300005616 Ga0068852_100084959 Ga0068852_1000849592 229
18 3300005718 Ga0068866_10114844 Ga0068866_101148442 229
19 3300014968 Ga0157379_10276636 Ga0157379_102766361 229
20 3300017792 Ga0163161_10287853 Ga0163161_102878531 229
21 3300025903 Ga0207680_10143597 Ga0207680_101435972 229
22 3300026023 Ga0207677_10071687 Ga0207677_100716872 229
23 3300005617 Ga0068859_100150606 Ga0068859_1001506062 230
24 3300006931 Ga0097620_100150613 Ga0097620_1001506132 230
25 3300013308 Ga0157375_10110439 Ga0157375_101104393 230
26 3300026118 Ga0207675_100012170 Ga0207675_1000121702 230
27 3300028380 Ga0268265_10066115 Ga0268265_100661152 230
28 3300045051 Ga0451576_0018222 Ga0451576_0018222_3530_4555 231
29 3300006844 Ga0075428_100010817 Ga0075428_1000108179 232
30 3300009177 Ga0105248_10036086 Ga0105248_100360864 232
31 3300046809 Ga0495600_0084253 Ga0495600_0084253_752_1804 232
32 3300025911 Ga0207654_10019532 Ga0207654_100195322 233
33 3300049515 Ga0501292_001124 Ga0501292_001124_1506_2507 233
34 3300049519 Ga0501296_001024 Ga0501296_001024_551_1552 233
35 3300049521 Ga0501298_003778 Ga0501298_003778_648_1649 233
36 3300049652 Ga0501202_003683 Ga0501202_003683_856_1857 233
37 3300049763 Ga0501266_005696 Ga0501266_005696_526_1527 233
38 3300005330 Ga0070690_100274338 Ga0070690_1002743381 234
39 3300005617 Ga0068859_100171669 Ga0068859_1001716692 234
40 3300006931 Ga0097620_100171670 Ga0097620_1001716702 234
41 3300009094 Ga0111539_10125305 Ga0111539_101253052 234
42 3300005467 Ga0070706_100016810 Ga0070706_1000168108 235
43 3300005614 Ga0068856_100022591 Ga0068856_1000225913 235
44 3300005985 Ga0081539_10057580 Ga0081539_100575802 235
45 3300013308 Ga0157375_10025425 Ga0157375_100254254 235
46 3300025910 Ga0207684_10042741 Ga0207684_100427416 235
47 3300005548 Ga0070665_100228060 Ga0070665_1002280602 236
48 3300005617 Ga0068859_100020147 Ga0068859_1000201472 236
49 3300005618 Ga0068864_100021949 Ga0068864_1000219492 236
50 3300005843 Ga0068860_100088822 Ga0068860_1000888223 236
51 3300006931 Ga0097620_100020148 Ga0097620_1000201485 236
52 3300009094 Ga0111539_10006864 Ga0111539_1000686414 236
53 3300026095 Ga0207676_10024106 Ga0207676_100241062 236
54 3300032002 Ga0307416_100180341 Ga0307416_1001803412 236
55 3300049521 Ga0501298_001045 Ga0501298_001045_1809_2822 236
56 3300049652 Ga0501202_012546 Ga0501202_012546_448_1461 236
57 3300049653 Ga0501206_011391 Ga0501206_011391_41_1054 236
58 3300049707 Ga0501234_003635 Ga0501234_003635_1041_2054 236
59 3300050511 nmdc:mga08y16_162757_c1 nmdc:mga08y16_162757_c1_1183_2232 236
60 3300005334 Ga0068869_100129096 Ga0068869_1001290961 237
61 3300005547 Ga0070693_100004027 Ga0070693_1000040273 237
62 3300014326 Ga0157380_10205247 Ga0157380_102052472 237
63 3300036401 Ga0373937_0154541 Ga0373937_0154541_19_1047 237
64 3300005288 Ga0065714_10064605 Ga0065714_1006460510 238
65 3300005290 Ga0065712_10067817 Ga0065712_1006781710 238
66 3300005293 Ga0065715_10091139 Ga0065715_100911395 238
67 3300005546 Ga0070696_100048614 Ga0070696_1000486142 238
68 3300006914 Ga0075436_100000007 Ga0075436_100000007248 238
69 3300007076 Ga0075435_100000578 Ga0075435_10000057815 238
70 3300013308 Ga0157375_10070012 Ga0157375_100700122 238
71 3300050513 nmdc:mga0rr50_437_c1 nmdc:mga0rr50_437_c1_13295_14362 238
72 3300050514 nmdc:mga08x19_70_c1 nmdc:mga08x19_70_c1_71231_72298 238
73 3300005334 Ga0068869_100354475 Ga0068869_1003544751 239
74 3300005546 Ga0070696_100044746 Ga0070696_1000447462 239
75 3300025942 Ga0207689_10358419 Ga0207689_103584191 239
76 3300050510 nmdc:mga06r32_290986_c1 nmdc:mga06r32_290986_c1_391_1407 239
77 3300005334 Ga0068869_100054682 Ga0068869_1000546822 240
78 3300005445 Ga0070708_100003169 Ga0070708_10000316911 240
79 3300005467 Ga0070706_100000138 Ga0070706_10000013836 240
80 3300005617 Ga0068859_100042975 Ga0068859_1000429754 240
81 3300005842 Ga0068858_100131609 Ga0068858_1001316093 240
82 3300005843 Ga0068860_100031983 Ga0068860_1000319832 240
83 3300006931 Ga0097620_100042975 Ga0097620_1000429754 240
84 3300007076 Ga0075435_100197345 Ga0075435_1001973452 240
85 3300009094 Ga0111539_10216007 Ga0111539_102160072 240
86 3300009147 Ga0114129_10011843 Ga0114129_100118437 240
87 3300025910 Ga0207684_10000023 Ga0207684_1000002342 240
88 3300025910 Ga0207684_10074828 Ga0207684_100748281 240
89 3300025942 Ga0207689_10097964 Ga0207689_100979642 240
90 3300025942 Ga0207689_10140096 Ga0207689_101400963 240
91 3300026035 Ga0207703_10099830 Ga0207703_100998303 240
92 3300026118 Ga0207675_100479206 Ga0207675_1004792062 240
93 3300036401 Ga0373937_0039738 Ga0373937_0039738_1793_2824 240
94 3300047322 Ga0495680_0026995 Ga0495680_0026995_1931_2962 240
95 3300050507 nmdc:mga05p37_20534_c1 nmdc:mga05p37_20534_c1_4530_5600 240
96 3300050511 nmdc:mga08y16_292148_c1 nmdc:mga08y16_292148_c1_140_1183 240
97 3300050511 nmdc:mga08y16_462743_c1 nmdc:mga08y16_462743_c1_85_1182 240
98 3300050513 nmdc:mga0rr50_85345_c1 nmdc:mga0rr50_85345_c1_948_1991 240
99 3300053085 Ga0495619_0051141 Ga0495619_0051141_1669_2700 240
100 3300013306 Ga0163162_10019762 Ga0163162_100197623 241
101 3300005844 Ga0068862_100449107 Ga0068862_1004491071 242
102 3300014326 Ga0157380_10103587 Ga0157380_101035872 242
103 3300025911 Ga0207654_10040221 Ga0207654_100402212 242
104 3300048909 Ga0496106_0026559 Ga0496106_0026559_3208_4242 242
105 3300005290 Ga0065712_10002532 Ga0065712_100025322 243
106 3300005356 Ga0070674_100085548 Ga0070674_1000855482 243
107 3300048911 Ga0496108_0259518 Ga0496108_0259518_427_1458 243
108 3300005330 Ga0070690_100029550 Ga0070690_1000295502 244
109 3300005334 Ga0068869_100061573 Ga0068869_1000615732 244
110 3300005335 Ga0070666_10096493 Ga0070666_100964932 244
111 3300005336 Ga0070680_100004028 Ga0070680_1000040284 244
112 3300005336 Ga0070680_100068866 Ga0070680_1000688662 244
113 3300005355 Ga0070671_100109601 Ga0070671_1001096012 244
114 3300005364 Ga0070673_100074804 Ga0070673_1000748042 244
115 3300005456 Ga0070678_100118137 Ga0070678_1001181372 244
116 3300005458 Ga0070681_10000523 Ga0070681_1000052311 244
117 3300005459 Ga0068867_100024527 Ga0068867_1000245272 244
118 3300005466 Ga0070685_10016990 Ga0070685_100169901 244
119 3300005530 Ga0070679_100001109 Ga0070679_10000110920 244
120 3300005547 Ga0070693_100072307 Ga0070693_1000723071 244
121 3300005616 Ga0068852_100112464 Ga0068852_1001124643 244
122 3300005618 Ga0068864_100121478 Ga0068864_1001214782 244
123 3300005718 Ga0068866_10016712 Ga0068866_100167122 244
124 3300005842 Ga0068858_100102456 Ga0068858_1001024562 244
125 3300005843 Ga0068860_100048156 Ga0068860_1000481564 244
126 3300005843 Ga0068860_100074102 Ga0068860_1000741022 244
127 3300006852 Ga0075433_10130509 Ga0075433_101305092 244
128 3300006871 Ga0075434_100103051 Ga0075434_1001030511 244
129 3300006881 Ga0068865_100017990 Ga0068865_1000179903 244
130 3300009098 Ga0105245_10099496 Ga0105245_100994962 244
131 3300009176 Ga0105242_10060633 Ga0105242_100606331 244
132 3300009177 Ga0105248_10218163 Ga0105248_102181632 244
133 3300013297 Ga0157378_10010432 Ga0157378_100104322 244
134 3300013306 Ga0163162_10112897 Ga0163162_101128973 244
135 3300013307 Ga0157372_10024822 Ga0157372_100248224 244
136 3300014325 Ga0163163_10044443 Ga0163163_100444434 244
137 3300014326 Ga0157380_10033291 Ga0157380_100332913 244
138 3300014969 Ga0157376_10077896 Ga0157376_100778961 244
139 3300017792 Ga0163161_10044122 Ga0163161_100441222 244
140 3300025904 Ga0207647_10025645 Ga0207647_100256453 244
141 3300025912 Ga0207707_10000006 Ga0207707_10000006158 244
142 3300025917 Ga0207660_10000971 Ga0207660_1000097116 244
143 3300025921 Ga0207652_10000216 Ga0207652_1000021620 244
144 3300025931 Ga0207644_10022097 Ga0207644_100220972 244
145 3300025933 Ga0207706_10405922 Ga0207706_104059221 244
146 3300025937 Ga0207669_10215678 Ga0207669_102156782 244
147 3300025938 Ga0207704_10035226 Ga0207704_100352263 244
148 3300025940 Ga0207691_10283661 Ga0207691_102836612 244
149 3300025941 Ga0207711_10130267 Ga0207711_101302672 244
150 3300025942 Ga0207689_10002977 Ga0207689_1000297714 244
151 3300025960 Ga0207651_10061866 Ga0207651_100618662 244
152 3300025961 Ga0207712_10028263 Ga0207712_100282632 244
153 3300026023 Ga0207677_10087319 Ga0207677_100873192 244
154 3300026041 Ga0207639_10322580 Ga0207639_103225802 244
155 3300026089 Ga0207648_10007763 Ga0207648_100077631 244
156 3300026095 Ga0207676_10066690 Ga0207676_100666902 244
157 3300026121 Ga0207683_10107918 Ga0207683_101079182 244
158 3300028381 Ga0268264_10029917 Ga0268264_100299172 244
159 3300028381 Ga0268264_10244033 Ga0268264_102440331 244
160 3300038996 Ga0242420_003088 Ga0242420_003088_870_1925 244
161 3300050512 nmdc:mga0n895_153425_c1 nmdc:mga0n895_153425_c1_716_1771 244
162 3300050515 nmdc:mga0a205_16862_c1 nmdc:mga0a205_16862_c1_2621_3676 244
163 3300005293 Ga0065715_10211925 Ga0065715_102119252 245
164 3300005340 Ga0070689_100113120 Ga0070689_1001131202 245
165 3300005353 Ga0070669_100319205 Ga0070669_1003192051 245
166 3300005438 Ga0070701_10055812 Ga0070701_100558122 245
167 3300005438 Ga0070701_10142359 Ga0070701_101423592 245
168 3300005441 Ga0070700_100020737 Ga0070700_1000207372 245
169 3300005459 Ga0068867_100196601 Ga0068867_1001966012 245
170 3300005539 Ga0068853_100204763 Ga0068853_1002047632 245
171 3300005547 Ga0070693_100178066 Ga0070693_1001780661 245
172 3300005617 Ga0068859_100011486 Ga0068859_1000114867 245
173 3300005617 Ga0068859_100029729 Ga0068859_1000297294 245
174 3300005618 Ga0068864_100044378 Ga0068864_1000443783 245
175 3300005842 Ga0068858_100216366 Ga0068858_1002163662 245
176 3300005844 Ga0068862_100032812 Ga0068862_1000328124 245
177 3300005985 Ga0081539_10000279 Ga0081539_1000027979 245
178 3300006852 Ga0075433_10038684 Ga0075433_100386842 245
179 3300006931 Ga0097620_100011487 Ga0097620_1000114872 245
180 3300006931 Ga0097620_100029724 Ga0097620_1000297244 245
181 3300009174 Ga0105241_10085417 Ga0105241_100854172 245
182 3300014326 Ga0157380_10070139 Ga0157380_100701393 245
183 3300014745 Ga0157377_10035675 Ga0157377_100356752 245
184 3300025900 Ga0207710_10000360 Ga0207710_1000036025 245
185 3300025918 Ga0207662_10013770 Ga0207662_100137704 245
186 3300025960 Ga0207651_10038328 Ga0207651_100383282 245
187 3300025961 Ga0207712_10022142 Ga0207712_100221423 245
188 3300026035 Ga0207703_10045601 Ga0207703_100456012 245
189 3300026075 Ga0207708_10031695 Ga0207708_100316954 245
190 3300026075 Ga0207708_10044097 Ga0207708_100440971 245
191 3300026089 Ga0207648_10207215 Ga0207648_102072152 245
192 3300028380 Ga0268265_10021379 Ga0268265_100213791 245
193 3300028380 Ga0268265_10464207 Ga0268265_104642071 245
194 3300005289 Ga0065704_10005525 Ga0065704_100055252 246
195 3300005289 Ga0065704_10010901 Ga0065704_100109012 246
196 3300005295 Ga0065707_10098569 Ga0065707_100985693 246
197 3300005331 Ga0070670_100081610 Ga0070670_1000816102 246
198 3300005336 Ga0070680_100062324 Ga0070680_1000623242 246
199 3300005340 Ga0070689_100199692 Ga0070689_1001996922 246
200 3300005468 Ga0070707_100084212 Ga0070707_1000842122 246
201 3300005471 Ga0070698_100150534 Ga0070698_1001505342 246
202 3300005518 Ga0070699_100023454 Ga0070699_1000234541 246
203 3300005518 Ga0070699_100036747 Ga0070699_1000367472 246
204 3300005518 Ga0070699_100170271 Ga0070699_1001702713 246
205 3300005844 Ga0068862_100232058 Ga0068862_1002320582 246
206 3300006871 Ga0075434_100245404 Ga0075434_1002454042 246
207 3300009147 Ga0114129_10547010 Ga0114129_105470102 246
208 3300009174 Ga0105241_10314080 Ga0105241_103140801 246
209 3300009545 Ga0105237_10065494 Ga0105237_100654943 246
210 3300025904 Ga0207647_10083340 Ga0207647_100833402 246
211 3300026118 Ga0207675_100370041 Ga0207675_1003700412 246
212 3300031548 Ga0307408_100024802 Ga0307408_1000248023 246
213 3300031731 Ga0307405_10007673 Ga0307405_100076732 246
214 3300031852 Ga0307410_10032527 Ga0307410_100325273 246
215 3300031911 Ga0307412_10030476 Ga0307412_100304762 246
216 3300032002 Ga0307416_100229444 Ga0307416_1002294442 246
217 3300032004 Ga0307414_10003383 Ga0307414_100033835 246
218 3300032005 Ga0307411_10013000 Ga0307411_100130004 246
219 3300032126 Ga0307415_100011058 Ga0307415_1000110582 246
220 3300042005 Ga0439448_0006017 Ga0439448_0006017_443_1489 246
221 3300048907 Ga0496104_0058907 Ga0496104_0058907_1831_2883 246
222 3300048915 Ga0496112_0115880 Ga0496112_0115880_496_1545 246
223 3300048916 Ga0496113_0071654 Ga0496113_0071654_131_1183 246
224 3300049649 Ga0501198_003505 Ga0501198_003505_317_1411 246
225 3300049652 Ga0501202_005068 Ga0501202_005068_1132_2178 246
226 3300049665 Ga0501227_010321 Ga0501227_010321_89_1135 246
227 3300049667 Ga0501230_001052 Ga0501230_001052_1443_2489 246
228 3300049673 Ga0501240_003449 Ga0501240_003449_566_1612 246
229 3300050507 nmdc:mga05p37_503627_c1 nmdc:mga05p37_503627_c1_136_1182 246
230 3300050509 nmdc:mga0qj67_76094_c1 nmdc:mga0qj67_76094_c1_60_1097 246
231 3300050515 nmdc:mga0a205_76610_c1 nmdc:mga0a205_76610_c1_1632_2687 246
232 3300005840 Ga0068870_10047565 Ga0068870_100475652 247
233 3300014325 Ga0163163_10005683 Ga0163163_100056832 247
234 3300025908 Ga0207643_10008153 Ga0207643_100081534 247
235 3300005617 Ga0068859_100243981 Ga0068859_1002439812 248
236 3300005617 Ga0068859_100304668 Ga0068859_1003046682 248
237 3300006931 Ga0097620_100243984 Ga0097620_1002439842 248
238 3300006931 Ga0097620_100304632 Ga0097620_1003046322 248
239 3300009177 Ga0105248_10076353 Ga0105248_100763532 248
240 3300013306 Ga0163162_10004174 Ga0163162_1000417411 248
241 3300025941 Ga0207711_10109148 Ga0207711_101091481 248
242 3300026035 Ga0207703_10092625 Ga0207703_100926252 248
243 3300005339 Ga0070660_100077117 Ga0070660_1000771172 249
244 3300005366 Ga0070659_100043495 Ga0070659_1000434952 249
245 3300005458 Ga0070681_10001765 Ga0070681_100017657 249
246 3300005458 Ga0070681_10022640 Ga0070681_100226403 249
247 3300005467 Ga0070706_100264671 Ga0070706_1002646712 249
248 3300005471 Ga0070698_100008698 Ga0070698_1000086984 249
249 3300005530 Ga0070679_100009165 Ga0070679_1000091653 249
250 3300005539 Ga0068853_100034814 Ga0068853_1000348142 249
251 3300005539 Ga0068853_100037988 Ga0068853_1000379882 249
252 3300005545 Ga0070695_100163622 Ga0070695_1001636222 249
253 3300005563 Ga0068855_100337640 Ga0068855_1003376402 249
254 3300005564 Ga0070664_100001715 Ga0070664_1000017155 249
255 3300005577 Ga0068857_100013452 Ga0068857_1000134525 249
256 3300005618 Ga0068864_100016132 Ga0068864_1000161324 249
257 3300005842 Ga0068858_100043649 Ga0068858_1000436494 249
258 3300005843 Ga0068860_100051120 Ga0068860_1000511202 249
259 3300006237 Ga0097621_100001987 Ga0097621_1000019874 249
260 3300009093 Ga0105240_10091078 Ga0105240_100910782 249
261 3300009551 Ga0105238_10153011 Ga0105238_101530112 249
262 3300013100 Ga0157373_10026553 Ga0157373_100265532 249
263 3300013307 Ga0157372_10006818 Ga0157372_100068186 249
264 3300014325 Ga0163163_10030744 Ga0163163_100307444 249
265 3300014325 Ga0163163_10043665 Ga0163163_100436654 249
266 3300014325 Ga0163163_10172950 Ga0163163_101729502 249
267 3300025910 Ga0207684_10095810 Ga0207684_100958103 249
268 3300025912 Ga0207707_10009795 Ga0207707_100097956 249
269 3300025912 Ga0207707_10010819 Ga0207707_100108197 249
270 3300025913 Ga0207695_10067169 Ga0207695_100671692 249
271 3300025919 Ga0207657_10075018 Ga0207657_100750182 249
272 3300025921 Ga0207652_10016140 Ga0207652_100161404 249
273 3300025932 Ga0207690_10055498 Ga0207690_100554982 249
274 3300025933 Ga0207706_10060738 Ga0207706_100607381 249
275 3300025945 Ga0207679_10026276 Ga0207679_100262762 249
276 3300026035 Ga0207703_10015260 Ga0207703_100152602 249
277 3300026041 Ga0207639_10096367 Ga0207639_100963672 249
278 3300026041 Ga0207639_10416819 Ga0207639_104168191 249
279 3300026075 Ga0207708_10083669 Ga0207708_100836692 249
280 3300026116 Ga0207674_10000192 Ga0207674_1000019248 249
281 3300028381 Ga0268264_10091776 Ga0268264_100917762 249
282 3300050512 nmdc:mga0n895_331614_c1 nmdc:mga0n895_331614_c1_299_1357 249
283 3300050512 nmdc:mga0n895_55020_c1 nmdc:mga0n895_55020_c1_832_1881 249
284 3300050515 nmdc:mga0a205_8373_c1 nmdc:mga0a205_8373_c1_2387_3436 249
285 3300002459 JGI24751J29686_10000010 JGI24751J29686_10000010105 250
286 3300003322 rootL2_10047739 rootL2_100477392 250
287 3300005293 Ga0065715_10183344 Ga0065715_101833442 250
288 3300005295 Ga0065707_10094651 Ga0065707_100946512 250
289 3300005331 Ga0070670_100000380 Ga0070670_10000038031 250
290 3300005334 Ga0068869_100165289 Ga0068869_1001652892 250
291 3300005337 Ga0070682_100006658 Ga0070682_1000066583 250
292 3300005444 Ga0070694_100197096 Ga0070694_1001970962 250
293 3300005471 Ga0070698_100133050 Ga0070698_1001330501 250
294 3300005518 Ga0070699_100284889 Ga0070699_1002848892 250
295 3300005546 Ga0070696_100019299 Ga0070696_1000192991 250
296 3300005547 Ga0070693_100054096 Ga0070693_1000540962 250
297 3300005617 Ga0068859_100077876 Ga0068859_1000778761 250
298 3300006931 Ga0097620_100077881 Ga0097620_1000778811 250
299 3300009545 Ga0105237_10093964 Ga0105237_100939642 250
300 3300025924 Ga0207694_10005775 Ga0207694_100057757 250
301 3300025925 Ga0207650_10000001 Ga0207650_10000001409 250
302 3300025961 Ga0207712_10006566 Ga0207712_100065664 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07676

PD40

WD40-like Beta Propeller Repeat

181

214

0.96

PF07676

PD40

WD40-like Beta Propeller Repeat

250

293

0.9

PF07676

PD40

WD40-like Beta Propeller Repeat

117

149

0.89

PF07676

PD40

WD40-like Beta Propeller Repeat

74

109

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j2j-assembly3.cif.gz_C crystal structure of axh domain complex with capicua 0.743 46 80
2ivz-assembly4.cif.gz_D structure of tolb in complex with a peptide of the colicin e9 t- domain 0.7196 46 226
4pwz-assembly1.cif.gz_A crystal structure of tolb protein from yersinia pestis co92 0.7136 46 226
1npe-assembly1.cif.gz_A crystal structure of nidogen/laminin complex 0.6786 51 226
2hqs-assembly3.cif.gz_D crystal structure of tolb/pal complex 0.672 46 246
ID Description Score Start End Superfamily
3tdgA01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7469 47 89 3.10.450.520
af_F1QZ06_599_747_2.110.10.10 Mainly Beta;4 Propeller;Hemopexin;Hemopexin-like domain 0.7225 135 226 2.110.10.10
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.6895 46 78 2.40.50.140
af_G5EFK8_321_622_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.6894 48 230 2.120.10.30
af_G5EG67_297_429_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.682 115 250 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A524AUT8-F1-model_v4 DUF2157 domain-containing protein 0.9303 120 232 GO:0016020
AF-A0A2G9TU63-F1-model_v4 WD40-like protein 0.8921 113 226
AF-A0A7V9T1D2-F1-model_v4 PD40 domain-containing protein 0.8808 124 215
AF-A0A3D2S3K6-F1-model_v4 Tol-Pal system beta propeller repeat protein TolB 0.8807 135 245
AF-A0A1I9G905-F1-model_v4 Bm11326 0.8732 110 226

Feature Viewer

pLDDT pTM Quality
74.65 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map