F396361
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 302 | 177 | 302 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300005467|Ga0070706_100161331|Ga0070706_1001613312 |
| Length | 144 |
| Sequence | MRFASICGTTTLSQPNPIPELESVAVLHRLSRDADDPVFAEPWQAEAFALAVKLSEQGQFAWKEWAVALADELSAAASCGEPDDGSRYYHHLLAALERLVTAKGLADSADLAARKEAWAEAYRRTPHGKPVELSAESNDEQPPS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 2 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 4 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 5 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 23 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 24 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 25 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 26 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 33 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 34 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 35 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 36 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 37 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 38 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 57 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 58 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 59 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 60 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 85 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 86 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 87 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 88 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 89 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 90 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 91 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 92 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 93 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 94 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 95 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 96 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 97 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 98 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 99 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 100 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 102 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 105 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 106 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 107 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 108 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 109 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 149 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 150 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 153 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 154 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 155 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 159 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 160 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 162 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 163 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.32 |
| Rhizosphere | 96.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068869_101137461 | 3300005334 | Bacteria | 684 |
| 2 | Ga0070666_10438678 | 3300005335 | Bacteria | 942 |
| 3 | Ga0070691_10000050 | 3300005341 | Bacteria | 33001 |
| 4 | Ga0070692_10396056 | 3300005345 | Unclassified | 870 |
| 5 | Ga0070669_100099855 | 3300005353 | Bacteria | 2188 |
| 6 | Ga0070671_100672543 | 3300005355 | Bacteria | 897 |
| 7 | Ga0070673_100039974 | 3300005364 | Bacteria | 3595 |
| 8 | Ga0070714_100035092 | 3300005435 | Unclassified | 4202 |
| 9 | Ga0070714_100163261 | 3300005435 | Bacteria | 2017 |
| 10 | Ga0070713_100000041 | 3300005436 | Bacteria | 80753 |
| 11 | Ga0070710_10464618 | 3300005437 | Unclassified | 860 |
| 12 | Ga0070710_10993307 | 3300005437 | Unclassified | 611 |
| 13 | Ga0070711_100120695 | 3300005439 | Bacteria | 1938 |
| 14 | Ga0070711_100383454 | 3300005439 | Unclassified | 1137 |
| 15 | Ga0070711_100553357 | 3300005439 | Bacteria | 955 |
| 16 | Ga0070711_100814015 | 3300005439 | Bacteria | 793 |
| 17 | Ga0070708_100030238 | 3300005445 | Bacteria | 4681 |
| 18 | Ga0070708_100313140 | 3300005445 | Unclassified | 1478 |
| 19 | Ga0070706_100161331 | 3300005467 | Bacteria | 2093 |
| 20 | Ga0070706_100197241 | 3300005467 | Bacteria | 1880 |
| 21 | Ga0070707_100062748 | 3300005468 | Bacteria | 3565 |
| 22 | Ga0070707_101113803 | 3300005468 | Bacteria | 755 |
| 23 | Ga0070698_100039564 | 3300005471 | Bacteria | 4852 |
| 24 | Ga0070698_100044751 | 3300005471 | Bacteria | 4530 |
| 25 | Ga0070699_100034133 | 3300005518 | Bacteria | 4396 |
| 26 | Ga0070699_100082204 | 3300005518 | Bacteria | 2807 |
| 27 | Ga0070697_100041851 | 3300005536 | Bacteria | 3708 |
| 28 | Ga0070697_100115565 | 3300005536 | Bacteria | 2240 |
| 29 | Ga0070697_100543010 | 3300005536 | Unclassified | 1019 |
| 30 | Ga0068853_100012494 | 3300005539 | Bacteria | 6908 |
| 31 | Ga0070695_100030021 | 3300005545 | Bacteria | 3381 |
| 32 | Ga0070693_100030534 | 3300005547 | Bacteria | 2946 |
| 33 | Ga0070664_101457823 | 3300005564 | Unclassified | 647 |
| 34 | Ga0068857_100009044 | 3300005577 | Bacteria | 8640 |
| 35 | Ga0068854_100164908 | 3300005578 | Bacteria | 1719 |
| 36 | Ga0068856_100000274 | 3300005614 | Bacteria | 56135 |
| 37 | Ga0068856_100028050 | 3300005614 | Bacteria | 5494 |
| 38 | Ga0068864_100060146 | 3300005618 | Unclassified | 3289 |
| 39 | Ga0068863_100370679 | 3300005841 | Bacteria | 1397 |
| 40 | Ga0068858_101062458 | 3300005842 | Unclassified | 794 |
| 41 | Ga0070717_10115154 | 3300006028 | Bacteria | 2297 |
| 42 | Ga0070717_10160576 | 3300006028 | Bacteria | 1949 |
| 43 | Ga0070716_100304972 | 3300006173 | Bacteria | 1109 |
| 44 | Ga0070712_100000059 | 3300006175 | Bacteria | 55897 |
| 45 | Ga0070712_100943086 | 3300006175 | Bacteria | 745 |
| 46 | Ga0097621_100345947 | 3300006237 | Bacteria | 1321 |
| 47 | Ga0068871_101078780 | 3300006358 | Bacteria | 750 |
| 48 | Ga0075430_101156263 | 3300006846 | Unclassified | 637 |
| 49 | Ga0075433_10025867 | 3300006852 | Bacteria | 4964 |
| 50 | Ga0075433_10781347 | 3300006852 | Unclassified | 835 |
| 51 | Ga0075434_100007239 | 3300006871 | Bacteria | 10270 |
| 52 | Ga0075434_100053443 | 3300006871 | Bacteria | 4014 |
| 53 | Ga0075434_100088906 | 3300006871 | Bacteria | 3091 |
| 54 | Ga0075434_100149325 | 3300006871 | Unclassified | 2357 |
| 55 | Ga0075434_100223241 | 3300006871 | Bacteria | 1904 |
| 56 | Ga0075429_100765341 | 3300006880 | Bacteria | 846 |
| 57 | Ga0075436_100000023 | 3300006914 | Bacteria | 116796 |
| 58 | Ga0075436_100137999 | 3300006914 | Bacteria | 1713 |
| 59 | Ga0075436_101193775 | 3300006914 | Bacteria | 574 |
| 60 | Ga0075435_100067820 | 3300007076 | Unclassified | 2905 |
| 61 | Ga0075435_100372954 | 3300007076 | Bacteria | 1225 |
| 62 | Ga0105240_10010687 | 3300009093 | Bacteria | 12882 |
| 63 | Ga0105240_10204181 | 3300009093 | Bacteria | 2314 |
| 64 | Ga0105240_11739879 | 3300009093 | Unclassified | 650 |
| 65 | Ga0111539_10077347 | 3300009094 | Bacteria | 3916 |
| 66 | Ga0111539_10396182 | 3300009094 | Unclassified | 1608 |
| 67 | Ga0114129_10001468 | 3300009147 | Bacteria | 31889 |
| 68 | Ga0114129_10030681 | 3300009147 | Bacteria | 7604 |
| 69 | Ga0114129_10070422 | 3300009147 | Bacteria | 4877 |
| 70 | Ga0114129_10353969 | 3300009147 | Unclassified | 1944 |
| 71 | Ga0105241_10167773 | 3300009174 | Unclassified | 1810 |
| 72 | Ga0105241_10182533 | 3300009174 | Bacteria | 1741 |
| 73 | Ga0105242_10186722 | 3300009176 | Bacteria | 1832 |
| 74 | Ga0105248_10021289 | 3300009177 | Bacteria | 7186 |
| 75 | Ga0105237_10081224 | 3300009545 | Bacteria | 3232 |
| 76 | Ga0105238_10012230 | 3300009551 | Bacteria | 8655 |
| 77 | Ga0157373_10080328 | 3300013100 | Bacteria | 2300 |
| 78 | Ga0157369_10292493 | 3300013105 | Bacteria | 1695 |
| 79 | Ga0163162_10516978 | 3300013306 | Bacteria | 1323 |
| 80 | Ga0157372_10493988 | 3300013307 | Bacteria | 1427 |
| 81 | Ga0157372_12545850 | 3300013307 | Bacteria | 587 |
| 82 | Ga0157375_12041261 | 3300013308 | Unclassified | 682 |
| 83 | Ga0157380_10277338 | 3300014326 | Bacteria | 1532 |
| 84 | Ga0157380_12062021 | 3300014326 | Unclassified | 633 |
| 85 | Ga0157380_12359331 | 3300014326 | Bacteria | 597 |
| 86 | Ga0157379_10013633 | 3300014968 | Bacteria | 7122 |
| 87 | Ga0157379_10158303 | 3300014968 | Bacteria | 2044 |
| 88 | Ga0157376_10246236 | 3300014969 | Bacteria | 1668 |
| 89 | Ga0182007_10393235 | 3300015262 | Unclassified | 527 |
| 90 | Ga0213872_10020500 | 3300021361 | Bacteria | 3047 |
| 91 | Ga0213874_10068948 | 3300021377 | Bacteria | 1124 |
| 92 | Ga0213875_10012141 | 3300021388 | Bacteria | 4261 |
| 93 | Ga0228598_1001900 | 3300024227 | Plasmid | 4541 |
| 94 | Ga0207692_10124457 | 3300025898 | Bacteria | 1448 |
| 95 | Ga0207685_10343148 | 3300025905 | Bacteria | 751 |
| 96 | Ga0207699_10000225 | 3300025906 | Bacteria | 32327 |
| 97 | Ga0207684_10032394 | 3300025910 | Bacteria | 4445 |
| 98 | Ga0207684_10099338 | 3300025910 | Bacteria | 2486 |
| 99 | Ga0207684_10197458 | 3300025910 | Bacteria | 1735 |
| 100 | Ga0207684_10761250 | 3300025910 | Bacteria | 820 |
| 101 | Ga0207654_10474101 | 3300025911 | Bacteria | 881 |
| 102 | Ga0207671_10088959 | 3300025914 | Bacteria | 2324 |
| 103 | Ga0207693_10001253 | 3300025915 | Bacteria | 22580 |
| 104 | Ga0207693_10543100 | 3300025915 | Bacteria | 907 |
| 105 | Ga0207663_10139470 | 3300025916 | Bacteria | 1687 |
| 106 | Ga0207663_10261100 | 3300025916 | Bacteria | 1279 |
| 107 | Ga0207660_11074610 | 3300025917 | Unclassified | 656 |
| 108 | Ga0207646_10028144 | 3300025922 | Bacteria | 5118 |
| 109 | Ga0207646_10296955 | 3300025922 | Bacteria | 1460 |
| 110 | Ga0207646_10525281 | 3300025922 | Bacteria | 1065 |
| 111 | Ga0207700_10000010 | 3300025928 | Bacteria | 298473 |
| 112 | Ga0207664_10059979 | 3300025929 | Unclassified | 3032 |
| 113 | Ga0207664_10368307 | 3300025929 | Unclassified | 1274 |
| 114 | Ga0207664_10416949 | 3300025929 | Bacteria | 1196 |
| 115 | Ga0207664_11793657 | 3300025929 | Bacteria | 536 |
| 116 | Ga0207644_10591477 | 3300025931 | Bacteria | 921 |
| 117 | Ga0207665_10031841 | 3300025939 | Bacteria | 3490 |
| 118 | Ga0207667_10023621 | 3300025949 | Bacteria | 6768 |
| 119 | Ga0207640_11209520 | 3300025981 | Bacteria | 672 |
| 120 | Ga0207703_10725752 | 3300026035 | Unclassified | 946 |
| 121 | Ga0207639_10300246 | 3300026041 | Bacteria | 1419 |
| 122 | Ga0207702_10000013 | 3300026078 | Bacteria | 257468 |
| 123 | Ga0207702_10111633 | 3300026078 | Bacteria | 2431 |
| 124 | Ga0207641_11028523 | 3300026088 | Unclassified | 821 |
| 125 | Ga0207676_10089404 | 3300026095 | Bacteria | 2524 |
| 126 | Ga0207674_10000887 | 3300026116 | Bacteria | 39121 |
| 127 | Ga0207698_11236336 | 3300026142 | Unclassified | 761 |
| 128 | Ga0268264_11822486 | 3300028381 | Unclassified | 618 |
| 129 | Ga0373926_0086763 | 3300035083 | Unclassified | 1161 |
| 130 | Ga0373934_0014545 | 3300035086 | Bacteria | 2983 |
| 131 | Ga0373923_0421722 | 3300035111 | Unclassified | 644 |
| 132 | Ga0373945_0036081 | 3300035116 | Bacteria | 1770 |
| 133 | Ga0373953_0106119 | 3300035117 | Bacteria | 1185 |
| 134 | Ga0373953_0421375 | 3300035117 | Unclassified | 589 |
| 135 | Ga0373954_0082981 | 3300035118 | Unclassified | 1533 |
| 136 | Ga0373954_0231772 | 3300035118 | Bacteria | 909 |
| 137 | Ga0373956_0394412 | 3300035119 | Unclassified | 660 |
| 138 | Ga0373957_0169675 | 3300035120 | Unclassified | 901 |
| 139 | Ga0373957_0307172 | 3300035120 | Unclassified | 673 |
| 140 | Ga0373943_0024515 | 3300035170 | Bacteria | 2813 |
| 141 | Ga0373946_0016916 | 3300035171 | Bacteria | 2785 |
| 142 | Ga0373946_0465222 | 3300035171 | Unclassified | 645 |
| 143 | Ga0373955_0302810 | 3300035172 | Bacteria | 964 |
| 144 | Ga0373955_0491351 | 3300035172 | Unclassified | 749 |
| 145 | Ga0373942_0324311 | 3300035207 | Unclassified | 539 |
| 146 | Ga0373935_0009879 | 3300035692 | Bacteria | 5717 |
| 147 | Ga0373935_0063033 | 3300035692 | Bacteria | 2376 |
| 148 | Ga0373935_0176508 | 3300035692 | Unclassified | 1464 |
| 149 | Ga0373927_0001671 | 3300035695 | Bacteria | 16580 |
| 150 | Ga0373927_0009515 | 3300035695 | Bacteria | 6516 |
| 151 | Ga0373927_0024378 | 3300035695 | Bacteria | 3957 |
| 152 | Ga0373927_0330531 | 3300035695 | Unclassified | 1004 |
| 153 | Ga0373927_0733566 | 3300035695 | Bacteria | 653 |
| 154 | Ga0373933_0083345 | 3300035724 | Unclassified | 1964 |
| 155 | Ga0373933_0530604 | 3300035724 | Bacteria | 772 |
| 156 | Ga0373947_0001874 | 3300035725 | Bacteria | 12830 |
| 157 | Ga0373947_0006978 | 3300035725 | Bacteria | 6544 |
| 158 | Ga0373947_0023929 | 3300035725 | Bacteria | 3556 |
| 159 | Ga0373947_0224280 | 3300035725 | Unclassified | 1236 |
| 160 | Ga0373947_0807880 | 3300035725 | Unclassified | 640 |
| 161 | Ga0373937_0008207 | 3300036401 | Bacteria | 9069 |
| 162 | Ga0373937_0028966 | 3300036401 | Bacteria | 5015 |
| 163 | Ga0373937_0110147 | 3300036401 | Bacteria | 2561 |
| 164 | Ga0373937_0143980 | 3300036401 | Bacteria | 2230 |
| 165 | Ga0373937_0284132 | 3300036401 | Bacteria | 1563 |
| 166 | Ga0373937_0640328 | 3300036401 | Bacteria | 1008 |
| 167 | Ga0373925_0000905 | 3300037068 | Bacteria | 27102 |
| 168 | Ga0373925_0062774 | 3300037068 | Unclassified | 2794 |
| 169 | Ga0373925_0126432 | 3300037068 | Bacteria | 1989 |
| 170 | Ga0373925_0254994 | 3300037068 | Unclassified | 1408 |
| 171 | Ga0436364_0243527 | 3300037853 | Bacteria | 9499 |
| 172 | Ga0436364_0928786 | 3300037853 | Bacteria | 1906 |
| 173 | Ga0436365_0123489 | 3300039437 | Unclassified | 924 |
| 174 | Ga0436365_1176681 | 3300039437 | Bacteria | 7491 |
| 175 | Ga0436361_0166355 | 3300039447 | Unclassified | 815 |
| 176 | Ga0436361_0318014 | 3300039447 | Bacteria | 937 |
| 177 | Ga0436361_0458649 | 3300039447 | Unclassified | 2207 |
| 178 | Ga0436361_1006938 | 3300039447 | Unclassified | 840 |
| 179 | Ga0436363_0271088 | 3300039450 | Unclassified | 1418 |
| 180 | Ga0436363_1604339 | 3300039450 | Bacteria | 1394 |
| 181 | Ga0436362_0014932 | 3300039453 | Bacteria | 865 |
| 182 | Ga0466966_0607825 | 3300044684 | Bacteria | 658 |
| 183 | Ga0453684_2205059 | 3300044712 | Bacteria | 550 |
| 184 | Ga0495592_0302779 | 3300046454 | Unclassified | 1038 |
| 185 | Ga0495603_0300057 | 3300046455 | Bacteria | 923 |
| 186 | Ga0495651_0007466 | 3300046462 | Bacteria | 8361 |
| 187 | Ga0495651_0069673 | 3300046462 | Bacteria | 2678 |
| 188 | Ga0495651_0585770 | 3300046462 | Unclassified | 705 |
| 189 | Ga0495653_0032092 | 3300046463 | Bacteria | 4173 |
| 190 | Ga0495653_0083604 | 3300046463 | Bacteria | 2353 |
| 191 | Ga0495653_0333869 | 3300046463 | Unclassified | 979 |
| 192 | Ga0495653_0672714 | 3300046463 | Bacteria | 631 |
| 193 | Ga0495580_0002695 | 3300046472 | Bacteria | 15362 |
| 194 | Ga0495580_0022153 | 3300046472 | Bacteria | 4680 |
| 195 | Ga0495580_0076252 | 3300046472 | Bacteria | 2339 |
| 196 | Ga0495580_0535296 | 3300046472 | Unclassified | 779 |
| 197 | Ga0495580_0954039 | 3300046472 | Bacteria | 549 |
| 198 | Ga0495662_0197825 | 3300046476 | Bacteria | 991 |
| 199 | Ga0495662_0266294 | 3300046476 | Unclassified | 843 |
| 200 | Ga0495662_0295454 | 3300046476 | Bacteria | 797 |
| 201 | Ga0495664_0020935 | 3300046477 | Bacteria | 3775 |
| 202 | Ga0495664_0060887 | 3300046477 | Bacteria | 2248 |
| 203 | Ga0495664_0091483 | 3300046477 | Bacteria | 1829 |
| 204 | Ga0495585_0127040 | 3300046492 | Bacteria | 1345 |
| 205 | Ga0495608_0040924 | 3300046511 | Bacteria | 3103 |
| 206 | Ga0495628_0004328 | 3300046516 | Bacteria | 12600 |
| 207 | Ga0495630_0076291 | 3300046517 | Bacteria | 2525 |
| 208 | Ga0495630_0534299 | 3300046517 | Unclassified | 899 |
| 209 | Ga0495630_1036065 | 3300046517 | Unclassified | 623 |
| 210 | Ga0495666_0035000 | 3300046526 | Bacteria | 2449 |
| 211 | Ga0495652_0020350 | 3300046529 | Bacteria | 5899 |
| 212 | Ga0495665_0107308 | 3300046531 | Unclassified | 1465 |
| 213 | Ga0495665_0128144 | 3300046531 | Bacteria | 1329 |
| 214 | Ga0495665_0189092 | 3300046531 | Unclassified | 1068 |
| 215 | Ga0495640_0017951 | 3300046533 | Bacteria | 5260 |
| 216 | Ga0495586_0016052 | 3300046535 | Bacteria | 3984 |
| 217 | Ga0495587_0068169 | 3300046536 | Bacteria | 2073 |
| 218 | Ga0495645_0035012 | 3300046543 | Bacteria | 3661 |
| 219 | Ga0495667_0003831 | 3300046559 | Bacteria | 10107 |
| 220 | Ga0495667_0313102 | 3300046559 | Bacteria | 994 |
| 221 | Ga0495656_0529201 | 3300046615 | Unclassified | 627 |
| 222 | Ga0495634_0087379 | 3300046642 | Bacteria | 2029 |
| 223 | Ga0495634_0315891 | 3300046642 | Unclassified | 941 |
| 224 | Ga0495634_0499937 | 3300046642 | Unclassified | 713 |
| 225 | Ga0495635_0075283 | 3300046663 | Bacteria | 2313 |
| 226 | Ga0495635_0767038 | 3300046663 | Bacteria | 623 |
| 227 | Ga0495657_0020821 | 3300046675 | Bacteria | 4713 |
| 228 | Ga0495623_0184411 | 3300046679 | Bacteria | 1210 |
| 229 | Ga0495623_0268913 | 3300046679 | Unclassified | 952 |
| 230 | Ga0495623_0541984 | 3300046679 | Bacteria | 610 |
| 231 | Ga0495646_0003068 | 3300046680 | Bacteria | 10355 |
| 232 | Ga0495613_0088184 | 3300046689 | Unclassified | 2248 |
| 233 | Ga0495613_0898753 | 3300046689 | Bacteria | 573 |
| 234 | Ga0495624_0132409 | 3300046690 | Bacteria | 1528 |
| 235 | Ga0495624_0339639 | 3300046690 | Unclassified | 904 |
| 236 | Ga0495600_0381529 | 3300046809 | Bacteria | 879 |
| 237 | Ga0495600_0596466 | 3300046809 | Bacteria | 671 |
| 238 | Ga0495600_0932030 | 3300046809 | Bacteria | 511 |
| 239 | Ga0495604_0028340 | 3300047317 | Bacteria | 4454 |
| 240 | Ga0495674_0030768 | 3300047319 | Bacteria | 4878 |
| 241 | Ga0495674_0264085 | 3300047319 | Bacteria | 1414 |
| 242 | Ga0495674_0543774 | 3300047319 | Unclassified | 925 |
| 243 | Ga0495676_0200790 | 3300047321 | Bacteria | 1386 |
| 244 | Ga0495680_0000537 | 3300047322 | Bacteria | 42715 |
| 245 | Ga0495680_0250274 | 3300047322 | Unclassified | 1256 |
| 246 | Ga0495675_0003719 | 3300047444 | Bacteria | 9219 |
| 247 | Ga0495675_0583402 | 3300047444 | Bacteria | 635 |
| 248 | Ga0495684_0002238 | 3300047471 | Bacteria | 15506 |
| 249 | Ga0495684_0041854 | 3300047471 | Bacteria | 3510 |
| 250 | Ga0495684_0234006 | 3300047471 | Unclassified | 1343 |
| 251 | Ga0495684_0546468 | 3300047471 | Bacteria | 789 |
| 252 | Ga0495593_0010076 | 3300047673 | Bacteria | 5472 |
| 253 | Ga0495602_0033685 | 3300048088 | Bacteria | 4801 |
| 254 | Ga0495602_0532320 | 3300048088 | Bacteria | 817 |
| 255 | Ga0495614_0173364 | 3300048089 | Unclassified | 968 |
| 256 | Ga0496102_0131638 | 3300048905 | Bacteria | 2342 |
| 257 | Ga0496109_0134787 | 3300048912 | Bacteria | 2307 |
| 258 | Ga0496112_0121744 | 3300048915 | Bacteria | 2579 |
| 259 | Ga0496114_0928482 | 3300048917 | Bacteria | 752 |
| 260 | Ga0501033_0615243 | 3300049570 | Bacteria | 744 |
| 261 | Ga0501036_0090598 | 3300049572 | Bacteria | 2583 |
| 262 | Ga0501038_0306617 | 3300049574 | Bacteria | 1245 |
| 263 | Ga0501039_0311596 | 3300049575 | Bacteria | 1237 |
| 264 | Ga0501040_0154314 | 3300049576 | Bacteria | 1621 |
| 265 | Ga0501041_0126330 | 3300049577 | Bacteria | 1592 |
| 266 | Ga0501043_0936744 | 3300049579 | Bacteria | 619 |
| 267 | Ga0501070_0786085 | 3300049586 | Bacteria | 748 |
| 268 | Ga0501071_0052898 | 3300049587 | Bacteria | 2928 |
| 269 | Ga0501072_0056483 | 3300049588 | Bacteria | 3093 |
| 270 | Ga0501074_1079164 | 3300049590 | Bacteria | 564 |
| 271 | Ga0501075_0004530 | 3300049591 | Bacteria | 9412 |
| 272 | Ga0501076_0015309 | 3300049592 | Bacteria | 5794 |
| 273 | Ga0501079_0662893 | 3300049741 | Bacteria | 821 |
| 274 | Ga0501081_0551432 | 3300049743 | Bacteria | 861 |
| 275 | Ga0501044_0263922 | 3300049823 | Bacteria | 1660 |
| 276 | Ga0501045_0105383 | 3300049824 | Bacteria | 2089 |
| 277 | nmdc:mga05p37_1100335_c1 | 3300050507 | Bacteria | 832 |
| 278 | nmdc:mga05p37_181081_c1 | 3300050507 | Bacteria | 2563 |
| 279 | nmdc:mga05p37_310494_c1 | 3300050507 | Unclassified | 1869 |
| 280 | nmdc:mga05p37_687_c1 | 3300050507 | Bacteria | 37482 |
| 281 | nmdc:mga05p37_85247_c2 | 3300050507 | Unclassified | 1400 |
| 282 | nmdc:mga09592_919824_c1 | 3300050508 | Bacteria | 734 |
| 283 | nmdc:mga09592_958612_c1 | 3300050508 | Bacteria | 717 |
| 284 | nmdc:mga08y16_306217_c1 | 3300050511 | Unclassified | 1637 |
| 285 | nmdc:mga08y16_702248_c1 | 3300050511 | Unclassified | 1011 |
| 286 | nmdc:mga0n895_1260081_c1 | 3300050512 | Unclassified | 711 |
| 287 | nmdc:mga0n895_135702_c1 | 3300050512 | Bacteria | 2487 |
| 288 | nmdc:mga0n895_191476_c1 | 3300050512 | Bacteria | 2076 |
| 289 | nmdc:mga0n895_317371_c1 | 3300050512 | Bacteria | 1579 |
| 290 | nmdc:mga0n895_328080_c1 | 3300050512 | Bacteria | 1551 |
| 291 | nmdc:mga0rr50_463503_c1 | 3300050513 | Unclassified | 1075 |
| 292 | nmdc:mga0rr50_73139_c1 | 3300050513 | Bacteria | 2620 |
| 293 | nmdc:mga08x19_107936_c1 | 3300050514 | Bacteria | 1854 |
| 294 | nmdc:mga08x19_686523_c1 | 3300050514 | Unclassified | 727 |
| 295 | nmdc:mga0a205_1045887_c1 | 3300050515 | Unclassified | 663 |
| 296 | nmdc:mga0a205_158907_c1 | 3300050515 | Bacteria | 2158 |
| 297 | nmdc:mga0a205_39584_c1 | 3300050515 | Bacteria | 4537 |
| 298 | Ga0495601_0365607 | 3300053077 | Unclassified | 937 |
| 299 | Ga0495612_0001620 | 3300053078 | Bacteria | 9257 |
| 300 | Ga0501084_0765353 | 3300054114 | Bacteria | 813 |
| 301 | Ga0530510_0048593 | 3300061734 | Bacteria | 3067 |
| 302 | Ga0530510_0600437 | 3300061734 | Bacteria | 837 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006871 | Ga0075434_100223241 | Ga0075434_1002232412 | 112 |
| 2 | 3300007076 | Ga0075435_100372954 | Ga0075435_1003729542 | 112 |
| 3 | 3300044712 | Ga0453684_2205059 | Ga0453684_2205059_163_519 | 112 |
| 4 | 3300050512 | nmdc:mga0n895_191476_c1 | nmdc:mga0n895_191476_c1_748_1104 | 112 |
| 5 | 3300005341 | Ga0070691_10000050 | Ga0070691_1000005026 | 113 |
| 6 | 3300005345 | Ga0070692_10396056 | Ga0070692_103960561 | 113 |
| 7 | 3300005435 | Ga0070714_100035092 | Ga0070714_1000350923 | 113 |
| 8 | 3300005435 | Ga0070714_100163261 | Ga0070714_1001632612 | 113 |
| 9 | 3300005436 | Ga0070713_100000041 | Ga0070713_10000004144 | 113 |
| 10 | 3300005437 | Ga0070710_10464618 | Ga0070710_104646182 | 113 |
| 11 | 3300005439 | Ga0070711_100120695 | Ga0070711_1001206952 | 113 |
| 12 | 3300005536 | Ga0070697_100543010 | Ga0070697_1005430101 | 113 |
| 13 | 3300005539 | Ga0068853_100012494 | Ga0068853_1000124945 | 113 |
| 14 | 3300005545 | Ga0070695_100030021 | Ga0070695_1000300212 | 113 |
| 15 | 3300005547 | Ga0070693_100030534 | Ga0070693_1000305342 | 113 |
| 16 | 3300005564 | Ga0070664_101457823 | Ga0070664_1014578232 | 113 |
| 17 | 3300005577 | Ga0068857_100009044 | Ga0068857_1000090447 | 113 |
| 18 | 3300005578 | Ga0068854_100164908 | Ga0068854_1001649082 | 113 |
| 19 | 3300005614 | Ga0068856_100000274 | Ga0068856_10000027433 | 113 |
| 20 | 3300005614 | Ga0068856_100028050 | Ga0068856_1000280504 | 113 |
| 21 | 3300005618 | Ga0068864_100060146 | Ga0068864_1000601464 | 113 |
| 22 | 3300005841 | Ga0068863_100370679 | Ga0068863_1003706792 | 113 |
| 23 | 3300005842 | Ga0068858_101062458 | Ga0068858_1010624582 | 113 |
| 24 | 3300006175 | Ga0070712_100000059 | Ga0070712_10000005915 | 113 |
| 25 | 3300006237 | Ga0097621_100345947 | Ga0097621_1003459472 | 113 |
| 26 | 3300006871 | Ga0075434_100149325 | Ga0075434_1001493254 | 113 |
| 27 | 3300006914 | Ga0075436_100000023 | Ga0075436_10000002352 | 113 |
| 28 | 3300006914 | Ga0075436_100137999 | Ga0075436_1001379992 | 113 |
| 29 | 3300007076 | Ga0075435_100067820 | Ga0075435_1000678204 | 113 |
| 30 | 3300009093 | Ga0105240_10010687 | Ga0105240_100106877 | 113 |
| 31 | 3300009174 | Ga0105241_10167773 | Ga0105241_101677732 | 113 |
| 32 | 3300009174 | Ga0105241_10182533 | Ga0105241_101825332 | 113 |
| 33 | 3300009545 | Ga0105237_10081224 | Ga0105237_100812242 | 113 |
| 34 | 3300009551 | Ga0105238_10012230 | Ga0105238_100122309 | 113 |
| 35 | 3300013100 | Ga0157373_10080328 | Ga0157373_100803283 | 113 |
| 36 | 3300013105 | Ga0157369_10292493 | Ga0157369_102924932 | 113 |
| 37 | 3300013306 | Ga0163162_10516978 | Ga0163162_105169783 | 113 |
| 38 | 3300013307 | Ga0157372_12545850 | Ga0157372_125458502 | 113 |
| 39 | 3300014968 | Ga0157379_10013633 | Ga0157379_100136337 | 113 |
| 40 | 3300014968 | Ga0157379_10158303 | Ga0157379_101583033 | 113 |
| 41 | 3300015262 | Ga0182007_10393235 | Ga0182007_103932352 | 113 |
| 42 | 3300025898 | Ga0207692_10124457 | Ga0207692_101244572 | 113 |
| 43 | 3300025906 | Ga0207699_10000225 | Ga0207699_1000022513 | 113 |
| 44 | 3300025911 | Ga0207654_10474101 | Ga0207654_104741011 | 113 |
| 45 | 3300025914 | Ga0207671_10088959 | Ga0207671_100889592 | 113 |
| 46 | 3300025915 | Ga0207693_10001253 | Ga0207693_100012536 | 113 |
| 47 | 3300025916 | Ga0207663_10139470 | Ga0207663_101394702 | 113 |
| 48 | 3300025917 | Ga0207660_11074610 | Ga0207660_110746102 | 113 |
| 49 | 3300025928 | Ga0207700_10000010 | Ga0207700_1000001072 | 113 |
| 50 | 3300025929 | Ga0207664_10059979 | Ga0207664_100599792 | 113 |
| 51 | 3300025929 | Ga0207664_10368307 | Ga0207664_103683072 | 113 |
| 52 | 3300025949 | Ga0207667_10023621 | Ga0207667_100236216 | 113 |
| 53 | 3300026035 | Ga0207703_10725752 | Ga0207703_107257522 | 113 |
| 54 | 3300026041 | Ga0207639_10300246 | Ga0207639_103002462 | 113 |
| 55 | 3300026078 | Ga0207702_10000013 | Ga0207702_10000013215 | 113 |
| 56 | 3300026078 | Ga0207702_10111633 | Ga0207702_101116332 | 113 |
| 57 | 3300026088 | Ga0207641_11028523 | Ga0207641_110285232 | 113 |
| 58 | 3300026095 | Ga0207676_10089404 | Ga0207676_100894042 | 113 |
| 59 | 3300026116 | Ga0207674_10000887 | Ga0207674_1000088734 | 113 |
| 60 | 3300026142 | Ga0207698_11236336 | Ga0207698_112363362 | 113 |
| 61 | 3300028381 | Ga0268264_11822486 | Ga0268264_118224862 | 113 |
| 62 | 3300050514 | nmdc:mga08x19_107936_c1 | nmdc:mga08x19_107936_c1_910_1269 | 113 |
| 63 | 3300009093 | Ga0105240_10204181 | Ga0105240_102041813 | 115 |
| 64 | 3300013307 | Ga0157372_10493988 | Ga0157372_104939882 | 115 |
| 65 | 3300035117 | Ga0373953_0421375 | Ga0373953_0421375_59_415 | 115 |
| 66 | 3300035120 | Ga0373957_0307172 | Ga0373957_0307172_148_504 | 115 |
| 67 | 3300035171 | Ga0373946_0465222 | Ga0373946_0465222_110_466 | 115 |
| 68 | 3300035692 | Ga0373935_0009879 | Ga0373935_0009879_4204_4560 | 115 |
| 69 | 3300035695 | Ga0373927_0330531 | Ga0373927_0330531_421_777 | 115 |
| 70 | 3300035725 | Ga0373947_0807880 | Ga0373947_0807880_99_455 | 115 |
| 71 | 3300036401 | Ga0373937_0028966 | Ga0373937_0028966_4384_4740 | 115 |
| 72 | 3300037068 | Ga0373925_0254994 | Ga0373925_0254994_760_1116 | 115 |
| 73 | 3300005439 | Ga0070711_100553357 | Ga0070711_1005533572 | 116 |
| 74 | 3300006846 | Ga0075430_101156263 | Ga0075430_1011562632 | 116 |
| 75 | 3300009147 | Ga0114129_10030681 | Ga0114129_100306815 | 116 |
| 76 | 3300009147 | Ga0114129_10070422 | Ga0114129_100704223 | 116 |
| 77 | 3300013308 | Ga0157375_12041261 | Ga0157375_120412611 | 116 |
| 78 | 3300014326 | Ga0157380_12359331 | Ga0157380_123593312 | 116 |
| 79 | 3300025916 | Ga0207663_10261100 | Ga0207663_102611002 | 116 |
| 80 | 3300039447 | Ga0436361_0166355 | Ga0436361_0166355_208_570 | 116 |
| 81 | 3300047471 | Ga0495684_0546468 | Ga0495684_0546468_411_770 | 116 |
| 82 | 3300050508 | nmdc:mga09592_958612_c1 | nmdc:mga09592_958612_c1_301_657 | 116 |
| 83 | 3300050512 | nmdc:mga0n895_1260081_c1 | nmdc:mga0n895_1260081_c1_147_497 | 116 |
| 84 | 3300050512 | nmdc:mga0n895_135702_c1 | nmdc:mga0n895_135702_c1_1905_2258 | 116 |
| 85 | 3300050515 | nmdc:mga0a205_1045887_c1 | nmdc:mga0a205_1045887_c1_266_619 | 116 |
| 86 | 3300061734 | Ga0530510_0600437 | Ga0530510_0600437_376_735 | 116 |
| 87 | 3300005437 | Ga0070710_10993307 | Ga0070710_109933072 | 117 |
| 88 | 3300006852 | Ga0075433_10025867 | Ga0075433_100258674 | 117 |
| 89 | 3300006871 | Ga0075434_100088906 | Ga0075434_1000889065 | 117 |
| 90 | 3300009147 | Ga0114129_10001468 | Ga0114129_1000146828 | 117 |
| 91 | 3300014326 | Ga0157380_12062021 | Ga0157380_120620212 | 117 |
| 92 | 3300050507 | nmdc:mga05p37_687_c1 | nmdc:mga05p37_687_c1_32660_33016 | 117 |
| 93 | 3300050512 | nmdc:mga0n895_317371_c1 | nmdc:mga0n895_317371_c1_50_406 | 117 |
| 94 | 3300050515 | nmdc:mga0a205_39584_c1 | nmdc:mga0a205_39584_c1_816_1172 | 117 |
| 95 | 3300047444 | Ga0495675_0583402 | Ga0495675_0583402_14_412 | 118 |
| 96 | 3300048088 | Ga0495602_0532320 | Ga0495602_0532320_407_805 | 118 |
| 97 | 3300009147 | Ga0114129_10353969 | Ga0114129_103539694 | 119 |
| 98 | 3300039437 | Ga0436365_0123489 | Ga0436365_0123489_511_888 | 119 |
| 99 | 3300039447 | Ga0436361_1006938 | Ga0436361_1006938_63_440 | 119 |
| 100 | 3300049570 | Ga0501033_0615243 | Ga0501033_0615243_259_633 | 119 |
| 101 | 3300049572 | Ga0501036_0090598 | Ga0501036_0090598_2064_2438 | 119 |
| 102 | 3300049579 | Ga0501043_0936744 | Ga0501043_0936744_220_594 | 119 |
| 103 | 3300049586 | Ga0501070_0786085 | Ga0501070_0786085_268_642 | 119 |
| 104 | 3300049587 | Ga0501071_0052898 | Ga0501071_0052898_2222_2596 | 119 |
| 105 | 3300049590 | Ga0501074_1079164 | Ga0501074_1079164_168_542 | 119 |
| 106 | 3300049741 | Ga0501079_0662893 | Ga0501079_0662893_329_703 | 119 |
| 107 | 3300049743 | Ga0501081_0551432 | Ga0501081_0551432_103_477 | 119 |
| 108 | 3300050507 | nmdc:mga05p37_1100335_c1 | nmdc:mga05p37_1100335_c1_203_568 | 119 |
| 109 | 3300025905 | Ga0207685_10343148 | Ga0207685_103431482 | 120 |
| 110 | 3300035116 | Ga0373945_0036081 | Ga0373945_0036081_1221_1589 | 120 |
| 111 | 3300035170 | Ga0373943_0024515 | Ga0373943_0024515_622_990 | 120 |
| 112 | 3300035692 | Ga0373935_0063033 | Ga0373935_0063033_373_741 | 120 |
| 113 | 3300035695 | Ga0373927_0009515 | Ga0373927_0009515_3805_4173 | 120 |
| 114 | 3300035725 | Ga0373947_0001874 | Ga0373947_0001874_7197_7565 | 120 |
| 115 | 3300037068 | Ga0373925_0000905 | Ga0373925_0000905_1815_2183 | 120 |
| 116 | 3300044684 | Ga0466966_0607825 | Ga0466966_0607825_144_524 | 120 |
| 117 | 3300046476 | Ga0495662_0295454 | Ga0495662_0295454_315_683 | 120 |
| 118 | 3300046531 | Ga0495665_0128144 | Ga0495665_0128144_886_1254 | 120 |
| 119 | 3300005445 | Ga0070708_100030238 | Ga0070708_1000302384 | 121 |
| 120 | 3300005467 | Ga0070706_100197241 | Ga0070706_1001972412 | 121 |
| 121 | 3300005468 | Ga0070707_100062748 | Ga0070707_1000627482 | 121 |
| 122 | 3300005471 | Ga0070698_100039564 | Ga0070698_1000395643 | 121 |
| 123 | 3300005471 | Ga0070698_100044751 | Ga0070698_1000447514 | 121 |
| 124 | 3300005518 | Ga0070699_100034133 | Ga0070699_1000341331 | 121 |
| 125 | 3300006028 | Ga0070717_10115154 | Ga0070717_101151542 | 121 |
| 126 | 3300025910 | Ga0207684_10099338 | Ga0207684_100993382 | 121 |
| 127 | 3300025929 | Ga0207664_10416949 | Ga0207664_104169491 | 121 |
| 128 | 3300035724 | Ga0373933_0530604 | Ga0373933_0530604_22_405 | 121 |
| 129 | 3300048905 | Ga0496102_0131638 | Ga0496102_0131638_998_1408 | 121 |
| 130 | 3300048912 | Ga0496109_0134787 | Ga0496109_0134787_148_558 | 121 |
| 131 | 3300048915 | Ga0496112_0121744 | Ga0496112_0121744_1248_1658 | 121 |
| 132 | 3300049574 | Ga0501038_0306617 | Ga0501038_0306617_851_1231 | 121 |
| 133 | 3300049575 | Ga0501039_0311596 | Ga0501039_0311596_489_869 | 121 |
| 134 | 3300049576 | Ga0501040_0154314 | Ga0501040_0154314_114_494 | 121 |
| 135 | 3300049577 | Ga0501041_0126330 | Ga0501041_0126330_376_756 | 121 |
| 136 | 3300049588 | Ga0501072_0056483 | Ga0501072_0056483_1234_1614 | 121 |
| 137 | 3300049591 | Ga0501075_0004530 | Ga0501075_0004530_5957_6337 | 121 |
| 138 | 3300049592 | Ga0501076_0015309 | Ga0501076_0015309_4951_5331 | 121 |
| 139 | 3300049823 | Ga0501044_0263922 | Ga0501044_0263922_396_776 | 121 |
| 140 | 3300049824 | Ga0501045_0105383 | Ga0501045_0105383_488_868 | 121 |
| 141 | 3300054114 | Ga0501084_0765353 | Ga0501084_0765353_338_718 | 121 |
| 142 | 3300061734 | Ga0530510_0048593 | Ga0530510_0048593_320_700 | 121 |
| 143 | 3300005439 | Ga0070711_100814015 | Ga0070711_1008140151 | 122 |
| 144 | 3300006914 | Ga0075436_101193775 | Ga0075436_1011937752 | 122 |
| 145 | 3300021361 | Ga0213872_10020500 | Ga0213872_100205002 | 122 |
| 146 | 3300035118 | Ga0373954_0231772 | Ga0373954_0231772_290_673 | 122 |
| 147 | 3300035172 | Ga0373955_0302810 | Ga0373955_0302810_532_915 | 122 |
| 148 | 3300046472 | Ga0495580_0076252 | Ga0495580_0076252_65_448 | 122 |
| 149 | 3300046476 | Ga0495662_0197825 | Ga0495662_0197825_322_705 | 122 |
| 150 | 3300046477 | Ga0495664_0091483 | Ga0495664_0091483_84_467 | 122 |
| 151 | 3300046663 | Ga0495635_0767038 | Ga0495635_0767038_177_560 | 122 |
| 152 | 3300005439 | Ga0070711_100383454 | Ga0070711_1003834542 | 123 |
| 153 | 3300006175 | Ga0070712_100943086 | Ga0070712_1009430862 | 123 |
| 154 | 3300021388 | Ga0213875_10012141 | Ga0213875_100121413 | 123 |
| 155 | 3300025915 | Ga0207693_10543100 | Ga0207693_105431001 | 123 |
| 156 | 3300035695 | Ga0373927_0733566 | Ga0373927_0733566_79_471 | 123 |
| 157 | 3300035725 | Ga0373947_0006978 | Ga0373947_0006978_4370_4768 | 123 |
| 158 | 3300036401 | Ga0373937_0640328 | Ga0373937_0640328_226_615 | 123 |
| 159 | 3300037068 | Ga0373925_0062774 | Ga0373925_0062774_1417_1815 | 123 |
| 160 | 3300037853 | Ga0436364_0243527 | Ga0436364_0243527_5676_6074 | 123 |
| 161 | 3300046455 | Ga0495603_0300057 | Ga0495603_0300057_66_464 | 123 |
| 162 | 3300046476 | Ga0495662_0266294 | Ga0495662_0266294_323_721 | 123 |
| 163 | 3300046533 | Ga0495640_0017951 | Ga0495640_0017951_1902_2300 | 123 |
| 164 | 3300046642 | Ga0495634_0087379 | Ga0495634_0087379_136_534 | 123 |
| 165 | 3300046690 | Ga0495624_0339639 | Ga0495624_0339639_142_540 | 123 |
| 166 | 3300046809 | Ga0495600_0932030 | Ga0495600_0932030_75_473 | 123 |
| 167 | 3300047319 | Ga0495674_0543774 | Ga0495674_0543774_32_430 | 123 |
| 168 | 3300047471 | Ga0495684_0234006 | Ga0495684_0234006_113_511 | 123 |
| 169 | 3300048917 | Ga0496114_0928482 | Ga0496114_0928482_342_740 | 123 |
| 170 | 3300050513 | nmdc:mga0rr50_73139_c1 | nmdc:mga0rr50_73139_c1_1006_1395 | 123 |
| 171 | 3300050514 | nmdc:mga08x19_686523_c1 | nmdc:mga08x19_686523_c1_294_683 | 123 |
| 172 | 3300005445 | Ga0070708_100313140 | Ga0070708_1003131402 | 124 |
| 173 | 3300006880 | Ga0075429_100765341 | Ga0075429_1007653412 | 124 |
| 174 | 3300021377 | Ga0213874_10068948 | Ga0213874_100689482 | 124 |
| 175 | 3300025922 | Ga0207646_10296955 | Ga0207646_102969552 | 124 |
| 176 | 3300039450 | Ga0436363_0271088 | Ga0436363_0271088_696_1082 | 124 |
| 177 | 3300009093 | Ga0105240_11739879 | Ga0105240_117398792 | 125 |
| 178 | 3300025981 | Ga0207640_11209520 | Ga0207640_112095202 | 125 |
| 179 | 3300039437 | Ga0436365_1176681 | Ga0436365_1176681_2070_2474 | 125 |
| 180 | 3300046679 | Ga0495623_0184411 | Ga0495623_0184411_353_748 | 125 |
| 181 | 3300025939 | Ga0207665_10031841 | Ga0207665_100318414 | 126 |
| 182 | 3300035086 | Ga0373934_0014545 | Ga0373934_0014545_1154_1576 | 126 |
| 183 | 3300035117 | Ga0373953_0106119 | Ga0373953_0106119_342_764 | 126 |
| 184 | 3300035695 | Ga0373927_0001671 | Ga0373927_0001671_12813_13235 | 126 |
| 185 | 3300035725 | Ga0373947_0023929 | Ga0373947_0023929_960_1382 | 126 |
| 186 | 3300036401 | Ga0373937_0008207 | Ga0373937_0008207_3063_3485 | 126 |
| 187 | 3300037068 | Ga0373925_0126432 | Ga0373925_0126432_208_630 | 126 |
| 188 | 3300039453 | Ga0436362_0014932 | Ga0436362_0014932_162_560 | 126 |
| 189 | 3300046462 | Ga0495651_0585770 | Ga0495651_0585770_186_608 | 126 |
| 190 | 3300046463 | Ga0495653_0333869 | Ga0495653_0333869_290_712 | 126 |
| 191 | 3300046472 | Ga0495580_0002695 | Ga0495580_0002695_9721_10143 | 126 |
| 192 | 3300046472 | Ga0495580_0535296 | Ga0495580_0535296_74_460 | 126 |
| 193 | 3300046472 | Ga0495580_0954039 | Ga0495580_0954039_97_495 | 126 |
| 194 | 3300046531 | Ga0495665_0107308 | Ga0495665_0107308_125_547 | 126 |
| 195 | 3300046679 | Ga0495623_0541984 | Ga0495623_0541984_165_587 | 126 |
| 196 | 3300046689 | Ga0495613_0898753 | Ga0495613_0898753_117_539 | 126 |
| 197 | 3300047471 | Ga0495684_0041854 | Ga0495684_0041854_1108_1530 | 126 |
| 198 | 3300005355 | Ga0070671_100672543 | Ga0070671_1006725431 | 127 |
| 199 | 3300005536 | Ga0070697_100115565 | Ga0070697_1001155653 | 127 |
| 200 | 3300006028 | Ga0070717_10160576 | Ga0070717_101605762 | 127 |
| 201 | 3300006173 | Ga0070716_100304972 | Ga0070716_1003049722 | 127 |
| 202 | 3300006358 | Ga0068871_101078780 | Ga0068871_1010787801 | 127 |
| 203 | 3300006852 | Ga0075433_10781347 | Ga0075433_107813471 | 127 |
| 204 | 3300006871 | Ga0075434_100007239 | Ga0075434_1000072391 | 127 |
| 205 | 3300009094 | Ga0111539_10396182 | Ga0111539_103961822 | 127 |
| 206 | 3300025910 | Ga0207684_10197458 | Ga0207684_101974582 | 127 |
| 207 | 3300025929 | Ga0207664_11793657 | Ga0207664_117936571 | 127 |
| 208 | 3300025931 | Ga0207644_10591477 | Ga0207644_105914771 | 127 |
| 209 | 3300035083 | Ga0373926_0086763 | Ga0373926_0086763_309_710 | 127 |
| 210 | 3300035111 | Ga0373923_0421722 | Ga0373923_0421722_71_472 | 127 |
| 211 | 3300035118 | Ga0373954_0082981 | Ga0373954_0082981_690_1091 | 127 |
| 212 | 3300035119 | Ga0373956_0394412 | Ga0373956_0394412_144_545 | 127 |
| 213 | 3300035120 | Ga0373957_0169675 | Ga0373957_0169675_175_576 | 127 |
| 214 | 3300035171 | Ga0373946_0016916 | Ga0373946_0016916_211_612 | 127 |
| 215 | 3300035172 | Ga0373955_0491351 | Ga0373955_0491351_33_434 | 127 |
| 216 | 3300035692 | Ga0373935_0176508 | Ga0373935_0176508_468_869 | 127 |
| 217 | 3300035695 | Ga0373927_0024378 | Ga0373927_0024378_3259_3660 | 127 |
| 218 | 3300035724 | Ga0373933_0083345 | Ga0373933_0083345_1162_1563 | 127 |
| 219 | 3300035725 | Ga0373947_0224280 | Ga0373947_0224280_346_747 | 127 |
| 220 | 3300036401 | Ga0373937_0143980 | Ga0373937_0143980_1609_2010 | 127 |
| 221 | 3300039450 | Ga0436363_1604339 | Ga0436363_1604339_753_1154 | 127 |
| 222 | 3300046454 | Ga0495592_0302779 | Ga0495592_0302779_177_578 | 127 |
| 223 | 3300046462 | Ga0495651_0007466 | Ga0495651_0007466_7944_8345 | 127 |
| 224 | 3300046463 | Ga0495653_0032092 | Ga0495653_0032092_1609_2010 | 127 |
| 225 | 3300046463 | Ga0495653_0083604 | Ga0495653_0083604_306_707 | 127 |
| 226 | 3300046463 | Ga0495653_0672714 | Ga0495653_0672714_35_436 | 127 |
| 227 | 3300046472 | Ga0495580_0022153 | Ga0495580_0022153_507_908 | 127 |
| 228 | 3300046477 | Ga0495664_0020935 | Ga0495664_0020935_653_1054 | 127 |
| 229 | 3300046477 | Ga0495664_0060887 | Ga0495664_0060887_296_697 | 127 |
| 230 | 3300046511 | Ga0495608_0040924 | Ga0495608_0040924_2692_3093 | 127 |
| 231 | 3300046516 | Ga0495628_0004328 | Ga0495628_0004328_7734_8135 | 127 |
| 232 | 3300046517 | Ga0495630_0076291 | Ga0495630_0076291_528_929 | 127 |
| 233 | 3300046517 | Ga0495630_0534299 | Ga0495630_0534299_410_811 | 127 |
| 234 | 3300046526 | Ga0495666_0035000 | Ga0495666_0035000_471_872 | 127 |
| 235 | 3300046529 | Ga0495652_0020350 | Ga0495652_0020350_568_969 | 127 |
| 236 | 3300046531 | Ga0495665_0189092 | Ga0495665_0189092_527_928 | 127 |
| 237 | 3300046535 | Ga0495586_0016052 | Ga0495586_0016052_421_822 | 127 |
| 238 | 3300046536 | Ga0495587_0068169 | Ga0495587_0068169_328_729 | 127 |
| 239 | 3300046543 | Ga0495645_0035012 | Ga0495645_0035012_696_1097 | 127 |
| 240 | 3300046559 | Ga0495667_0003831 | Ga0495667_0003831_4391_4792 | 127 |
| 241 | 3300046559 | Ga0495667_0313102 | Ga0495667_0313102_481_882 | 127 |
| 242 | 3300046642 | Ga0495634_0499937 | Ga0495634_0499937_31_432 | 127 |
| 243 | 3300046663 | Ga0495635_0075283 | Ga0495635_0075283_319_720 | 127 |
| 244 | 3300046675 | Ga0495657_0020821 | Ga0495657_0020821_3555_3956 | 127 |
| 245 | 3300046679 | Ga0495623_0268913 | Ga0495623_0268913_432_833 | 127 |
| 246 | 3300046680 | Ga0495646_0003068 | Ga0495646_0003068_1453_1854 | 127 |
| 247 | 3300046689 | Ga0495613_0088184 | Ga0495613_0088184_1608_2009 | 127 |
| 248 | 3300046690 | Ga0495624_0132409 | Ga0495624_0132409_1114_1515 | 127 |
| 249 | 3300046809 | Ga0495600_0381529 | Ga0495600_0381529_414_815 | 127 |
| 250 | 3300046809 | Ga0495600_0596466 | Ga0495600_0596466_28_429 | 127 |
| 251 | 3300047317 | Ga0495604_0028340 | Ga0495604_0028340_2209_2610 | 127 |
| 252 | 3300047319 | Ga0495674_0030768 | Ga0495674_0030768_3775_4176 | 127 |
| 253 | 3300047321 | Ga0495676_0200790 | Ga0495676_0200790_843_1244 | 127 |
| 254 | 3300047322 | Ga0495680_0000537 | Ga0495680_0000537_31182_31583 | 127 |
| 255 | 3300047322 | Ga0495680_0250274 | Ga0495680_0250274_527_928 | 127 |
| 256 | 3300047444 | Ga0495675_0003719 | Ga0495675_0003719_7916_8317 | 127 |
| 257 | 3300047471 | Ga0495684_0002238 | Ga0495684_0002238_14683_15084 | 127 |
| 258 | 3300047673 | Ga0495593_0010076 | Ga0495593_0010076_1517_1918 | 127 |
| 259 | 3300048088 | Ga0495602_0033685 | Ga0495602_0033685_4384_4785 | 127 |
| 260 | 3300048089 | Ga0495614_0173364 | Ga0495614_0173364_453_854 | 127 |
| 261 | 3300050507 | nmdc:mga05p37_85247_c2 | nmdc:mga05p37_85247_c2_593_979 | 127 |
| 262 | 3300050508 | nmdc:mga09592_919824_c1 | nmdc:mga09592_919824_c1_36_419 | 127 |
| 263 | 3300050511 | nmdc:mga08y16_306217_c1 | nmdc:mga08y16_306217_c1_327_710 | 127 |
| 264 | 3300053077 | Ga0495601_0365607 | Ga0495601_0365607_435_836 | 127 |
| 265 | 3300053078 | Ga0495612_0001620 | Ga0495612_0001620_5206_5607 | 127 |
| 266 | 3300009094 | Ga0111539_10077347 | Ga0111539_100773474 | 128 |
| 267 | 3300009176 | Ga0105242_10186722 | Ga0105242_101867222 | 128 |
| 268 | 3300009177 | Ga0105248_10021289 | Ga0105248_100212897 | 128 |
| 269 | 3300014326 | Ga0157380_10277338 | Ga0157380_102773381 | 128 |
| 270 | 3300014969 | Ga0157376_10246236 | Ga0157376_102462362 | 128 |
| 271 | 3300024227 | Ga0228598_1001900 | Ga0228598_10019002 | 128 |
| 272 | 3300035207 | Ga0373942_0324311 | Ga0373942_0324311_72_458 | 128 |
| 273 | 3300036401 | Ga0373937_0110147 | Ga0373937_0110147_441_848 | 128 |
| 274 | 3300036401 | Ga0373937_0284132 | Ga0373937_0284132_330_737 | 128 |
| 275 | 3300037853 | Ga0436364_0928786 | Ga0436364_0928786_1298_1705 | 128 |
| 276 | 3300039447 | Ga0436361_0458649 | Ga0436361_0458649_1348_1764 | 128 |
| 277 | 3300046492 | Ga0495585_0127040 | Ga0495585_0127040_488_874 | 128 |
| 278 | 3300046615 | Ga0495656_0529201 | Ga0495656_0529201_183_569 | 128 |
| 279 | 3300050507 | nmdc:mga05p37_181081_c1 | nmdc:mga05p37_181081_c1_564_968 | 128 |
| 280 | 3300050507 | nmdc:mga05p37_310494_c1 | nmdc:mga05p37_310494_c1_920_1309 | 128 |
| 281 | 3300050511 | nmdc:mga08y16_702248_c1 | nmdc:mga08y16_702248_c1_79_468 | 128 |
| 282 | 3300050512 | nmdc:mga0n895_328080_c1 | nmdc:mga0n895_328080_c1_1083_1472 | 128 |
| 283 | 3300050513 | nmdc:mga0rr50_463503_c1 | nmdc:mga0rr50_463503_c1_161_547 | 128 |
| 284 | 3300050515 | nmdc:mga0a205_158907_c1 | nmdc:mga0a205_158907_c1_267_656 | 128 |
| 285 | 3300005468 | Ga0070707_101113803 | Ga0070707_1011138032 | 131 |
| 286 | 3300005536 | Ga0070697_100041851 | Ga0070697_1000418511 | 131 |
| 287 | 3300025910 | Ga0207684_10032394 | Ga0207684_100323942 | 131 |
| 288 | 3300025922 | Ga0207646_10028144 | Ga0207646_100281443 | 131 |
| 289 | 3300025922 | Ga0207646_10525281 | Ga0207646_105252812 | 131 |
| 290 | 3300046462 | Ga0495651_0069673 | Ga0495651_0069673_2216_2632 | 131 |
| 291 | 3300046517 | Ga0495630_1036065 | Ga0495630_1036065_53_475 | 134 |
| 292 | 3300046642 | Ga0495634_0315891 | Ga0495634_0315891_15_437 | 134 |
| 293 | 3300047319 | Ga0495674_0264085 | Ga0495674_0264085_672_1094 | 134 |
| 294 | 3300005518 | Ga0070699_100082204 | Ga0070699_1000822043 | 135 |
| 295 | 3300025910 | Ga0207684_10761250 | Ga0207684_107612502 | 135 |
| 296 | 3300039447 | Ga0436361_0318014 | Ga0436361_0318014_430_861 | 137 |
| 297 | 3300005467 | Ga0070706_100161331 | Ga0070706_1001613312 | 138 |
| 298 | 3300005334 | Ga0068869_101137461 | Ga0068869_1011374612 | 139 |
| 299 | 3300005335 | Ga0070666_10438678 | Ga0070666_104386782 | 139 |
| 300 | 3300005353 | Ga0070669_100099855 | Ga0070669_1000998553 | 139 |
| 301 | 3300005364 | Ga0070673_100039974 | Ga0070673_1000399743 | 139 |
| 302 | 3300006871 | Ga0075434_100053443 | Ga0075434_1000534434 | 139 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar