F396162

General Info

Members Datasets Scaffolds Average Seq Length
301 156 602 219

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0766907|Ga0501039_0766907_28_720
Length 230
Sequence VLSGVWAVLVAAGRGERLGEDRPKAFARLGELPLLAEPLRRLDESEWIEAIVLVAPPGWEEPAILLAEEIGASKVSACVPGGETRSESVRAGLAEVPDDAAVVLVHDAARPILPAEIVPRLLEALGEGFDGAVPGLPVADTVKRVRDDVVVETLTRDELVTVQTPQAFVASVLRAAAAGEGSDCASLVEAAGGRVKVVEGDERLLKVTTPADLDRVAAWLEPSSAAPDDR

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
95 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
125 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
126 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
127 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
131 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
132 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
133 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
136 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
141 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
152 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
153 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
154 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
155 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
156 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.35
Metatranscriptomes 3.65
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.31
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 2.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0766907 3300049575 Unclassified 753
2 Ga0070658_10083457 3300005327 Bacteria 2626
3 Ga0070658_10109100 3300005327 Bacteria 2291
4 Ga0070683_100095452 3300005329 Bacteria 2796
5 Ga0070683_100098443 3300005329 Bacteria 2752
6 Ga0070683_100235047 3300005329 Bacteria 1743
7 Ga0070683_100251643 3300005329 Bacteria 1680
8 Ga0070683_100416526 3300005329 Bacteria 1281
9 Ga0070683_100615169 3300005329 Bacteria 1040
10 Ga0070680_100029076 3300005336 Bacteria 4438
11 Ga0070680_100662885 3300005336 Bacteria 897
12 Ga0070682_100413860 3300005337 Unclassified 1023
13 Ga0068868_100129756 3300005338 Bacteria 2062
14 Ga0070660_100055372 3300005339 Bacteria 3064
15 Ga0070660_100164079 3300005339 Bacteria 1791
16 Ga0070660_100528962 3300005339 Bacteria 982
17 Ga0070661_100209546 3300005344 Bacteria 1491
18 Ga0070661_100301496 3300005344 Bacteria 1247
19 Ga0070661_100402497 3300005344 Bacteria 1082
20 Ga0070674_100624099 3300005356 Unclassified 913
21 Ga0070659_100014646 3300005366 Bacteria 5864
22 Ga0070659_100111243 3300005366 Bacteria 2211
23 Ga0070667_100034802 3300005367 Bacteria 4217
24 Ga0070713_100948885 3300005436 Bacteria 828
25 Ga0070708_100643827 3300005445 Bacteria 999
26 Ga0070663_100242853 3300005455 Bacteria 1422
27 Ga0070681_10024280 3300005458 Bacteria 6103
28 Ga0070681_10065375 3300005458 Bacteria 3606
29 Ga0070681_10117935 3300005458 Bacteria 2590
30 Ga0070681_10203319 3300005458 Bacteria 1898
31 Ga0070681_10320181 3300005458 Bacteria 1460
32 Ga0070706_100366183 3300005467 Bacteria 1343
33 Ga0070707_100389957 3300005468 Bacteria 1352
34 Ga0070679_100035635 3300005530 Bacteria 4937
35 Ga0070679_100276371 3300005530 Bacteria 1633
36 Ga0070679_100310934 3300005530 Bacteria 1525
37 Ga0070679_100332588 3300005530 Bacteria 1467
38 Ga0070679_100648256 3300005530 Bacteria 999
39 Ga0070684_100114248 3300005535 Bacteria 2424
40 Ga0070684_100260950 3300005535 Bacteria 1585
41 Ga0070684_100274186 3300005535 Bacteria 1545
42 Ga0070697_100507606 3300005536 Bacteria 1055
43 Ga0068853_100232635 3300005539 Bacteria 1686
44 Ga0068853_100365241 3300005539 Bacteria 1345
45 Ga0070696_100013030 3300005546 Bacteria 5580
46 Ga0070665_100012330 3300005548 Bacteria 8613
47 Ga0068855_100023015 3300005563 Bacteria 7467
48 Ga0068855_100030788 3300005563 Bacteria 6415
49 Ga0068855_100035682 3300005563 Bacteria 5922
50 Ga0068855_100166933 3300005563 Bacteria 2494
51 Ga0068855_100262709 3300005563 Bacteria 1922
52 Ga0068855_100699709 3300005563 Bacteria 1085
53 Ga0068857_100129501 3300005577 Bacteria 2275
54 Ga0068857_100233308 3300005577 Bacteria 1683
55 Ga0068854_100218251 3300005578 Bacteria 1507
56 Ga0068856_100033138 3300005614 Bacteria 5059
57 Ga0068856_100071348 3300005614 Bacteria 3438
58 Ga0068856_100431521 3300005614 Bacteria 1338
59 Ga0068856_100606295 3300005614 Bacteria 1116
60 Ga0068856_100980149 3300005614 Bacteria 864
61 Ga0068852_100001855 3300005616 Bacteria 14367
62 Ga0068852_100171899 3300005616 Bacteria 2032
63 Ga0068864_101203662 3300005618 Bacteria 756
64 Ga0081539_10000068 3300005985 Bacteria 240998
65 Ga0070716_100401184 3300006173 Bacteria 986
66 Ga0075434_100038939 3300006871 Bacteria 4710
67 Ga0075434_100273701 3300006871 Bacteria 1708
68 Ga0075435_100020330 3300007076 Bacteria 5084
69 Ga0105240_10049059 3300009093 Bacteria 5332
70 Ga0105240_10173013 3300009093 Bacteria 2556
71 Ga0105240_10901089 3300009093 Unclassified 951
72 Ga0105245_10205928 3300009098 Bacteria 1891
73 Ga0105241_10311902 3300009174 Bacteria 1353
74 Ga0105242_10608679 3300009176 Bacteria 1056
75 Ga0105248_10141362 3300009177 Bacteria 2715
76 Ga0105238_10159206 3300009551 Bacteria 2233
77 Ga0105238_10745410 3300009551 Bacteria 993
78 Ga0105239_10495584 3300010375 Bacteria 1389
79 Ga0157373_10376103 3300013100 Unclassified 1016
80 Ga0157373_10390975 3300013100 Unclassified 996
81 Ga0157370_10045105 3300013104 Bacteria 4232
82 Ga0157370_10104689 3300013104 Bacteria 2649
83 Ga0157370_10252585 3300013104 Bacteria 1631
84 Ga0157370_10501171 3300013104 Bacteria 1115
85 Ga0157370_10938080 3300013104 Bacteria 785
86 Ga0157369_10002407 3300013105 Bacteria 22492
87 Ga0157369_10004188 3300013105 Bacteria 17087
88 Ga0157369_10070942 3300013105 Bacteria 3742
89 Ga0157374_10377193 3300013296 Bacteria 1412
90 Ga0157372_10013365 3300013307 Bacteria 8765
91 Ga0157372_10186097 3300013307 Bacteria 2405
92 Ga0157372_10411540 3300013307 Bacteria 1576
93 Ga0157375_10054007 3300013308 Bacteria 3955
94 Ga0197907_10597091 3300020069 Bacteria 1372
95 Ga0197907_11015359 3300020069 Bacteria 1293
96 Ga0206356_10114604 3300020070 Bacteria 3012
97 Ga0206356_11071099 3300020070 Bacteria 1398
98 Ga0206354_10021293 3300020081 Bacteria 1305
99 Ga0206354_11184305 3300020081 Bacteria 2928
100 Ga0206353_10354493 3300020082 Bacteria 1155
101 Ga0206353_10670248 3300020082 Bacteria 4377
102 Ga0206353_11049044 3300020082 Bacteria 1416
103 Ga0206353_11400643 3300020082 Bacteria 1201
104 Ga0206353_11831169 3300020082 Bacteria 1518
105 Ga0207699_10063430 3300025906 Bacteria 2232
106 Ga0207705_10026260 3300025909 Bacteria 4154
107 Ga0207705_10355277 3300025909 Bacteria 1129
108 Ga0207707_10032621 3300025912 Bacteria 4558
109 Ga0207707_10065048 3300025912 Bacteria 3176
110 Ga0207707_10430829 3300025912 Bacteria 1130
111 Ga0207695_10199730 3300025913 Bacteria 1914
112 Ga0207695_10283249 3300025913 Bacteria 1551
113 Ga0207671_10107497 3300025914 Bacteria 2119
114 Ga0207693_10394028 3300025915 Bacteria 1083
115 Ga0207660_10004758 3300025917 Bacteria 8839
116 Ga0207657_10002442 3300025919 Bacteria 20076
117 Ga0207657_10440516 3300025919 Bacteria 1023
118 Ga0207649_10024479 3300025920 Bacteria 3509
119 Ga0207649_10078927 3300025920 Bacteria 2125
120 Ga0207649_10265959 3300025920 Bacteria 1241
121 Ga0207649_10463190 3300025920 Bacteria 959
122 Ga0207652_10098443 3300025921 Bacteria 2579
123 Ga0207652_10353125 3300025921 Bacteria 1327
124 Ga0207652_10410872 3300025921 Bacteria 1221
125 Ga0207646_10509571 3300025922 Bacteria 1084
126 Ga0207664_10249396 3300025929 Bacteria 1549
127 Ga0207664_10255184 3300025929 Bacteria 1532
128 Ga0207664_10481565 3300025929 Bacteria 1110
129 Ga0207686_10027485 3300025934 Bacteria 3333
130 Ga0207686_10342256 3300025934 Bacteria 1124
131 Ga0207665_10226194 3300025939 Bacteria 1373
132 Ga0207661_10126191 3300025944 Bacteria 2186
133 Ga0207661_10238607 3300025944 Bacteria 1612
134 Ga0207661_10301206 3300025944 Bacteria 1437
135 Ga0207661_10381671 3300025944 Bacteria 1275
136 Ga0207661_10423822 3300025944 Bacteria 1209
137 Ga0207661_10761777 3300025944 Unclassified 891
138 Ga0207667_10126008 3300025949 Bacteria 2638
139 Ga0207667_10229550 3300025949 Bacteria 1901
140 Ga0207667_10335146 3300025949 Bacteria 1544
141 Ga0207667_10681736 3300025949 Bacteria 1031
142 Ga0207640_10539126 3300025981 Bacteria 978
143 Ga0207658_10004184 3300025986 Bacteria 10055
144 Ga0207639_10224636 3300026041 Bacteria 1624
145 Ga0207678_10061736 3300026067 Bacteria 3223
146 Ga0207702_10069309 3300026078 Bacteria 3032
147 Ga0207702_11145680 3300026078 Bacteria 772
148 Ga0207674_10236787 3300026116 Bacteria 1773
149 Ga0207683_10096385 3300026121 Bacteria 2638
150 Ga0207698_10033051 3300026142 Bacteria 3755
151 Ga0207698_10485649 3300026142 Bacteria 1199
152 Ga0268266_10042048 3300028379 Bacteria 3902
153 Ga0265338_10012196 3300028800 Bacteria 9817
154 Ga0265338_10190347 3300028800 Bacteria 1556
155 Ga0265327_10033237 3300031251 Bacteria 2877
156 Ga0265327_10077636 3300031251 Bacteria 1647
157 Ga0307409_100083060 3300031995 Bacteria 2596
158 Ga0307416_100140934 3300032002 Bacteria 2191
159 Ga0373936_0004050 3300035113 Bacteria 5522
160 Ga0373945_0005311 3300035116 Bacteria 4122
161 Ga0373943_0001623 3300035170 Bacteria 10198
162 Ga0373943_0056393 3300035170 Bacteria 1949
163 Ga0373935_0090053 3300035692 Bacteria 2007
164 Ga0373927_0147543 3300035695 Bacteria 1540
165 Ga0373927_0404754 3300035695 Bacteria 900
166 Ga0373947_0007753 3300035725 Bacteria 6202
167 Ga0373947_0024826 3300035725 Bacteria 3495
168 Ga0373937_0097397 3300036401 Bacteria 2728
169 Ga0373937_0117809 3300036401 Bacteria 2474
170 Ga0373925_0005348 3300037068 Bacteria 9578
171 Ga0373925_0223011 3300037068 Bacteria 1505
172 Ga0395899_0126451 3300037312 Bacteria 1828
173 Ga0395900_0228564 3300037418 Bacteria 1872
174 Ga0395900_0249672 3300037418 Bacteria 1776
175 Ga0395900_0296263 3300037418 Bacteria 1605
176 Ga0395900_0339626 3300037418 Bacteria 1478
177 Ga0395900_0729889 3300037418 Bacteria 922
178 Ga0395898_0070374 3300037466 Bacteria 3382
179 Ga0395898_0128291 3300037466 Bacteria 2430
180 Ga0395898_0206792 3300037466 Bacteria 1873
181 Ga0395898_0602994 3300037466 Bacteria 1041
182 Ga0395905_0033636 3300037471 Bacteria 4814
183 Ga0395905_0130383 3300037471 Bacteria 2365
184 Ga0395905_0200720 3300037471 Bacteria 1870
185 Ga0395905_0540600 3300037471 Bacteria 1066
186 Ga0395901_0009011 3300038443 Bacteria 10105
187 Ga0395901_0048535 3300038443 Bacteria 4409
188 Ga0395901_0089459 3300038443 Bacteria 3222
189 Ga0395901_0306508 3300038443 Bacteria 1645
190 Ga0395901_0653918 3300038443 Bacteria 1054
191 Ga0436365_0055585 3300039437 Bacteria 1120
192 Ga0436360_0425115 3300039438 Bacteria 6793
193 Ga0436362_0114581 3300039453 Bacteria 1042
194 Ga0436362_0838091 3300039453 Bacteria 1526
195 Ga0466961_0066700 3300044693 Bacteria 2286
196 Ga0466961_0097657 3300044693 Bacteria 1852
197 Ga0466961_0101293 3300044693 Bacteria 1814
198 Ga0466961_0216420 3300044693 Bacteria 1181
199 Ga0466963_0021554 3300044694 Bacteria 4067
200 Ga0466963_0223095 3300044694 Bacteria 1320
201 Ga0466968_0004108 3300044735 Bacteria 5421
202 Ga0466970_0253245 3300044765 Bacteria 987
203 Ga0466957_0056814 3300044842 Bacteria 2394
204 Ga0466957_0063998 3300044842 Bacteria 2262
205 Ga0466957_0153601 3300044842 Bacteria 1490
206 Ga0466957_0402495 3300044842 Bacteria 936
207 Ga0466959_0001267 3300045049 Bacteria 15270
208 Ga0466959_0047430 3300045049 Bacteria 3160
209 Ga0466959_0119899 3300045049 Bacteria 1871
210 Ga0466958_0008418 3300045836 Bacteria 5720
211 Ga0466958_0162969 3300045836 Bacteria 1409
212 Ga0466958_0405437 3300045836 Bacteria 880
213 Ga0466967_0008240 3300045976 Bacteria 7614
214 Ga0466967_0033431 3300045976 Bacteria 4353
215 Ga0466967_0047157 3300045976 Bacteria 3755
216 Ga0466967_0117143 3300045976 Bacteria 2455
217 Ga0466967_0126246 3300045976 Bacteria 2370
218 Ga0466967_0129123 3300045976 Bacteria 2344
219 Ga0466967_0210859 3300045976 Bacteria 1842
220 Ga0466967_0504077 3300045976 Bacteria 1188
221 Ga0466967_0663696 3300045976 Bacteria 1032
222 Ga0466967_0989955 3300045976 Bacteria 837
223 Ga0466967_0999467 3300045976 Bacteria 833
224 Ga0495592_0081738 3300046454 Bacteria 2336
225 Ga0495603_0081656 3300046455 Bacteria 1894
226 Ga0495641_0019711 3300046461 Bacteria 3442
227 Ga0495641_0081158 3300046461 Bacteria 1453
228 Ga0495651_0025075 3300046462 Bacteria 4640
229 Ga0495651_0138265 3300046462 Bacteria 1770
230 Ga0495653_0062860 3300046463 Bacteria 2804
231 Ga0495584_0214009 3300046491 Bacteria 980
232 Ga0495608_0178308 3300046511 Bacteria 1345
233 Ga0495618_0207257 3300046514 Bacteria 1240
234 Ga0495628_0098349 3300046516 Bacteria 2260
235 Ga0495628_0262733 3300046516 Bacteria 1286
236 Ga0495630_0079749 3300046517 Bacteria 2469
237 Ga0495652_0131971 3300046529 Bacteria 1976
238 Ga0495665_0133534 3300046531 Bacteria 1299
239 Ga0495667_0010939 3300046559 Bacteria 6132
240 Ga0495634_0056211 3300046642 Bacteria 2630
241 Ga0495659_0011492 3300046664 Bacteria 2853
242 Ga0495658_0045332 3300046683 Bacteria 2468
243 Ga0495581_0131554 3300047315 Bacteria 1458
244 Ga0495581_0166148 3300047315 Bacteria 1290
245 Ga0495604_0051995 3300047317 Bacteria 3174
246 Ga0495604_0351400 3300047317 Bacteria 979
247 Ga0495680_0006237 3300047322 Bacteria 11118
248 Ga0495675_0212433 3300047444 Bacteria 1174
249 Ga0495602_0121644 3300048088 Bacteria 2099
250 Ga0496100_0012268 3300048903 Bacteria 4907
251 Ga0496100_0014383 3300048903 Bacteria 4594
252 Ga0496100_0025965 3300048903 Bacteria 3587
253 Ga0496100_0114258 3300048903 Bacteria 1880
254 Ga0496101_0009869 3300048904 Bacteria 6289
255 Ga0496101_0011786 3300048904 Bacteria 5814
256 Ga0496101_0028009 3300048904 Bacteria 3931
257 Ga0496102_0817157 3300048905 Unclassified 854
258 Ga0496102_0934006 3300048905 Bacteria 789
259 Ga0496104_0022916 3300048907 Bacteria 5738
260 Ga0496104_0511288 3300048907 Unclassified 1112
261 Ga0496105_0044911 3300048908 Bacteria 3645
262 Ga0496106_0022269 3300048909 Bacteria 4707
263 Ga0496106_0140181 3300048909 Bacteria 1901
264 Ga0496107_0015659 3300048910 Bacteria 5316
265 Ga0496107_0068847 3300048910 Bacteria 2568
266 Ga0496108_0402831 3300048911 Bacteria 1195
267 Ga0496109_0209164 3300048912 Bacteria 1835
268 Ga0496112_0022302 3300048915 Bacteria 6033
269 Ga0496112_0114558 3300048915 Bacteria 2666
270 Ga0496112_0135890 3300048915 Bacteria 2429
271 Ga0496114_0062267 3300048917 Bacteria 3122
272 Ga0496114_0089165 3300048917 Bacteria 2617
273 Ga0496114_0174773 3300048917 Bacteria 1873
274 Ga0496115_0357783 3300048918 Bacteria 1190
275 Ga0501033_0500424 3300049570 Bacteria 841
276 Ga0501034_0141022 3300049571 Bacteria 2390
277 Ga0501047_0040560 3300049581 Bacteria 4502
278 Ga0501047_0108676 3300049581 Bacteria 2656
279 Ga0501069_0057308 3300049585 Bacteria 2171
280 Ga0501070_0070528 3300049586 Bacteria 2893
281 Ga0501070_0201335 3300049586 Bacteria 1635
282 Ga0501070_0225548 3300049586 Bacteria 1536
283 Ga0501077_0004819 3300049593 Bacteria 8200
284 Ga0501079_0194995 3300049741 Bacteria 1581
285 Ga0501080_0004809 3300049742 Bacteria 12044
286 Ga0501080_0021254 3300049742 Bacteria 6006
287 Ga0501080_0504092 3300049742 Bacteria 1081
288 Ga0501035_0237936 3300049822 Bacteria 1550
289 Ga0501044_0352218 3300049823 Bacteria 1392
290 nmdc:mga0n895_43401_c1 3300050512 Bacteria 4381
291 nmdc:mga0n895_603022_c1 3300050512 Bacteria 1100
292 nmdc:mga0rr50_368110_c1 3300050513 Bacteria 1211
293 nmdc:mga08x19_450972_c1 3300050514 Bacteria 905
294 nmdc:mga0a205_31815_c1 3300050515 Bacteria 5057
295 Ga0495601_0055804 3300053077 Bacteria 2501
296 Ga0495612_0051477 3300053078 Bacteria 1692
297 Ga0495655_0012719 3300053083 Bacteria 1722
298 Ga0501082_0431376 3300060353 Bacteria 1151
299 Ga0466962_0127692 3300061719 Bacteria 1228
300 Ga0530510_0074612 3300061734 Bacteria 2463
301 Ga0530510_0562819 3300061734 Bacteria 866
302 Ga0501039_0766907
303 Ga0070658_10083457
304 Ga0070658_10109100
305 Ga0070683_100095452
306 Ga0070683_100098443
307 Ga0070683_100235047
308 Ga0070683_100251643
309 Ga0070683_100416526
310 Ga0070683_100615169
311 Ga0070680_100029076
312 Ga0070680_100662885
313 Ga0070682_100413860
314 Ga0068868_100129756
315 Ga0070660_100055372
316 Ga0070660_100164079
317 Ga0070660_100528962
318 Ga0070661_100209546
319 Ga0070661_100301496
320 Ga0070661_100402497
321 Ga0070674_100624099
322 Ga0070659_100014646
323 Ga0070659_100111243
324 Ga0070667_100034802
325 Ga0070713_100948885
326 Ga0070708_100643827
327 Ga0070663_100242853
328 Ga0070681_10024280
329 Ga0070681_10065375
330 Ga0070681_10117935
331 Ga0070681_10203319
332 Ga0070681_10320181
333 Ga0070706_100366183
334 Ga0070707_100389957
335 Ga0070679_100035635
336 Ga0070679_100276371
337 Ga0070679_100310934
338 Ga0070679_100332588
339 Ga0070679_100648256
340 Ga0070684_100114248
341 Ga0070684_100260950
342 Ga0070684_100274186
343 Ga0070697_100507606
344 Ga0068853_100232635
345 Ga0068853_100365241
346 Ga0070696_100013030
347 Ga0070665_100012330
348 Ga0068855_100023015
349 Ga0068855_100030788
350 Ga0068855_100035682
351 Ga0068855_100166933
352 Ga0068855_100262709
353 Ga0068855_100699709
354 Ga0068857_100129501
355 Ga0068857_100233308
356 Ga0068854_100218251
357 Ga0068856_100033138
358 Ga0068856_100071348
359 Ga0068856_100431521
360 Ga0068856_100606295
361 Ga0068856_100980149
362 Ga0068852_100001855
363 Ga0068852_100171899
364 Ga0068864_101203662
365 Ga0081539_10000068
366 Ga0070716_100401184
367 Ga0075434_100038939
368 Ga0075434_100273701
369 Ga0075435_100020330
370 Ga0105240_10049059
371 Ga0105240_10173013
372 Ga0105240_10901089
373 Ga0105245_10205928
374 Ga0105241_10311902
375 Ga0105242_10608679
376 Ga0105248_10141362
377 Ga0105238_10159206
378 Ga0105238_10745410
379 Ga0105239_10495584
380 Ga0157373_10376103
381 Ga0157373_10390975
382 Ga0157370_10045105
383 Ga0157370_10104689
384 Ga0157370_10252585
385 Ga0157370_10501171
386 Ga0157370_10938080
387 Ga0157369_10002407
388 Ga0157369_10004188
389 Ga0157369_10070942
390 Ga0157374_10377193
391 Ga0157372_10013365
392 Ga0157372_10186097
393 Ga0157372_10411540
394 Ga0157375_10054007
395 Ga0197907_10597091
396 Ga0197907_11015359
397 Ga0206356_10114604
398 Ga0206356_11071099
399 Ga0206354_10021293
400 Ga0206354_11184305
401 Ga0206353_10354493
402 Ga0206353_10670248
403 Ga0206353_11049044
404 Ga0206353_11400643
405 Ga0206353_11831169
406 Ga0207699_10063430
407 Ga0207705_10026260
408 Ga0207705_10355277
409 Ga0207707_10032621
410 Ga0207707_10065048
411 Ga0207707_10430829
412 Ga0207695_10199730
413 Ga0207695_10283249
414 Ga0207671_10107497
415 Ga0207693_10394028
416 Ga0207660_10004758
417 Ga0207657_10002442
418 Ga0207657_10440516
419 Ga0207649_10024479
420 Ga0207649_10078927
421 Ga0207649_10265959
422 Ga0207649_10463190
423 Ga0207652_10098443
424 Ga0207652_10353125
425 Ga0207652_10410872
426 Ga0207646_10509571
427 Ga0207664_10249396
428 Ga0207664_10255184
429 Ga0207664_10481565
430 Ga0207686_10027485
431 Ga0207686_10342256
432 Ga0207665_10226194
433 Ga0207661_10126191
434 Ga0207661_10238607
435 Ga0207661_10301206
436 Ga0207661_10381671
437 Ga0207661_10423822
438 Ga0207661_10761777
439 Ga0207667_10126008
440 Ga0207667_10229550
441 Ga0207667_10335146
442 Ga0207667_10681736
443 Ga0207640_10539126
444 Ga0207658_10004184
445 Ga0207639_10224636
446 Ga0207678_10061736
447 Ga0207702_10069309
448 Ga0207702_11145680
449 Ga0207674_10236787
450 Ga0207683_10096385
451 Ga0207698_10033051
452 Ga0207698_10485649
453 Ga0268266_10042048
454 Ga0265338_10012196
455 Ga0265338_10190347
456 Ga0265327_10033237
457 Ga0265327_10077636
458 Ga0307409_100083060
459 Ga0307416_100140934
460 Ga0373936_0004050
461 Ga0373945_0005311
462 Ga0373943_0001623
463 Ga0373943_0056393
464 Ga0373935_0090053
465 Ga0373927_0147543
466 Ga0373927_0404754
467 Ga0373947_0007753
468 Ga0373947_0024826
469 Ga0373937_0097397
470 Ga0373937_0117809
471 Ga0373925_0005348
472 Ga0373925_0223011
473 Ga0395899_0126451
474 Ga0395900_0228564
475 Ga0395900_0249672
476 Ga0395900_0296263
477 Ga0395900_0339626
478 Ga0395900_0729889
479 Ga0395898_0070374
480 Ga0395898_0128291
481 Ga0395898_0206792
482 Ga0395898_0602994
483 Ga0395905_0033636
484 Ga0395905_0130383
485 Ga0395905_0200720
486 Ga0395905_0540600
487 Ga0395901_0009011
488 Ga0395901_0048535
489 Ga0395901_0089459
490 Ga0395901_0306508
491 Ga0395901_0653918
492 Ga0436365_0055585
493 Ga0436360_0425115
494 Ga0436362_0114581
495 Ga0436362_0838091
496 Ga0466961_0066700
497 Ga0466961_0097657
498 Ga0466961_0101293
499 Ga0466961_0216420
500 Ga0466963_0021554
501 Ga0466963_0223095
502 Ga0466968_0004108
503 Ga0466970_0253245
504 Ga0466957_0056814
505 Ga0466957_0063998
506 Ga0466957_0153601
507 Ga0466957_0402495
508 Ga0466959_0001267
509 Ga0466959_0047430
510 Ga0466959_0119899
511 Ga0466958_0008418
512 Ga0466958_0162969
513 Ga0466958_0405437
514 Ga0466967_0008240
515 Ga0466967_0033431
516 Ga0466967_0047157
517 Ga0466967_0117143
518 Ga0466967_0126246
519 Ga0466967_0129123
520 Ga0466967_0210859
521 Ga0466967_0504077
522 Ga0466967_0663696
523 Ga0466967_0989955
524 Ga0466967_0999467
525 Ga0495592_0081738
526 Ga0495603_0081656
527 Ga0495641_0019711
528 Ga0495641_0081158
529 Ga0495651_0025075
530 Ga0495651_0138265
531 Ga0495653_0062860
532 Ga0495584_0214009
533 Ga0495608_0178308
534 Ga0495618_0207257
535 Ga0495628_0098349
536 Ga0495628_0262733
537 Ga0495630_0079749
538 Ga0495652_0131971
539 Ga0495665_0133534
540 Ga0495667_0010939
541 Ga0495634_0056211
542 Ga0495659_0011492
543 Ga0495658_0045332
544 Ga0495581_0131554
545 Ga0495581_0166148
546 Ga0495604_0051995
547 Ga0495604_0351400
548 Ga0495680_0006237
549 Ga0495675_0212433
550 Ga0495602_0121644
551 Ga0496100_0012268
552 Ga0496100_0014383
553 Ga0496100_0025965
554 Ga0496100_0114258
555 Ga0496101_0009869
556 Ga0496101_0011786
557 Ga0496101_0028009
558 Ga0496102_0817157
559 Ga0496102_0934006
560 Ga0496104_0022916
561 Ga0496104_0511288
562 Ga0496105_0044911
563 Ga0496106_0022269
564 Ga0496106_0140181
565 Ga0496107_0015659
566 Ga0496107_0068847
567 Ga0496108_0402831
568 Ga0496109_0209164
569 Ga0496112_0022302
570 Ga0496112_0114558
571 Ga0496112_0135890
572 Ga0496114_0062267
573 Ga0496114_0089165
574 Ga0496114_0174773
575 Ga0496115_0357783
576 Ga0501033_0500424
577 Ga0501034_0141022
578 Ga0501047_0040560
579 Ga0501047_0108676
580 Ga0501069_0057308
581 Ga0501070_0070528
582 Ga0501070_0201335
583 Ga0501070_0225548
584 Ga0501077_0004819
585 Ga0501079_0194995
586 Ga0501080_0004809
587 Ga0501080_0021254
588 Ga0501080_0504092
589 Ga0501035_0237936
590 Ga0501044_0352218
591 nmdc:mga0n895_43401_c1
592 nmdc:mga0n895_603022_c1
593 nmdc:mga0rr50_368110_c1
594 nmdc:mga08x19_450972_c1
595 nmdc:mga0a205_31815_c1
596 Ga0495601_0055804
597 Ga0495612_0051477
598 Ga0495655_0012719
599 Ga0501082_0431376
600 Ga0466962_0127692
601 Ga0530510_0074612
602 Ga0530510_0562819

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01128

IspD

2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

5

222

0.92

PF12804

NTP_transf_3

MobA-like NTP transferase domain

7

142

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3okr-assembly1.cif.gz_A structure of mtb apo 2-c-methyl-d-erythritol 4-phosphate cytidyltransferase (ispd) 0.9101 3 187
7kmw-assembly3.cif.gz_C crystal structure of ispd from mycobacterium paratuberculosis 0.9069 2 188
2xwn-assembly1.cif.gz_A crystal structure of ispd from mycobacterium tuberculosis in complex with ctp and mg 0.9039 2 189
2vsh-assembly1.cif.gz_B synthesis of cdp-activated ribitol for teichoic acid precursors in streptococcus pneumoniae 0.9035 2 189
2xwm-assembly1.cif.gz_A crystal structure of ispd from mycobacterium smegmatis in complex with cmp 0.9034 2 188
ID Description Score Start End Superfamily
3okrA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9101 3 187 3.90.550.10
af_B4FP01_68_298_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8946 2 189 3.90.550.10
3f1cA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.889 2 187 3.90.550.10
af_A0JPF9_66_301_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8863 2 188 3.90.550.10
af_B4FP01_68_298_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8857 2 189 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7W1JGG3-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) 0.9804 2 188 GO:0019288
GO:0050518
AF-A0A847MR77-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.9701 48 188 GO:0008299
GO:0050518
AF-A0A538DUW3-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) 0.9667 2 189 GO:0019288
GO:0050518
AF-A0A0E2VMH1-F1-model_v4 deleted 0.9667 2 186
AF-A0A538GTU9-F1-model_v4 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 0.966 11 188 GO:0008299
GO:0050518

Map