F396165

General Info

Members Datasets Scaffolds Average Seq Length
301 203 602 262

Family's Representative Sequence

Representative Sequence 3300049580|Ga0501046_0019445|Ga0501046_0019445_3167_3997
Length 276
Sequence VTGAPDPEEEAMSVTPFRQARRGEERWVSPVFLGIAAVMGVSGWALWTGFASDPGFAVFLFVVSGWVVSLCLHEYAHARTALHSGDISIGAKGYLTLNPLKYANAALSIVLPVIFVIMGGIGLPGGAVFIERGRIHGRWKHSLISAAGPLTNVLFAVLLMVPFTMGVLGDWPVDFLCALAFLALLQVSAALLNLLPIPGLDGYGIWEPWLSYNIRRQAESFAPFGIFATFGLLYIPAVNDKFFDVVYHVMAWFDVPPEAAARGYWLFKFWTSMGKN

Samples

Sample ID Description Type Environment
1 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
9 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
10 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
11 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
12 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
15 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
18 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
20 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
21 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
22 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
23 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
24 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
25 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
26 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
27 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
28 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
29 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
30 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
31 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
32 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
33 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
34 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
35 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
36 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
37 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
38 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
39 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
40 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
41 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
42 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
43 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
44 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
45 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
46 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
47 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
48 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
49 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
50 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
51 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
52 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
53 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
54 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
55 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
56 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
57 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
58 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
59 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
60 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
61 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
62 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
63 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
64 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
65 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
66 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
67 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
70 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
71 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
72 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
73 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
74 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
75 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
76 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
77 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
78 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
79 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
80 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
81 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
82 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
83 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
84 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
87 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
88 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
89 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
90 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
91 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
92 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
99 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
102 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
103 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
104 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
109 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
110 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
126 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
127 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
128 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
129 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
130 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
144 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
145 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
146 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
147 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
150 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
153 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
154 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
155 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
156 2643221548 Streptomyces sp. Root55 Isolate Unclassified
157 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
158 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
159 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
160 2643221670 Streptomyces sp. Root431 Isolate Unclassified
161 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
162 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
163 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
164 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
165 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
166 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
167 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
168 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
169 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
170 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
171 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
172 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
173 2867428634 Streptomyces sp. RP5T Isolate Unclassified
174 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
175 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
176 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
177 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
178 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
179 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
180 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
181 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
182 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
183 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
184 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
185 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
186 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
187 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
188 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
189 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
190 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
191 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
192 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
193 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
194 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
195 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
196 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
197 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
198 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
199 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
200 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
201 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
202 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
203 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.06
Metatranscriptomes 0
Isolates 16.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0
Rhizoplane 1.66
Rhizosphere 83.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501046_0019445 3300049580 Bacteria 5635
2 JGI24740J21852_10033317 3300001979 Bacteria 1637
3 JGI24739J22299_10042391 3300001989 Bacteria 1510
4 JGI24737J22298_10020869 3300001990 Bacteria 2089
5 JGI24735J21928_10044642 3300002067 Bacteria 1288
6 JGI24738J21930_10013510 3300002075 Bacteria 1764
7 rootH2_10028175 3300003320 Bacteria 5009
8 rootH2_10049980 3300003320 Bacteria 1747
9 Ga0068855_100177958 3300005563 Bacteria 2406
10 Ga0075367_10013978 3300006178 Bacteria 4333
11 Ga0105250_10063851 3300009092 Bacteria 1482
12 Ga0105245_10469482 3300009098 Bacteria 1270
13 Ga0105247_10346656 3300009101 Bacteria 1043
14 Ga0105246_10091403 3300011119 Bacteria 2194
15 Ga0182008_10013528 3300014497 Bacteria 4290
16 Ga0182006_1108017 3300015261 Bacteria 979
17 Ga0182007_10023670 3300015262 Bacteria 2158
18 Ga0207426_1004660 3300025302 Bacteria 6591
19 Ga0207667_10364521 3300025949 Bacteria 1473
20 Ga0307517_10004678 3300028786 Bacteria 20967
21 Ga0307515_10280434 3300028794 Bacteria 1374
22 Ga0307512_10008531 3300030522 Bacteria 9974
23 Ga0307512_10045842 3300030522 Bacteria 3572
24 Ga0307513_10115795 3300031456 Bacteria 2662
25 Ga0307509_10202045 3300031507 Bacteria 1823
26 Ga0307509_10292670 3300031507 Bacteria 1382
27 Ga0307508_10026421 3300031616 Bacteria 5261
28 Ga0307508_10054309 3300031616 Bacteria 3552
29 Ga0307508_10175212 3300031616 Bacteria 1748
30 Ga0307516_10080553 3300031730 Bacteria 3100
31 Ga0307516_10168318 3300031730 Bacteria 1934
32 Ga0307416_100979280 3300032002 Bacteria 948
33 Ga0307507_10104471 3300033179 Bacteria 2351
34 Ga0395898_0017323 3300037466 Bacteria 7360
35 Ga0436364_0741234 3300037853 Bacteria 23339
36 Ga0439433_0042893 3300041999 Bacteria 1055
37 Ga0439448_0024268 3300042005 Bacteria 1895
38 Ga0439449_0016305 3300042007 Bacteria 2792
39 Ga0439449_0030935 3300042007 Bacteria 1995
40 Ga0439455_0013027 3300042012 Bacteria 1877
41 Ga0450903_001153 3300042138 Bacteria 4991
42 Ga0450901_001825 3300042533 Bacteria 2387
43 Ga0450901_013907 3300042533 Bacteria 844
44 Ga0466972_0003667 3300044658 Bacteria 7635
45 Ga0466972_0019041 3300044658 Bacteria 3432
46 Ga0466965_0000143 3300044683 Bacteria 20910
47 Ga0466966_0004861 3300044684 Bacteria 8839
48 Ga0466961_0002053 3300044693 Bacteria 12543
49 Ga0466963_0001200 3300044694 Bacteria 13640
50 Ga0466964_0003497 3300044706 Bacteria 5735
51 Ga0466971_0001073 3300044719 Bacteria 11357
52 Ga0466970_0002694 3300044765 Bacteria 8576
53 Ga0466970_0029837 3300044765 Bacteria 2874
54 Ga0466957_0001219 3300044842 Bacteria 13417
55 Ga0466960_0000943 3300044901 Bacteria 10288
56 Ga0466959_0000460 3300045049 Bacteria 23699
57 Ga0466958_0002206 3300045836 Bacteria 9698
58 Ga0466967_0007532 3300045976 Bacteria 7861
59 Ga0466967_0911201 3300045976 Bacteria 874
60 Ga0495592_0008891 3300046454 Bacteria 7542
61 Ga0495603_0000151 3300046455 Bacteria 34572
62 Ga0495603_0008316 3300046455 Bacteria 6272
63 Ga0495603_0056368 3300046455 Bacteria 2327
64 Ga0495590_0100874 3300046457 Bacteria 1025
65 Ga0495629_0001571 3300046459 Bacteria 17954
66 Ga0495629_0014829 3300046459 Bacteria 5606
67 Ga0495629_0018899 3300046459 Bacteria 4926
68 Ga0495629_0168958 3300046459 Bacteria 1518
69 Ga0495629_0233526 3300046459 Bacteria 1267
70 Ga0495651_0002602 3300046462 Bacteria 13952
71 Ga0495639_0061819 3300046475 Bacteria 1717
72 Ga0495662_0000830 3300046476 Bacteria 15011
73 Ga0495662_0034796 3300046476 Bacteria 2431
74 Ga0495664_0001867 3300046477 Bacteria 11190
75 Ga0495664_0075534 3300046477 Bacteria 2016
76 Ga0495585_0047653 3300046492 Bacteria 2386
77 Ga0495594_0002607 3300046499 Bacteria 9373
78 Ga0495594_0012986 3300046499 Bacteria 4343
79 Ga0495594_0158348 3300046499 Bacteria 1287
80 Ga0495607_0055387 3300046501 Bacteria 2281
81 Ga0495606_0012225 3300046507 Bacteria 6908
82 Ga0495616_0074089 3300046513 Bacteria 1641
83 Ga0495618_0022921 3300046514 Bacteria 3857
84 Ga0495618_0148073 3300046514 Bacteria 1500
85 Ga0495620_0011588 3300046515 Bacteria 4594
86 Ga0495620_0020076 3300046515 Bacteria 3270
87 Ga0495628_0075425 3300046516 Bacteria 2626
88 Ga0495628_0076172 3300046516 Bacteria 2611
89 Ga0495630_0025164 3300046517 Bacteria 4400
90 Ga0495630_0385805 3300046517 Bacteria 1073
91 Ga0495631_0005044 3300046518 Bacteria 6954
92 Ga0495637_0021382 3300046520 Bacteria 2968
93 Ga0495643_0001076 3300046522 Bacteria 27237
94 Ga0495648_0033935 3300046524 Bacteria 3328
95 Ga0495648_0119880 3300046524 Bacteria 1416
96 Ga0495640_0009759 3300046533 Bacteria 7457
97 Ga0495640_0023782 3300046533 Bacteria 4457
98 Ga0495640_0056977 3300046533 Bacteria 2668
99 Ga0495640_0120935 3300046533 Bacteria 1702
100 Ga0495597_0033727 3300046542 Bacteria 2316
101 Ga0495597_0058981 3300046542 Bacteria 1676
102 Ga0495622_0004026 3300046557 Bacteria 6861
103 Ga0495667_0129826 3300046559 Bacteria 1626
104 Ga0495668_0037563 3300046616 Bacteria 2709
105 Ga0495634_0056195 3300046642 Bacteria 2630
106 Ga0495634_0221198 3300046642 Bacteria 1168
107 Ga0495611_0039186 3300046648 Bacteria 2109
108 Ga0495625_0109341 3300046660 Bacteria 1891
109 Ga0495625_0283108 3300046660 Bacteria 1066
110 Ga0495661_0025563 3300046665 Bacteria 3812
111 Ga0495588_0009192 3300046674 Bacteria 4563
112 Ga0495657_0009881 3300046675 Bacteria 7197
113 Ga0495657_0054639 3300046675 Bacteria 2666
114 Ga0495599_0060571 3300046678 Bacteria 2367
115 Ga0495623_0149221 3300046679 Bacteria 1383
116 Ga0495646_0052596 3300046680 Bacteria 2459
117 Ga0495658_0032955 3300046683 Bacteria 2833
118 Ga0495613_0000854 3300046689 Bacteria 23375
119 Ga0495613_0001505 3300046689 Bacteria 17726
120 Ga0495613_0132812 3300046689 Bacteria 1782
121 Ga0495624_0198719 3300046690 Bacteria 1218
122 Ga0495671_0114296 3300046692 Bacteria 1318
123 Ga0495649_0013881 3300046694 Bacteria 4632
124 Ga0495649_0098713 3300046694 Bacteria 1553
125 Ga0495589_0013765 3300046794 Bacteria 4172
126 Ga0495589_0066046 3300046794 Bacteria 1772
127 Ga0495600_0062766 3300046809 Bacteria 2427
128 Ga0495660_0016280 3300046810 Bacteria 4288
129 Ga0495660_0035790 3300046810 Bacteria 2771
130 Ga0495660_0218980 3300046810 Bacteria 898
131 Ga0495581_0062856 3300047315 Bacteria 2145
132 Ga0495604_0000156 3300047317 Bacteria 59760
133 Ga0495604_0012561 3300047317 Bacteria 6734
134 Ga0495604_0134495 3300047317 Bacteria 1773
135 Ga0495604_0134718 3300047317 Bacteria 1771
136 Ga0495674_0094697 3300047319 Bacteria 2547
137 Ga0495676_0000914 3300047321 Bacteria 24698
138 Ga0495676_0004536 3300047321 Bacteria 12702
139 Ga0495676_0005594 3300047321 Bacteria 11534
140 Ga0495676_0075752 3300047321 Bacteria 2571
141 Ga0495676_0229565 3300047321 Bacteria 1275
142 Ga0495687_000786 3300047443 Bacteria 34092
143 Ga0495675_0031165 3300047444 Bacteria 3404
144 Ga0495685_000436 3300047447 Bacteria 13118
145 Ga0495681_0067683 3300047470 Bacteria 1626
146 Ga0495686_0062455 3300047472 Bacteria 2310
147 Ga0495593_0013153 3300047673 Bacteria 4724
148 Ga0495593_0015114 3300047673 Bacteria 4383
149 Ga0495593_0030939 3300047673 Bacteria 2926
150 Ga0495602_0094644 3300048088 Bacteria 2468
151 Ga0495614_0005628 3300048089 Bacteria 5650
152 Ga0495614_0069219 3300048089 Bacteria 1520
153 Ga0495626_0010628 3300048091 Bacteria 4897
154 Ga0496105_0310655 3300048908 Bacteria 1266
155 Ga0496108_0096506 3300048911 Bacteria 2518
156 Ga0496110_0317082 3300048913 Bacteria 1420
157 Ga0496113_0182839 3300048916 Bacteria 1662
158 Ga0495678_052242 3300049459 Bacteria 1574
159 Ga0495682_0043492 3300049460 Bacteria 1645
160 Ga0501031_0002837 3300049568 Bacteria 11058
161 Ga0501031_0043122 3300049568 Bacteria 2945
162 Ga0501031_0138008 3300049568 Bacteria 1593
163 Ga0501032_0001028 3300049569 Bacteria 22406
164 Ga0501032_0008324 3300049569 Bacteria 7557
165 Ga0501032_0014266 3300049569 Bacteria 5629
166 Ga0501033_0005833 3300049570 Bacteria 9685
167 Ga0501033_0014978 3300049570 Bacteria 5884
168 Ga0501033_0109480 3300049570 Bacteria 2011
169 Ga0501033_0282945 3300049570 Bacteria 1170
170 Ga0501034_0002440 3300049571 Bacteria 22430
171 Ga0501034_0144764 3300049571 Bacteria 2354
172 Ga0501034_0360950 3300049571 Bacteria 1380
173 Ga0501036_0001235 3300049572 Bacteria 19526
174 Ga0501036_0006292 3300049572 Bacteria 9635
175 Ga0501036_0050252 3300049572 Bacteria 3531
176 Ga0501036_0067423 3300049572 Bacteria 3027
177 Ga0501036_0117599 3300049572 Bacteria 2245
178 Ga0501037_0001579 3300049573 Bacteria 16609
179 Ga0501037_0048344 3300049573 Bacteria 3118
180 Ga0501037_0079765 3300049573 Bacteria 2376
181 Ga0501037_0099213 3300049573 Bacteria 2103
182 Ga0501038_0014726 3300049574 Bacteria 7125
183 Ga0501038_0065090 3300049574 Bacteria 3107
184 Ga0501038_0147478 3300049574 Bacteria 1920
185 Ga0501039_0031239 3300049575 Bacteria 4105
186 Ga0501040_0065949 3300049576 Bacteria 2494
187 Ga0501041_0014991 3300049577 Bacteria 4602
188 Ga0501042_0230327 3300049578 Bacteria 1336
189 Ga0501043_0004930 3300049579 Bacteria 10789
190 Ga0501043_0075946 3300049579 Bacteria 2639
191 Ga0501043_0111037 3300049579 Bacteria 2152
192 Ga0501043_0152174 3300049579 Bacteria 1810
193 Ga0501046_0081805 3300049580 Bacteria 2494
194 Ga0501046_0284152 3300049580 Bacteria 1211
195 Ga0501047_0001505 3300049581 Bacteria 22718
196 Ga0501047_0001535 3300049581 Bacteria 22575
197 Ga0501047_0015850 3300049581 Bacteria 7180
198 Ga0501047_0019656 3300049581 Bacteria 6481
199 Ga0501047_0023064 3300049581 Bacteria 5974
200 Ga0501047_0117335 3300049581 Bacteria 2543
201 Ga0501047_0204525 3300049581 Bacteria 1834
202 Ga0501047_0210195 3300049581 Bacteria 1804
203 Ga0501048_0142568 3300049582 Bacteria 1694
204 Ga0501048_0306287 3300049582 Bacteria 1130
205 Ga0501048_0397791 3300049582 Bacteria 984
206 Ga0501067_0000305 3300049583 Bacteria 27027
207 Ga0501068_0000535 3300049584 Bacteria 19209
208 Ga0501068_0059686 3300049584 Bacteria 2316
209 Ga0501069_0039989 3300049585 Bacteria 2591
210 Ga0501070_0011877 3300049586 Bacteria 7354
211 Ga0501070_0064264 3300049586 Bacteria 3039
212 Ga0501070_0225188 3300049586 Bacteria 1537
213 Ga0501071_0022907 3300049587 Bacteria 4357
214 Ga0501072_0002943 3300049588 Bacteria 12813
215 Ga0501073_0234454 3300049589 Bacteria 1267
216 Ga0501074_0109893 3300049590 Bacteria 1972
217 Ga0501077_0016547 3300049593 Bacteria 4647
218 Ga0501079_0073776 3300049741 Bacteria 2637
219 Ga0501080_0036332 3300049742 Bacteria 4599
220 Ga0501083_0002731 3300049744 Bacteria 12185
221 Ga0501035_0001601 3300049822 Bacteria 22920
222 Ga0501035_0004506 3300049822 Bacteria 13221
223 Ga0501035_0014133 3300049822 Bacteria 7363
224 Ga0501035_0056984 3300049822 Bacteria 3484
225 Ga0501035_0141727 3300049822 Bacteria 2089
226 Ga0501035_0226825 3300049822 Bacteria 1593
227 Ga0501044_0001539 3300049823 Bacteria 27060
228 Ga0501044_0003691 3300049823 Bacteria 17208
229 Ga0501044_0041121 3300049823 Bacteria 4813
230 Ga0501044_0053715 3300049823 Bacteria 4144
231 Ga0501044_0060042 3300049823 Bacteria 3895
232 Ga0501044_0072693 3300049823 Bacteria 3496
233 Ga0501044_0095059 3300049823 Bacteria 3004
234 Ga0501044_0113358 3300049823 Bacteria 2718
235 Ga0501045_0025245 3300049824 Bacteria 4270
236 Ga0501045_0123182 3300049824 Bacteria 1925
237 Ga0501045_0141227 3300049824 Bacteria 1791
238 nmdc:mga06z11_21024_c1 3300050494 Bacteria 3026
239 Ga0495612_0149786 3300053078 Bacteria 1015
240 Ga0495619_0092145 3300053085 Bacteria 2053
241 Ga0500566_0189998 3300053094 Bacteria 1046
242 Ga0500640_026272 3300053095 Bacteria 2536
243 Ga0500660_083448 3300053100 Bacteria 1454
244 Ga0500553_031967 3300053101 Bacteria 2623
245 Ga0500560_067039 3300053107 Bacteria 1178
246 Ga0500636_0176530 3300053177 Bacteria 1151
247 Ga0500587_008476 3300053739 Bacteria 1321
248 Ga0501084_0002534 3300054114 Bacteria 14727
249 Ga0501082_0028897 3300060353 Bacteria 4776
250 Ga0466962_0002905 3300061719 Bacteria 8164
251 2554258845 2554235005 Bacteria 6457341
252 2585299727 2582581312 Bacteria 7308206
253 2585317965 2582581314 Bacteria 11452267
254 2643759437 2643221548 Bacteria 8053412
255 2643945009 2643221587 Bacteria 7586415
256 2644019060 2643221601 Bacteria 7493239
257 2644180193 2643221631 Bacteria 8168043
258 2644385831 2643221670 Bacteria 6497041
259 2644431908 2643221677 Bacteria 7584031
260 2644435939 2643221678 Bacteria 9540101
261 2644463147 2643221682 Bacteria 6743283
262 2786669131 2786546132 Bacteria 10419719
263 2793984061 2791355406 Bacteria 11364898
264 2808840736 2808606359 Bacteria 9866990
265 2812359445 2811994879 Bacteria 9313447
266 2819743146 2818991472 Bacteria 10089953
267 2852642866 2852635781 Bacteria 8251373
268 2862182791 2862178590 Bacteria 8583590
269 2862295457 2862290372 Bacteria 7471434
270 2862511392 2862507626 Bacteria 9425308
271 2867437384 2867428634 Bacteria 9590268
272 2875393469 2875391855 Bacteria 7600475
273 2877682458 2877676314 Bacteria 9512378
274 2912721486 2912715099 Bacteria 9460473
275 2912725337 2912723979 Bacteria 8557534
276 2918503363 2918501144 Bacteria 8668083
277 2919468285 2919468124 Bacteria 9133025
278 2946066475 2946064051 Bacteria 8957905
279 2947230901 2947224130 Bacteria 9938529
280 2954675429 2954673503 Bacteria 9685905
281 2954688703 2954682443 Bacteria 9862841
282 2954717455 2954711539 Bacteria 10867210
283 2954727418 2954721474 Bacteria 10456478
284 2954734382 2954731030 Bacteria 10243860
285 2954746314 2954740390 Bacteria 10229294
286 2954753265 2954749733 Bacteria 10366972
287 2954765427 2954759201 Bacteria 9358192
288 2966603604 2966598605 Bacteria 7676064
289 2990062528 2990059506 Bacteria 9321252
290 2997606442 2997600082 Bacteria 9896405
291 3006322243 3006321560 Bacteria 8247479
292 3006394870 3006393351 Bacteria 6615579
293 8008579927 8008574985 Bacteria 7815457
294 8047899479 8047893842 Bacteria 11723082
295 8048136108 8048127548 Bacteria 11053136
296 8048359451 8048356638 Bacteria 11044339
297 8048376427 8048369669 Bacteria 11666822
298 8048385481 8048379754 Bacteria 11877923
299 8048408917 8048406513 Bacteria 8936924
300 8054167658 8054160619 Bacteria 7783213
301 8056450406 8056447290 Bacteria 7680491
302 Ga0501046_0019445
303 JGI24740J21852_10033317
304 JGI24739J22299_10042391
305 JGI24737J22298_10020869
306 JGI24735J21928_10044642
307 JGI24738J21930_10013510
308 rootH2_10028175
309 rootH2_10049980
310 Ga0068855_100177958
311 Ga0075367_10013978
312 Ga0105250_10063851
313 Ga0105245_10469482
314 Ga0105247_10346656
315 Ga0105246_10091403
316 Ga0182008_10013528
317 Ga0182006_1108017
318 Ga0182007_10023670
319 Ga0207426_1004660
320 Ga0207667_10364521
321 Ga0307517_10004678
322 Ga0307515_10280434
323 Ga0307512_10008531
324 Ga0307512_10045842
325 Ga0307513_10115795
326 Ga0307509_10202045
327 Ga0307509_10292670
328 Ga0307508_10026421
329 Ga0307508_10054309
330 Ga0307508_10175212
331 Ga0307516_10080553
332 Ga0307516_10168318
333 Ga0307416_100979280
334 Ga0307507_10104471
335 Ga0395898_0017323
336 Ga0436364_0741234
337 Ga0439433_0042893
338 Ga0439448_0024268
339 Ga0439449_0016305
340 Ga0439449_0030935
341 Ga0439455_0013027
342 Ga0450903_001153
343 Ga0450901_001825
344 Ga0450901_013907
345 Ga0466972_0003667
346 Ga0466972_0019041
347 Ga0466965_0000143
348 Ga0466966_0004861
349 Ga0466961_0002053
350 Ga0466963_0001200
351 Ga0466964_0003497
352 Ga0466971_0001073
353 Ga0466970_0002694
354 Ga0466970_0029837
355 Ga0466957_0001219
356 Ga0466960_0000943
357 Ga0466959_0000460
358 Ga0466958_0002206
359 Ga0466967_0007532
360 Ga0466967_0911201
361 Ga0495592_0008891
362 Ga0495603_0000151
363 Ga0495603_0008316
364 Ga0495603_0056368
365 Ga0495590_0100874
366 Ga0495629_0001571
367 Ga0495629_0014829
368 Ga0495629_0018899
369 Ga0495629_0168958
370 Ga0495629_0233526
371 Ga0495651_0002602
372 Ga0495639_0061819
373 Ga0495662_0000830
374 Ga0495662_0034796
375 Ga0495664_0001867
376 Ga0495664_0075534
377 Ga0495585_0047653
378 Ga0495594_0002607
379 Ga0495594_0012986
380 Ga0495594_0158348
381 Ga0495607_0055387
382 Ga0495606_0012225
383 Ga0495616_0074089
384 Ga0495618_0022921
385 Ga0495618_0148073
386 Ga0495620_0011588
387 Ga0495620_0020076
388 Ga0495628_0075425
389 Ga0495628_0076172
390 Ga0495630_0025164
391 Ga0495630_0385805
392 Ga0495631_0005044
393 Ga0495637_0021382
394 Ga0495643_0001076
395 Ga0495648_0033935
396 Ga0495648_0119880
397 Ga0495640_0009759
398 Ga0495640_0023782
399 Ga0495640_0056977
400 Ga0495640_0120935
401 Ga0495597_0033727
402 Ga0495597_0058981
403 Ga0495622_0004026
404 Ga0495667_0129826
405 Ga0495668_0037563
406 Ga0495634_0056195
407 Ga0495634_0221198
408 Ga0495611_0039186
409 Ga0495625_0109341
410 Ga0495625_0283108
411 Ga0495661_0025563
412 Ga0495588_0009192
413 Ga0495657_0009881
414 Ga0495657_0054639
415 Ga0495599_0060571
416 Ga0495623_0149221
417 Ga0495646_0052596
418 Ga0495658_0032955
419 Ga0495613_0000854
420 Ga0495613_0001505
421 Ga0495613_0132812
422 Ga0495624_0198719
423 Ga0495671_0114296
424 Ga0495649_0013881
425 Ga0495649_0098713
426 Ga0495589_0013765
427 Ga0495589_0066046
428 Ga0495600_0062766
429 Ga0495660_0016280
430 Ga0495660_0035790
431 Ga0495660_0218980
432 Ga0495581_0062856
433 Ga0495604_0000156
434 Ga0495604_0012561
435 Ga0495604_0134495
436 Ga0495604_0134718
437 Ga0495674_0094697
438 Ga0495676_0000914
439 Ga0495676_0004536
440 Ga0495676_0005594
441 Ga0495676_0075752
442 Ga0495676_0229565
443 Ga0495687_000786
444 Ga0495675_0031165
445 Ga0495685_000436
446 Ga0495681_0067683
447 Ga0495686_0062455
448 Ga0495593_0013153
449 Ga0495593_0015114
450 Ga0495593_0030939
451 Ga0495602_0094644
452 Ga0495614_0005628
453 Ga0495614_0069219
454 Ga0495626_0010628
455 Ga0496105_0310655
456 Ga0496108_0096506
457 Ga0496110_0317082
458 Ga0496113_0182839
459 Ga0495678_052242
460 Ga0495682_0043492
461 Ga0501031_0002837
462 Ga0501031_0043122
463 Ga0501031_0138008
464 Ga0501032_0001028
465 Ga0501032_0008324
466 Ga0501032_0014266
467 Ga0501033_0005833
468 Ga0501033_0014978
469 Ga0501033_0109480
470 Ga0501033_0282945
471 Ga0501034_0002440
472 Ga0501034_0144764
473 Ga0501034_0360950
474 Ga0501036_0001235
475 Ga0501036_0006292
476 Ga0501036_0050252
477 Ga0501036_0067423
478 Ga0501036_0117599
479 Ga0501037_0001579
480 Ga0501037_0048344
481 Ga0501037_0079765
482 Ga0501037_0099213
483 Ga0501038_0014726
484 Ga0501038_0065090
485 Ga0501038_0147478
486 Ga0501039_0031239
487 Ga0501040_0065949
488 Ga0501041_0014991
489 Ga0501042_0230327
490 Ga0501043_0004930
491 Ga0501043_0075946
492 Ga0501043_0111037
493 Ga0501043_0152174
494 Ga0501046_0081805
495 Ga0501046_0284152
496 Ga0501047_0001505
497 Ga0501047_0001535
498 Ga0501047_0015850
499 Ga0501047_0019656
500 Ga0501047_0023064
501 Ga0501047_0117335
502 Ga0501047_0204525
503 Ga0501047_0210195
504 Ga0501048_0142568
505 Ga0501048_0306287
506 Ga0501048_0397791
507 Ga0501067_0000305
508 Ga0501068_0000535
509 Ga0501068_0059686
510 Ga0501069_0039989
511 Ga0501070_0011877
512 Ga0501070_0064264
513 Ga0501070_0225188
514 Ga0501071_0022907
515 Ga0501072_0002943
516 Ga0501073_0234454
517 Ga0501074_0109893
518 Ga0501077_0016547
519 Ga0501079_0073776
520 Ga0501080_0036332
521 Ga0501083_0002731
522 Ga0501035_0001601
523 Ga0501035_0004506
524 Ga0501035_0014133
525 Ga0501035_0056984
526 Ga0501035_0141727
527 Ga0501035_0226825
528 Ga0501044_0001539
529 Ga0501044_0003691
530 Ga0501044_0041121
531 Ga0501044_0053715
532 Ga0501044_0060042
533 Ga0501044_0072693
534 Ga0501044_0095059
535 Ga0501044_0113358
536 Ga0501045_0025245
537 Ga0501045_0123182
538 Ga0501045_0141227
539 nmdc:mga06z11_21024_c1
540 Ga0495612_0149786
541 Ga0495619_0092145
542 Ga0500566_0189998
543 Ga0500640_026272
544 Ga0500660_083448
545 Ga0500553_031967
546 Ga0500560_067039
547 Ga0500636_0176530
548 Ga0500587_008476
549 Ga0501084_0002534
550 Ga0501082_0028897
551 Ga0466962_0002905
552 2554258845
553 2585299727
554 2585317965
555 2643759437
556 2643945009
557 2644019060
558 2644180193
559 2644385831
560 2644431908
561 2644435939
562 2644463147
563 2786669131
564 2793984061
565 2808840736
566 2812359445
567 2819743146
568 2852642866
569 2862182791
570 2862295457
571 2862511392
572 2867437384
573 2875393469
574 2877682458
575 2912721486
576 2912725337
577 2918503363
578 2919468285
579 2946066475
580 2947230901
581 2954675429
582 2954688703
583 2954717455
584 2954727418
585 2954734382
586 2954746314
587 2954753265
588 2954765427
589 2966603604
590 2990062528
591 2997606442
592 3006322243
593 3006394870
594 8008579927
595 8047899479
596 8048136108
597 8048359451
598 8048376427
599 8048385481
600 8048408917
601 8054167658
602 8056450406

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6job-assembly1.cif.gz_G-2 "ferritin variant with ""gmg"" motif" 0.4056 36 200
3uno-assembly1.cif.gz_B mycobacterium tuberculosis ferritin homolog, bfrb 0.4038 27 197
3uno-assembly1.cif.gz_N mycobacterium tuberculosis ferritin homolog, bfrb 0.4033 27 197
3uno-assembly1.cif.gz_C mycobacterium tuberculosis ferritin homolog, bfrb 0.4032 27 197
3uno-assembly1.cif.gz_F mycobacterium tuberculosis ferritin homolog, bfrb 0.4029 27 197
ID Description Score Start End Superfamily
3unoN00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.4033 27 197 1.20.1260.10
3oj5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3968 36 197 1.20.1260.10
af_P02794_1_183_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3966 36 200 1.20.1260.10
3qd8H00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3868 36 197 1.20.1260.10
3oj5A00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3842 36 197 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A378V1E6-F1-model_v4 Peptidase M50 0.9179 110 245 GO:0016020
AF-A0A7Y5P8D6-F1-model_v4 deleted 0.9134 140 244
AF-A0A378V1E6-F1-model_v4 Peptidase M50 0.893 110 245 GO:0016020
AF-A0A6P0WTQ7-F1-model_v4 Tetratricopeptide repeat protein 0.8841 26 242 GO:0005886
GO:0006508
GO:0008237
GO:0046872
AF-A0A2W1JG26-F1-model_v4 Zinc metalloprotease Rip2 0.8789 28 241 GO:0006508
GO:0008237
GO:0016020

Map