F396361

General Info

Members Datasets Scaffolds Average Seq Length
302 177 302 128

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100161331|Ga0070706_1001613312
Length 144
Sequence MRFASICGTTTLSQPNPIPELESVAVLHRLSRDADDPVFAEPWQAEAFALAVKLSEQGQFAWKEWAVALADELSAAASCGEPDDGSRYYHHLLAALERLVTAKGLADSADLAARKEAWAEAYRRTPHGKPVELSAESNDEQPPS

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
85 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
86 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
93 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
94 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
95 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
96 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
117 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
129 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
138 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
159 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
160 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.32
Rhizosphere 96.03
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_101137461 3300005334 Bacteria 684
2 Ga0070666_10438678 3300005335 Bacteria 942
3 Ga0070691_10000050 3300005341 Bacteria 33001
4 Ga0070692_10396056 3300005345 Unclassified 870
5 Ga0070669_100099855 3300005353 Bacteria 2188
6 Ga0070671_100672543 3300005355 Bacteria 897
7 Ga0070673_100039974 3300005364 Bacteria 3595
8 Ga0070714_100035092 3300005435 Unclassified 4202
9 Ga0070714_100163261 3300005435 Bacteria 2017
10 Ga0070713_100000041 3300005436 Bacteria 80753
11 Ga0070710_10464618 3300005437 Unclassified 860
12 Ga0070710_10993307 3300005437 Unclassified 611
13 Ga0070711_100120695 3300005439 Bacteria 1938
14 Ga0070711_100383454 3300005439 Unclassified 1137
15 Ga0070711_100553357 3300005439 Bacteria 955
16 Ga0070711_100814015 3300005439 Bacteria 793
17 Ga0070708_100030238 3300005445 Bacteria 4681
18 Ga0070708_100313140 3300005445 Unclassified 1478
19 Ga0070706_100161331 3300005467 Bacteria 2093
20 Ga0070706_100197241 3300005467 Bacteria 1880
21 Ga0070707_100062748 3300005468 Bacteria 3565
22 Ga0070707_101113803 3300005468 Bacteria 755
23 Ga0070698_100039564 3300005471 Bacteria 4852
24 Ga0070698_100044751 3300005471 Bacteria 4530
25 Ga0070699_100034133 3300005518 Bacteria 4396
26 Ga0070699_100082204 3300005518 Bacteria 2807
27 Ga0070697_100041851 3300005536 Bacteria 3708
28 Ga0070697_100115565 3300005536 Bacteria 2240
29 Ga0070697_100543010 3300005536 Unclassified 1019
30 Ga0068853_100012494 3300005539 Bacteria 6908
31 Ga0070695_100030021 3300005545 Bacteria 3381
32 Ga0070693_100030534 3300005547 Bacteria 2946
33 Ga0070664_101457823 3300005564 Unclassified 647
34 Ga0068857_100009044 3300005577 Bacteria 8640
35 Ga0068854_100164908 3300005578 Bacteria 1719
36 Ga0068856_100000274 3300005614 Bacteria 56135
37 Ga0068856_100028050 3300005614 Bacteria 5494
38 Ga0068864_100060146 3300005618 Unclassified 3289
39 Ga0068863_100370679 3300005841 Bacteria 1397
40 Ga0068858_101062458 3300005842 Unclassified 794
41 Ga0070717_10115154 3300006028 Bacteria 2297
42 Ga0070717_10160576 3300006028 Bacteria 1949
43 Ga0070716_100304972 3300006173 Bacteria 1109
44 Ga0070712_100000059 3300006175 Bacteria 55897
45 Ga0070712_100943086 3300006175 Bacteria 745
46 Ga0097621_100345947 3300006237 Bacteria 1321
47 Ga0068871_101078780 3300006358 Bacteria 750
48 Ga0075430_101156263 3300006846 Unclassified 637
49 Ga0075433_10025867 3300006852 Bacteria 4964
50 Ga0075433_10781347 3300006852 Unclassified 835
51 Ga0075434_100007239 3300006871 Bacteria 10270
52 Ga0075434_100053443 3300006871 Bacteria 4014
53 Ga0075434_100088906 3300006871 Bacteria 3091
54 Ga0075434_100149325 3300006871 Unclassified 2357
55 Ga0075434_100223241 3300006871 Bacteria 1904
56 Ga0075429_100765341 3300006880 Bacteria 846
57 Ga0075436_100000023 3300006914 Bacteria 116796
58 Ga0075436_100137999 3300006914 Bacteria 1713
59 Ga0075436_101193775 3300006914 Bacteria 574
60 Ga0075435_100067820 3300007076 Unclassified 2905
61 Ga0075435_100372954 3300007076 Bacteria 1225
62 Ga0105240_10010687 3300009093 Bacteria 12882
63 Ga0105240_10204181 3300009093 Bacteria 2314
64 Ga0105240_11739879 3300009093 Unclassified 650
65 Ga0111539_10077347 3300009094 Bacteria 3916
66 Ga0111539_10396182 3300009094 Unclassified 1608
67 Ga0114129_10001468 3300009147 Bacteria 31889
68 Ga0114129_10030681 3300009147 Bacteria 7604
69 Ga0114129_10070422 3300009147 Bacteria 4877
70 Ga0114129_10353969 3300009147 Unclassified 1944
71 Ga0105241_10167773 3300009174 Unclassified 1810
72 Ga0105241_10182533 3300009174 Bacteria 1741
73 Ga0105242_10186722 3300009176 Bacteria 1832
74 Ga0105248_10021289 3300009177 Bacteria 7186
75 Ga0105237_10081224 3300009545 Bacteria 3232
76 Ga0105238_10012230 3300009551 Bacteria 8655
77 Ga0157373_10080328 3300013100 Bacteria 2300
78 Ga0157369_10292493 3300013105 Bacteria 1695
79 Ga0163162_10516978 3300013306 Bacteria 1323
80 Ga0157372_10493988 3300013307 Bacteria 1427
81 Ga0157372_12545850 3300013307 Bacteria 587
82 Ga0157375_12041261 3300013308 Unclassified 682
83 Ga0157380_10277338 3300014326 Bacteria 1532
84 Ga0157380_12062021 3300014326 Unclassified 633
85 Ga0157380_12359331 3300014326 Bacteria 597
86 Ga0157379_10013633 3300014968 Bacteria 7122
87 Ga0157379_10158303 3300014968 Bacteria 2044
88 Ga0157376_10246236 3300014969 Bacteria 1668
89 Ga0182007_10393235 3300015262 Unclassified 527
90 Ga0213872_10020500 3300021361 Bacteria 3047
91 Ga0213874_10068948 3300021377 Bacteria 1124
92 Ga0213875_10012141 3300021388 Bacteria 4261
93 Ga0228598_1001900 3300024227 Plasmid 4541
94 Ga0207692_10124457 3300025898 Bacteria 1448
95 Ga0207685_10343148 3300025905 Bacteria 751
96 Ga0207699_10000225 3300025906 Bacteria 32327
97 Ga0207684_10032394 3300025910 Bacteria 4445
98 Ga0207684_10099338 3300025910 Bacteria 2486
99 Ga0207684_10197458 3300025910 Bacteria 1735
100 Ga0207684_10761250 3300025910 Bacteria 820
101 Ga0207654_10474101 3300025911 Bacteria 881
102 Ga0207671_10088959 3300025914 Bacteria 2324
103 Ga0207693_10001253 3300025915 Bacteria 22580
104 Ga0207693_10543100 3300025915 Bacteria 907
105 Ga0207663_10139470 3300025916 Bacteria 1687
106 Ga0207663_10261100 3300025916 Bacteria 1279
107 Ga0207660_11074610 3300025917 Unclassified 656
108 Ga0207646_10028144 3300025922 Bacteria 5118
109 Ga0207646_10296955 3300025922 Bacteria 1460
110 Ga0207646_10525281 3300025922 Bacteria 1065
111 Ga0207700_10000010 3300025928 Bacteria 298473
112 Ga0207664_10059979 3300025929 Unclassified 3032
113 Ga0207664_10368307 3300025929 Unclassified 1274
114 Ga0207664_10416949 3300025929 Bacteria 1196
115 Ga0207664_11793657 3300025929 Bacteria 536
116 Ga0207644_10591477 3300025931 Bacteria 921
117 Ga0207665_10031841 3300025939 Bacteria 3490
118 Ga0207667_10023621 3300025949 Bacteria 6768
119 Ga0207640_11209520 3300025981 Bacteria 672
120 Ga0207703_10725752 3300026035 Unclassified 946
121 Ga0207639_10300246 3300026041 Bacteria 1419
122 Ga0207702_10000013 3300026078 Bacteria 257468
123 Ga0207702_10111633 3300026078 Bacteria 2431
124 Ga0207641_11028523 3300026088 Unclassified 821
125 Ga0207676_10089404 3300026095 Bacteria 2524
126 Ga0207674_10000887 3300026116 Bacteria 39121
127 Ga0207698_11236336 3300026142 Unclassified 761
128 Ga0268264_11822486 3300028381 Unclassified 618
129 Ga0373926_0086763 3300035083 Unclassified 1161
130 Ga0373934_0014545 3300035086 Bacteria 2983
131 Ga0373923_0421722 3300035111 Unclassified 644
132 Ga0373945_0036081 3300035116 Bacteria 1770
133 Ga0373953_0106119 3300035117 Bacteria 1185
134 Ga0373953_0421375 3300035117 Unclassified 589
135 Ga0373954_0082981 3300035118 Unclassified 1533
136 Ga0373954_0231772 3300035118 Bacteria 909
137 Ga0373956_0394412 3300035119 Unclassified 660
138 Ga0373957_0169675 3300035120 Unclassified 901
139 Ga0373957_0307172 3300035120 Unclassified 673
140 Ga0373943_0024515 3300035170 Bacteria 2813
141 Ga0373946_0016916 3300035171 Bacteria 2785
142 Ga0373946_0465222 3300035171 Unclassified 645
143 Ga0373955_0302810 3300035172 Bacteria 964
144 Ga0373955_0491351 3300035172 Unclassified 749
145 Ga0373942_0324311 3300035207 Unclassified 539
146 Ga0373935_0009879 3300035692 Bacteria 5717
147 Ga0373935_0063033 3300035692 Bacteria 2376
148 Ga0373935_0176508 3300035692 Unclassified 1464
149 Ga0373927_0001671 3300035695 Bacteria 16580
150 Ga0373927_0009515 3300035695 Bacteria 6516
151 Ga0373927_0024378 3300035695 Bacteria 3957
152 Ga0373927_0330531 3300035695 Unclassified 1004
153 Ga0373927_0733566 3300035695 Bacteria 653
154 Ga0373933_0083345 3300035724 Unclassified 1964
155 Ga0373933_0530604 3300035724 Bacteria 772
156 Ga0373947_0001874 3300035725 Bacteria 12830
157 Ga0373947_0006978 3300035725 Bacteria 6544
158 Ga0373947_0023929 3300035725 Bacteria 3556
159 Ga0373947_0224280 3300035725 Unclassified 1236
160 Ga0373947_0807880 3300035725 Unclassified 640
161 Ga0373937_0008207 3300036401 Bacteria 9069
162 Ga0373937_0028966 3300036401 Bacteria 5015
163 Ga0373937_0110147 3300036401 Bacteria 2561
164 Ga0373937_0143980 3300036401 Bacteria 2230
165 Ga0373937_0284132 3300036401 Bacteria 1563
166 Ga0373937_0640328 3300036401 Bacteria 1008
167 Ga0373925_0000905 3300037068 Bacteria 27102
168 Ga0373925_0062774 3300037068 Unclassified 2794
169 Ga0373925_0126432 3300037068 Bacteria 1989
170 Ga0373925_0254994 3300037068 Unclassified 1408
171 Ga0436364_0243527 3300037853 Bacteria 9499
172 Ga0436364_0928786 3300037853 Bacteria 1906
173 Ga0436365_0123489 3300039437 Unclassified 924
174 Ga0436365_1176681 3300039437 Bacteria 7491
175 Ga0436361_0166355 3300039447 Unclassified 815
176 Ga0436361_0318014 3300039447 Bacteria 937
177 Ga0436361_0458649 3300039447 Unclassified 2207
178 Ga0436361_1006938 3300039447 Unclassified 840
179 Ga0436363_0271088 3300039450 Unclassified 1418
180 Ga0436363_1604339 3300039450 Bacteria 1394
181 Ga0436362_0014932 3300039453 Bacteria 865
182 Ga0466966_0607825 3300044684 Bacteria 658
183 Ga0453684_2205059 3300044712 Bacteria 550
184 Ga0495592_0302779 3300046454 Unclassified 1038
185 Ga0495603_0300057 3300046455 Bacteria 923
186 Ga0495651_0007466 3300046462 Bacteria 8361
187 Ga0495651_0069673 3300046462 Bacteria 2678
188 Ga0495651_0585770 3300046462 Unclassified 705
189 Ga0495653_0032092 3300046463 Bacteria 4173
190 Ga0495653_0083604 3300046463 Bacteria 2353
191 Ga0495653_0333869 3300046463 Unclassified 979
192 Ga0495653_0672714 3300046463 Bacteria 631
193 Ga0495580_0002695 3300046472 Bacteria 15362
194 Ga0495580_0022153 3300046472 Bacteria 4680
195 Ga0495580_0076252 3300046472 Bacteria 2339
196 Ga0495580_0535296 3300046472 Unclassified 779
197 Ga0495580_0954039 3300046472 Bacteria 549
198 Ga0495662_0197825 3300046476 Bacteria 991
199 Ga0495662_0266294 3300046476 Unclassified 843
200 Ga0495662_0295454 3300046476 Bacteria 797
201 Ga0495664_0020935 3300046477 Bacteria 3775
202 Ga0495664_0060887 3300046477 Bacteria 2248
203 Ga0495664_0091483 3300046477 Bacteria 1829
204 Ga0495585_0127040 3300046492 Bacteria 1345
205 Ga0495608_0040924 3300046511 Bacteria 3103
206 Ga0495628_0004328 3300046516 Bacteria 12600
207 Ga0495630_0076291 3300046517 Bacteria 2525
208 Ga0495630_0534299 3300046517 Unclassified 899
209 Ga0495630_1036065 3300046517 Unclassified 623
210 Ga0495666_0035000 3300046526 Bacteria 2449
211 Ga0495652_0020350 3300046529 Bacteria 5899
212 Ga0495665_0107308 3300046531 Unclassified 1465
213 Ga0495665_0128144 3300046531 Bacteria 1329
214 Ga0495665_0189092 3300046531 Unclassified 1068
215 Ga0495640_0017951 3300046533 Bacteria 5260
216 Ga0495586_0016052 3300046535 Bacteria 3984
217 Ga0495587_0068169 3300046536 Bacteria 2073
218 Ga0495645_0035012 3300046543 Bacteria 3661
219 Ga0495667_0003831 3300046559 Bacteria 10107
220 Ga0495667_0313102 3300046559 Bacteria 994
221 Ga0495656_0529201 3300046615 Unclassified 627
222 Ga0495634_0087379 3300046642 Bacteria 2029
223 Ga0495634_0315891 3300046642 Unclassified 941
224 Ga0495634_0499937 3300046642 Unclassified 713
225 Ga0495635_0075283 3300046663 Bacteria 2313
226 Ga0495635_0767038 3300046663 Bacteria 623
227 Ga0495657_0020821 3300046675 Bacteria 4713
228 Ga0495623_0184411 3300046679 Bacteria 1210
229 Ga0495623_0268913 3300046679 Unclassified 952
230 Ga0495623_0541984 3300046679 Bacteria 610
231 Ga0495646_0003068 3300046680 Bacteria 10355
232 Ga0495613_0088184 3300046689 Unclassified 2248
233 Ga0495613_0898753 3300046689 Bacteria 573
234 Ga0495624_0132409 3300046690 Bacteria 1528
235 Ga0495624_0339639 3300046690 Unclassified 904
236 Ga0495600_0381529 3300046809 Bacteria 879
237 Ga0495600_0596466 3300046809 Bacteria 671
238 Ga0495600_0932030 3300046809 Bacteria 511
239 Ga0495604_0028340 3300047317 Bacteria 4454
240 Ga0495674_0030768 3300047319 Bacteria 4878
241 Ga0495674_0264085 3300047319 Bacteria 1414
242 Ga0495674_0543774 3300047319 Unclassified 925
243 Ga0495676_0200790 3300047321 Bacteria 1386
244 Ga0495680_0000537 3300047322 Bacteria 42715
245 Ga0495680_0250274 3300047322 Unclassified 1256
246 Ga0495675_0003719 3300047444 Bacteria 9219
247 Ga0495675_0583402 3300047444 Bacteria 635
248 Ga0495684_0002238 3300047471 Bacteria 15506
249 Ga0495684_0041854 3300047471 Bacteria 3510
250 Ga0495684_0234006 3300047471 Unclassified 1343
251 Ga0495684_0546468 3300047471 Bacteria 789
252 Ga0495593_0010076 3300047673 Bacteria 5472
253 Ga0495602_0033685 3300048088 Bacteria 4801
254 Ga0495602_0532320 3300048088 Bacteria 817
255 Ga0495614_0173364 3300048089 Unclassified 968
256 Ga0496102_0131638 3300048905 Bacteria 2342
257 Ga0496109_0134787 3300048912 Bacteria 2307
258 Ga0496112_0121744 3300048915 Bacteria 2579
259 Ga0496114_0928482 3300048917 Bacteria 752
260 Ga0501033_0615243 3300049570 Bacteria 744
261 Ga0501036_0090598 3300049572 Bacteria 2583
262 Ga0501038_0306617 3300049574 Bacteria 1245
263 Ga0501039_0311596 3300049575 Bacteria 1237
264 Ga0501040_0154314 3300049576 Bacteria 1621
265 Ga0501041_0126330 3300049577 Bacteria 1592
266 Ga0501043_0936744 3300049579 Bacteria 619
267 Ga0501070_0786085 3300049586 Bacteria 748
268 Ga0501071_0052898 3300049587 Bacteria 2928
269 Ga0501072_0056483 3300049588 Bacteria 3093
270 Ga0501074_1079164 3300049590 Bacteria 564
271 Ga0501075_0004530 3300049591 Bacteria 9412
272 Ga0501076_0015309 3300049592 Bacteria 5794
273 Ga0501079_0662893 3300049741 Bacteria 821
274 Ga0501081_0551432 3300049743 Bacteria 861
275 Ga0501044_0263922 3300049823 Bacteria 1660
276 Ga0501045_0105383 3300049824 Bacteria 2089
277 nmdc:mga05p37_1100335_c1 3300050507 Bacteria 832
278 nmdc:mga05p37_181081_c1 3300050507 Bacteria 2563
279 nmdc:mga05p37_310494_c1 3300050507 Unclassified 1869
280 nmdc:mga05p37_687_c1 3300050507 Bacteria 37482
281 nmdc:mga05p37_85247_c2 3300050507 Unclassified 1400
282 nmdc:mga09592_919824_c1 3300050508 Bacteria 734
283 nmdc:mga09592_958612_c1 3300050508 Bacteria 717
284 nmdc:mga08y16_306217_c1 3300050511 Unclassified 1637
285 nmdc:mga08y16_702248_c1 3300050511 Unclassified 1011
286 nmdc:mga0n895_1260081_c1 3300050512 Unclassified 711
287 nmdc:mga0n895_135702_c1 3300050512 Bacteria 2487
288 nmdc:mga0n895_191476_c1 3300050512 Bacteria 2076
289 nmdc:mga0n895_317371_c1 3300050512 Bacteria 1579
290 nmdc:mga0n895_328080_c1 3300050512 Bacteria 1551
291 nmdc:mga0rr50_463503_c1 3300050513 Unclassified 1075
292 nmdc:mga0rr50_73139_c1 3300050513 Bacteria 2620
293 nmdc:mga08x19_107936_c1 3300050514 Bacteria 1854
294 nmdc:mga08x19_686523_c1 3300050514 Unclassified 727
295 nmdc:mga0a205_1045887_c1 3300050515 Unclassified 663
296 nmdc:mga0a205_158907_c1 3300050515 Bacteria 2158
297 nmdc:mga0a205_39584_c1 3300050515 Bacteria 4537
298 Ga0495601_0365607 3300053077 Unclassified 937
299 Ga0495612_0001620 3300053078 Bacteria 9257
300 Ga0501084_0765353 3300054114 Bacteria 813
301 Ga0530510_0048593 3300061734 Bacteria 3067
302 Ga0530510_0600437 3300061734 Bacteria 837

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006871 Ga0075434_100223241 Ga0075434_1002232412 112
2 3300007076 Ga0075435_100372954 Ga0075435_1003729542 112
3 3300044712 Ga0453684_2205059 Ga0453684_2205059_163_519 112
4 3300050512 nmdc:mga0n895_191476_c1 nmdc:mga0n895_191476_c1_748_1104 112
5 3300005341 Ga0070691_10000050 Ga0070691_1000005026 113
6 3300005345 Ga0070692_10396056 Ga0070692_103960561 113
7 3300005435 Ga0070714_100035092 Ga0070714_1000350923 113
8 3300005435 Ga0070714_100163261 Ga0070714_1001632612 113
9 3300005436 Ga0070713_100000041 Ga0070713_10000004144 113
10 3300005437 Ga0070710_10464618 Ga0070710_104646182 113
11 3300005439 Ga0070711_100120695 Ga0070711_1001206952 113
12 3300005536 Ga0070697_100543010 Ga0070697_1005430101 113
13 3300005539 Ga0068853_100012494 Ga0068853_1000124945 113
14 3300005545 Ga0070695_100030021 Ga0070695_1000300212 113
15 3300005547 Ga0070693_100030534 Ga0070693_1000305342 113
16 3300005564 Ga0070664_101457823 Ga0070664_1014578232 113
17 3300005577 Ga0068857_100009044 Ga0068857_1000090447 113
18 3300005578 Ga0068854_100164908 Ga0068854_1001649082 113
19 3300005614 Ga0068856_100000274 Ga0068856_10000027433 113
20 3300005614 Ga0068856_100028050 Ga0068856_1000280504 113
21 3300005618 Ga0068864_100060146 Ga0068864_1000601464 113
22 3300005841 Ga0068863_100370679 Ga0068863_1003706792 113
23 3300005842 Ga0068858_101062458 Ga0068858_1010624582 113
24 3300006175 Ga0070712_100000059 Ga0070712_10000005915 113
25 3300006237 Ga0097621_100345947 Ga0097621_1003459472 113
26 3300006871 Ga0075434_100149325 Ga0075434_1001493254 113
27 3300006914 Ga0075436_100000023 Ga0075436_10000002352 113
28 3300006914 Ga0075436_100137999 Ga0075436_1001379992 113
29 3300007076 Ga0075435_100067820 Ga0075435_1000678204 113
30 3300009093 Ga0105240_10010687 Ga0105240_100106877 113
31 3300009174 Ga0105241_10167773 Ga0105241_101677732 113
32 3300009174 Ga0105241_10182533 Ga0105241_101825332 113
33 3300009545 Ga0105237_10081224 Ga0105237_100812242 113
34 3300009551 Ga0105238_10012230 Ga0105238_100122309 113
35 3300013100 Ga0157373_10080328 Ga0157373_100803283 113
36 3300013105 Ga0157369_10292493 Ga0157369_102924932 113
37 3300013306 Ga0163162_10516978 Ga0163162_105169783 113
38 3300013307 Ga0157372_12545850 Ga0157372_125458502 113
39 3300014968 Ga0157379_10013633 Ga0157379_100136337 113
40 3300014968 Ga0157379_10158303 Ga0157379_101583033 113
41 3300015262 Ga0182007_10393235 Ga0182007_103932352 113
42 3300025898 Ga0207692_10124457 Ga0207692_101244572 113
43 3300025906 Ga0207699_10000225 Ga0207699_1000022513 113
44 3300025911 Ga0207654_10474101 Ga0207654_104741011 113
45 3300025914 Ga0207671_10088959 Ga0207671_100889592 113
46 3300025915 Ga0207693_10001253 Ga0207693_100012536 113
47 3300025916 Ga0207663_10139470 Ga0207663_101394702 113
48 3300025917 Ga0207660_11074610 Ga0207660_110746102 113
49 3300025928 Ga0207700_10000010 Ga0207700_1000001072 113
50 3300025929 Ga0207664_10059979 Ga0207664_100599792 113
51 3300025929 Ga0207664_10368307 Ga0207664_103683072 113
52 3300025949 Ga0207667_10023621 Ga0207667_100236216 113
53 3300026035 Ga0207703_10725752 Ga0207703_107257522 113
54 3300026041 Ga0207639_10300246 Ga0207639_103002462 113
55 3300026078 Ga0207702_10000013 Ga0207702_10000013215 113
56 3300026078 Ga0207702_10111633 Ga0207702_101116332 113
57 3300026088 Ga0207641_11028523 Ga0207641_110285232 113
58 3300026095 Ga0207676_10089404 Ga0207676_100894042 113
59 3300026116 Ga0207674_10000887 Ga0207674_1000088734 113
60 3300026142 Ga0207698_11236336 Ga0207698_112363362 113
61 3300028381 Ga0268264_11822486 Ga0268264_118224862 113
62 3300050514 nmdc:mga08x19_107936_c1 nmdc:mga08x19_107936_c1_910_1269 113
63 3300009093 Ga0105240_10204181 Ga0105240_102041813 115
64 3300013307 Ga0157372_10493988 Ga0157372_104939882 115
65 3300035117 Ga0373953_0421375 Ga0373953_0421375_59_415 115
66 3300035120 Ga0373957_0307172 Ga0373957_0307172_148_504 115
67 3300035171 Ga0373946_0465222 Ga0373946_0465222_110_466 115
68 3300035692 Ga0373935_0009879 Ga0373935_0009879_4204_4560 115
69 3300035695 Ga0373927_0330531 Ga0373927_0330531_421_777 115
70 3300035725 Ga0373947_0807880 Ga0373947_0807880_99_455 115
71 3300036401 Ga0373937_0028966 Ga0373937_0028966_4384_4740 115
72 3300037068 Ga0373925_0254994 Ga0373925_0254994_760_1116 115
73 3300005439 Ga0070711_100553357 Ga0070711_1005533572 116
74 3300006846 Ga0075430_101156263 Ga0075430_1011562632 116
75 3300009147 Ga0114129_10030681 Ga0114129_100306815 116
76 3300009147 Ga0114129_10070422 Ga0114129_100704223 116
77 3300013308 Ga0157375_12041261 Ga0157375_120412611 116
78 3300014326 Ga0157380_12359331 Ga0157380_123593312 116
79 3300025916 Ga0207663_10261100 Ga0207663_102611002 116
80 3300039447 Ga0436361_0166355 Ga0436361_0166355_208_570 116
81 3300047471 Ga0495684_0546468 Ga0495684_0546468_411_770 116
82 3300050508 nmdc:mga09592_958612_c1 nmdc:mga09592_958612_c1_301_657 116
83 3300050512 nmdc:mga0n895_1260081_c1 nmdc:mga0n895_1260081_c1_147_497 116
84 3300050512 nmdc:mga0n895_135702_c1 nmdc:mga0n895_135702_c1_1905_2258 116
85 3300050515 nmdc:mga0a205_1045887_c1 nmdc:mga0a205_1045887_c1_266_619 116
86 3300061734 Ga0530510_0600437 Ga0530510_0600437_376_735 116
87 3300005437 Ga0070710_10993307 Ga0070710_109933072 117
88 3300006852 Ga0075433_10025867 Ga0075433_100258674 117
89 3300006871 Ga0075434_100088906 Ga0075434_1000889065 117
90 3300009147 Ga0114129_10001468 Ga0114129_1000146828 117
91 3300014326 Ga0157380_12062021 Ga0157380_120620212 117
92 3300050507 nmdc:mga05p37_687_c1 nmdc:mga05p37_687_c1_32660_33016 117
93 3300050512 nmdc:mga0n895_317371_c1 nmdc:mga0n895_317371_c1_50_406 117
94 3300050515 nmdc:mga0a205_39584_c1 nmdc:mga0a205_39584_c1_816_1172 117
95 3300047444 Ga0495675_0583402 Ga0495675_0583402_14_412 118
96 3300048088 Ga0495602_0532320 Ga0495602_0532320_407_805 118
97 3300009147 Ga0114129_10353969 Ga0114129_103539694 119
98 3300039437 Ga0436365_0123489 Ga0436365_0123489_511_888 119
99 3300039447 Ga0436361_1006938 Ga0436361_1006938_63_440 119
100 3300049570 Ga0501033_0615243 Ga0501033_0615243_259_633 119
101 3300049572 Ga0501036_0090598 Ga0501036_0090598_2064_2438 119
102 3300049579 Ga0501043_0936744 Ga0501043_0936744_220_594 119
103 3300049586 Ga0501070_0786085 Ga0501070_0786085_268_642 119
104 3300049587 Ga0501071_0052898 Ga0501071_0052898_2222_2596 119
105 3300049590 Ga0501074_1079164 Ga0501074_1079164_168_542 119
106 3300049741 Ga0501079_0662893 Ga0501079_0662893_329_703 119
107 3300049743 Ga0501081_0551432 Ga0501081_0551432_103_477 119
108 3300050507 nmdc:mga05p37_1100335_c1 nmdc:mga05p37_1100335_c1_203_568 119
109 3300025905 Ga0207685_10343148 Ga0207685_103431482 120
110 3300035116 Ga0373945_0036081 Ga0373945_0036081_1221_1589 120
111 3300035170 Ga0373943_0024515 Ga0373943_0024515_622_990 120
112 3300035692 Ga0373935_0063033 Ga0373935_0063033_373_741 120
113 3300035695 Ga0373927_0009515 Ga0373927_0009515_3805_4173 120
114 3300035725 Ga0373947_0001874 Ga0373947_0001874_7197_7565 120
115 3300037068 Ga0373925_0000905 Ga0373925_0000905_1815_2183 120
116 3300044684 Ga0466966_0607825 Ga0466966_0607825_144_524 120
117 3300046476 Ga0495662_0295454 Ga0495662_0295454_315_683 120
118 3300046531 Ga0495665_0128144 Ga0495665_0128144_886_1254 120
119 3300005445 Ga0070708_100030238 Ga0070708_1000302384 121
120 3300005467 Ga0070706_100197241 Ga0070706_1001972412 121
121 3300005468 Ga0070707_100062748 Ga0070707_1000627482 121
122 3300005471 Ga0070698_100039564 Ga0070698_1000395643 121
123 3300005471 Ga0070698_100044751 Ga0070698_1000447514 121
124 3300005518 Ga0070699_100034133 Ga0070699_1000341331 121
125 3300006028 Ga0070717_10115154 Ga0070717_101151542 121
126 3300025910 Ga0207684_10099338 Ga0207684_100993382 121
127 3300025929 Ga0207664_10416949 Ga0207664_104169491 121
128 3300035724 Ga0373933_0530604 Ga0373933_0530604_22_405 121
129 3300048905 Ga0496102_0131638 Ga0496102_0131638_998_1408 121
130 3300048912 Ga0496109_0134787 Ga0496109_0134787_148_558 121
131 3300048915 Ga0496112_0121744 Ga0496112_0121744_1248_1658 121
132 3300049574 Ga0501038_0306617 Ga0501038_0306617_851_1231 121
133 3300049575 Ga0501039_0311596 Ga0501039_0311596_489_869 121
134 3300049576 Ga0501040_0154314 Ga0501040_0154314_114_494 121
135 3300049577 Ga0501041_0126330 Ga0501041_0126330_376_756 121
136 3300049588 Ga0501072_0056483 Ga0501072_0056483_1234_1614 121
137 3300049591 Ga0501075_0004530 Ga0501075_0004530_5957_6337 121
138 3300049592 Ga0501076_0015309 Ga0501076_0015309_4951_5331 121
139 3300049823 Ga0501044_0263922 Ga0501044_0263922_396_776 121
140 3300049824 Ga0501045_0105383 Ga0501045_0105383_488_868 121
141 3300054114 Ga0501084_0765353 Ga0501084_0765353_338_718 121
142 3300061734 Ga0530510_0048593 Ga0530510_0048593_320_700 121
143 3300005439 Ga0070711_100814015 Ga0070711_1008140151 122
144 3300006914 Ga0075436_101193775 Ga0075436_1011937752 122
145 3300021361 Ga0213872_10020500 Ga0213872_100205002 122
146 3300035118 Ga0373954_0231772 Ga0373954_0231772_290_673 122
147 3300035172 Ga0373955_0302810 Ga0373955_0302810_532_915 122
148 3300046472 Ga0495580_0076252 Ga0495580_0076252_65_448 122
149 3300046476 Ga0495662_0197825 Ga0495662_0197825_322_705 122
150 3300046477 Ga0495664_0091483 Ga0495664_0091483_84_467 122
151 3300046663 Ga0495635_0767038 Ga0495635_0767038_177_560 122
152 3300005439 Ga0070711_100383454 Ga0070711_1003834542 123
153 3300006175 Ga0070712_100943086 Ga0070712_1009430862 123
154 3300021388 Ga0213875_10012141 Ga0213875_100121413 123
155 3300025915 Ga0207693_10543100 Ga0207693_105431001 123
156 3300035695 Ga0373927_0733566 Ga0373927_0733566_79_471 123
157 3300035725 Ga0373947_0006978 Ga0373947_0006978_4370_4768 123
158 3300036401 Ga0373937_0640328 Ga0373937_0640328_226_615 123
159 3300037068 Ga0373925_0062774 Ga0373925_0062774_1417_1815 123
160 3300037853 Ga0436364_0243527 Ga0436364_0243527_5676_6074 123
161 3300046455 Ga0495603_0300057 Ga0495603_0300057_66_464 123
162 3300046476 Ga0495662_0266294 Ga0495662_0266294_323_721 123
163 3300046533 Ga0495640_0017951 Ga0495640_0017951_1902_2300 123
164 3300046642 Ga0495634_0087379 Ga0495634_0087379_136_534 123
165 3300046690 Ga0495624_0339639 Ga0495624_0339639_142_540 123
166 3300046809 Ga0495600_0932030 Ga0495600_0932030_75_473 123
167 3300047319 Ga0495674_0543774 Ga0495674_0543774_32_430 123
168 3300047471 Ga0495684_0234006 Ga0495684_0234006_113_511 123
169 3300048917 Ga0496114_0928482 Ga0496114_0928482_342_740 123
170 3300050513 nmdc:mga0rr50_73139_c1 nmdc:mga0rr50_73139_c1_1006_1395 123
171 3300050514 nmdc:mga08x19_686523_c1 nmdc:mga08x19_686523_c1_294_683 123
172 3300005445 Ga0070708_100313140 Ga0070708_1003131402 124
173 3300006880 Ga0075429_100765341 Ga0075429_1007653412 124
174 3300021377 Ga0213874_10068948 Ga0213874_100689482 124
175 3300025922 Ga0207646_10296955 Ga0207646_102969552 124
176 3300039450 Ga0436363_0271088 Ga0436363_0271088_696_1082 124
177 3300009093 Ga0105240_11739879 Ga0105240_117398792 125
178 3300025981 Ga0207640_11209520 Ga0207640_112095202 125
179 3300039437 Ga0436365_1176681 Ga0436365_1176681_2070_2474 125
180 3300046679 Ga0495623_0184411 Ga0495623_0184411_353_748 125
181 3300025939 Ga0207665_10031841 Ga0207665_100318414 126
182 3300035086 Ga0373934_0014545 Ga0373934_0014545_1154_1576 126
183 3300035117 Ga0373953_0106119 Ga0373953_0106119_342_764 126
184 3300035695 Ga0373927_0001671 Ga0373927_0001671_12813_13235 126
185 3300035725 Ga0373947_0023929 Ga0373947_0023929_960_1382 126
186 3300036401 Ga0373937_0008207 Ga0373937_0008207_3063_3485 126
187 3300037068 Ga0373925_0126432 Ga0373925_0126432_208_630 126
188 3300039453 Ga0436362_0014932 Ga0436362_0014932_162_560 126
189 3300046462 Ga0495651_0585770 Ga0495651_0585770_186_608 126
190 3300046463 Ga0495653_0333869 Ga0495653_0333869_290_712 126
191 3300046472 Ga0495580_0002695 Ga0495580_0002695_9721_10143 126
192 3300046472 Ga0495580_0535296 Ga0495580_0535296_74_460 126
193 3300046472 Ga0495580_0954039 Ga0495580_0954039_97_495 126
194 3300046531 Ga0495665_0107308 Ga0495665_0107308_125_547 126
195 3300046679 Ga0495623_0541984 Ga0495623_0541984_165_587 126
196 3300046689 Ga0495613_0898753 Ga0495613_0898753_117_539 126
197 3300047471 Ga0495684_0041854 Ga0495684_0041854_1108_1530 126
198 3300005355 Ga0070671_100672543 Ga0070671_1006725431 127
199 3300005536 Ga0070697_100115565 Ga0070697_1001155653 127
200 3300006028 Ga0070717_10160576 Ga0070717_101605762 127
201 3300006173 Ga0070716_100304972 Ga0070716_1003049722 127
202 3300006358 Ga0068871_101078780 Ga0068871_1010787801 127
203 3300006852 Ga0075433_10781347 Ga0075433_107813471 127
204 3300006871 Ga0075434_100007239 Ga0075434_1000072391 127
205 3300009094 Ga0111539_10396182 Ga0111539_103961822 127
206 3300025910 Ga0207684_10197458 Ga0207684_101974582 127
207 3300025929 Ga0207664_11793657 Ga0207664_117936571 127
208 3300025931 Ga0207644_10591477 Ga0207644_105914771 127
209 3300035083 Ga0373926_0086763 Ga0373926_0086763_309_710 127
210 3300035111 Ga0373923_0421722 Ga0373923_0421722_71_472 127
211 3300035118 Ga0373954_0082981 Ga0373954_0082981_690_1091 127
212 3300035119 Ga0373956_0394412 Ga0373956_0394412_144_545 127
213 3300035120 Ga0373957_0169675 Ga0373957_0169675_175_576 127
214 3300035171 Ga0373946_0016916 Ga0373946_0016916_211_612 127
215 3300035172 Ga0373955_0491351 Ga0373955_0491351_33_434 127
216 3300035692 Ga0373935_0176508 Ga0373935_0176508_468_869 127
217 3300035695 Ga0373927_0024378 Ga0373927_0024378_3259_3660 127
218 3300035724 Ga0373933_0083345 Ga0373933_0083345_1162_1563 127
219 3300035725 Ga0373947_0224280 Ga0373947_0224280_346_747 127
220 3300036401 Ga0373937_0143980 Ga0373937_0143980_1609_2010 127
221 3300039450 Ga0436363_1604339 Ga0436363_1604339_753_1154 127
222 3300046454 Ga0495592_0302779 Ga0495592_0302779_177_578 127
223 3300046462 Ga0495651_0007466 Ga0495651_0007466_7944_8345 127
224 3300046463 Ga0495653_0032092 Ga0495653_0032092_1609_2010 127
225 3300046463 Ga0495653_0083604 Ga0495653_0083604_306_707 127
226 3300046463 Ga0495653_0672714 Ga0495653_0672714_35_436 127
227 3300046472 Ga0495580_0022153 Ga0495580_0022153_507_908 127
228 3300046477 Ga0495664_0020935 Ga0495664_0020935_653_1054 127
229 3300046477 Ga0495664_0060887 Ga0495664_0060887_296_697 127
230 3300046511 Ga0495608_0040924 Ga0495608_0040924_2692_3093 127
231 3300046516 Ga0495628_0004328 Ga0495628_0004328_7734_8135 127
232 3300046517 Ga0495630_0076291 Ga0495630_0076291_528_929 127
233 3300046517 Ga0495630_0534299 Ga0495630_0534299_410_811 127
234 3300046526 Ga0495666_0035000 Ga0495666_0035000_471_872 127
235 3300046529 Ga0495652_0020350 Ga0495652_0020350_568_969 127
236 3300046531 Ga0495665_0189092 Ga0495665_0189092_527_928 127
237 3300046535 Ga0495586_0016052 Ga0495586_0016052_421_822 127
238 3300046536 Ga0495587_0068169 Ga0495587_0068169_328_729 127
239 3300046543 Ga0495645_0035012 Ga0495645_0035012_696_1097 127
240 3300046559 Ga0495667_0003831 Ga0495667_0003831_4391_4792 127
241 3300046559 Ga0495667_0313102 Ga0495667_0313102_481_882 127
242 3300046642 Ga0495634_0499937 Ga0495634_0499937_31_432 127
243 3300046663 Ga0495635_0075283 Ga0495635_0075283_319_720 127
244 3300046675 Ga0495657_0020821 Ga0495657_0020821_3555_3956 127
245 3300046679 Ga0495623_0268913 Ga0495623_0268913_432_833 127
246 3300046680 Ga0495646_0003068 Ga0495646_0003068_1453_1854 127
247 3300046689 Ga0495613_0088184 Ga0495613_0088184_1608_2009 127
248 3300046690 Ga0495624_0132409 Ga0495624_0132409_1114_1515 127
249 3300046809 Ga0495600_0381529 Ga0495600_0381529_414_815 127
250 3300046809 Ga0495600_0596466 Ga0495600_0596466_28_429 127
251 3300047317 Ga0495604_0028340 Ga0495604_0028340_2209_2610 127
252 3300047319 Ga0495674_0030768 Ga0495674_0030768_3775_4176 127
253 3300047321 Ga0495676_0200790 Ga0495676_0200790_843_1244 127
254 3300047322 Ga0495680_0000537 Ga0495680_0000537_31182_31583 127
255 3300047322 Ga0495680_0250274 Ga0495680_0250274_527_928 127
256 3300047444 Ga0495675_0003719 Ga0495675_0003719_7916_8317 127
257 3300047471 Ga0495684_0002238 Ga0495684_0002238_14683_15084 127
258 3300047673 Ga0495593_0010076 Ga0495593_0010076_1517_1918 127
259 3300048088 Ga0495602_0033685 Ga0495602_0033685_4384_4785 127
260 3300048089 Ga0495614_0173364 Ga0495614_0173364_453_854 127
261 3300050507 nmdc:mga05p37_85247_c2 nmdc:mga05p37_85247_c2_593_979 127
262 3300050508 nmdc:mga09592_919824_c1 nmdc:mga09592_919824_c1_36_419 127
263 3300050511 nmdc:mga08y16_306217_c1 nmdc:mga08y16_306217_c1_327_710 127
264 3300053077 Ga0495601_0365607 Ga0495601_0365607_435_836 127
265 3300053078 Ga0495612_0001620 Ga0495612_0001620_5206_5607 127
266 3300009094 Ga0111539_10077347 Ga0111539_100773474 128
267 3300009176 Ga0105242_10186722 Ga0105242_101867222 128
268 3300009177 Ga0105248_10021289 Ga0105248_100212897 128
269 3300014326 Ga0157380_10277338 Ga0157380_102773381 128
270 3300014969 Ga0157376_10246236 Ga0157376_102462362 128
271 3300024227 Ga0228598_1001900 Ga0228598_10019002 128
272 3300035207 Ga0373942_0324311 Ga0373942_0324311_72_458 128
273 3300036401 Ga0373937_0110147 Ga0373937_0110147_441_848 128
274 3300036401 Ga0373937_0284132 Ga0373937_0284132_330_737 128
275 3300037853 Ga0436364_0928786 Ga0436364_0928786_1298_1705 128
276 3300039447 Ga0436361_0458649 Ga0436361_0458649_1348_1764 128
277 3300046492 Ga0495585_0127040 Ga0495585_0127040_488_874 128
278 3300046615 Ga0495656_0529201 Ga0495656_0529201_183_569 128
279 3300050507 nmdc:mga05p37_181081_c1 nmdc:mga05p37_181081_c1_564_968 128
280 3300050507 nmdc:mga05p37_310494_c1 nmdc:mga05p37_310494_c1_920_1309 128
281 3300050511 nmdc:mga08y16_702248_c1 nmdc:mga08y16_702248_c1_79_468 128
282 3300050512 nmdc:mga0n895_328080_c1 nmdc:mga0n895_328080_c1_1083_1472 128
283 3300050513 nmdc:mga0rr50_463503_c1 nmdc:mga0rr50_463503_c1_161_547 128
284 3300050515 nmdc:mga0a205_158907_c1 nmdc:mga0a205_158907_c1_267_656 128
285 3300005468 Ga0070707_101113803 Ga0070707_1011138032 131
286 3300005536 Ga0070697_100041851 Ga0070697_1000418511 131
287 3300025910 Ga0207684_10032394 Ga0207684_100323942 131
288 3300025922 Ga0207646_10028144 Ga0207646_100281443 131
289 3300025922 Ga0207646_10525281 Ga0207646_105252812 131
290 3300046462 Ga0495651_0069673 Ga0495651_0069673_2216_2632 131
291 3300046517 Ga0495630_1036065 Ga0495630_1036065_53_475 134
292 3300046642 Ga0495634_0315891 Ga0495634_0315891_15_437 134
293 3300047319 Ga0495674_0264085 Ga0495674_0264085_672_1094 134
294 3300005518 Ga0070699_100082204 Ga0070699_1000822043 135
295 3300025910 Ga0207684_10761250 Ga0207684_107612502 135
296 3300039447 Ga0436361_0318014 Ga0436361_0318014_430_861 137
297 3300005467 Ga0070706_100161331 Ga0070706_1001613312 138
298 3300005334 Ga0068869_101137461 Ga0068869_1011374612 139
299 3300005335 Ga0070666_10438678 Ga0070666_104386782 139
300 3300005353 Ga0070669_100099855 Ga0070669_1000998553 139
301 3300005364 Ga0070673_100039974 Ga0070673_1000399743 139
302 3300006871 Ga0075434_100053443 Ga0075434_1000534434 139

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

23

141

0.77

Feature Viewer

pLDDT pTM Quality
55.16 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map