F396157
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 193 | 602 | 274 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0007941|Ga0501032_0007941_5242_6285 |
| Length | 327 |
| Sequence | LPEGHTLHRLAAAYRERFAGRPVRVTSPQGGFAAAAALLDGTVLRDSEAHGKHLFLGFGGAPESGAPEGSGGPEHYVHVHLGLFGKVAFEERGDPGTVRLRIATGGPDSPDGGPHQSPAVLADLRGPAACELLTPAEADAVHDRLGPDPLRPADTGDAAWQRISRSRSGLAVLLMDQKVVSGVGNIYRAEVLFRHGIDPHRPGRDLTRPEWDAVWADLRDLMREGVRTGRIDTVRPEHTPEAMGRPPRVDGHGGEVYVYRRAGQPCLVCGTEVRTADLAARNLFWCPGCQAPSSGPAAAGRLPAQKPKGSQGATSQPNAAPSETQPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 8 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 11 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 12 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 13 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 14 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 15 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 16 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 17 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 18 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 19 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 20 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 23 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 27 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 28 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 29 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 30 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 31 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 32 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 33 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 34 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 35 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 36 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 37 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 38 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 39 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 40 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 41 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 42 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 43 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 44 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 45 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 46 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 47 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 48 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 49 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 50 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 51 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 52 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 53 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 54 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 55 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 56 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 57 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 58 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 59 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 60 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 61 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 62 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 63 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 95 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 96 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 97 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 98 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 99 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 100 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 101 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 102 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 103 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 104 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 105 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 106 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 107 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 108 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 109 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 111 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 113 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 114 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 122 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 126 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 130 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 131 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 135 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 136 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 137 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 138 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 141 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 142 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 143 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 144 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 145 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 146 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 147 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 148 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 149 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 150 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 151 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 152 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 153 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 154 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 155 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 156 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 157 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 158 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 159 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 160 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 161 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 162 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 163 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 164 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 165 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 166 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 167 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 168 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 169 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 170 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 171 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 172 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 173 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 174 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 175 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 176 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 177 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 178 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 179 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 180 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 181 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 182 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 183 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 184 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 185 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 186 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 187 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 188 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 189 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 190 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 191 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 192 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 193 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.05 |
| Metatranscriptomes | 0.33 |
| Isolates | 13.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.98 |
| Nodule | 2.33 |
| Rhizoplane | 6.31 |
| Rhizosphere | 66.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501032_0007941 | 3300049569 | Bacteria | 7729 |
| 2 | Ga0070668_100000709 | 3300005347 | Bacteria | 22813 |
| 3 | Ga0070659_100138118 | 3300005366 | Bacteria | 1983 |
| 4 | Ga0070714_100008552 | 3300005435 | Bacteria | 8003 |
| 5 | Ga0070713_100014746 | 3300005436 | Bacteria | 5814 |
| 6 | Ga0070663_100502564 | 3300005455 | Bacteria | 1007 |
| 7 | Ga0068853_100006559 | 3300005539 | Bacteria | 9268 |
| 8 | Ga0070665_100002481 | 3300005548 | Bacteria | 20316 |
| 9 | Ga0070665_100025085 | 3300005548 | Bacteria | 6009 |
| 10 | Ga0070664_100037944 | 3300005564 | Bacteria | 4053 |
| 11 | Ga0075365_10039523 | 3300006038 | Bacteria | 3072 |
| 12 | Ga0075365_10197607 | 3300006038 | Bacteria | 1408 |
| 13 | Ga0075367_10098438 | 3300006178 | Bacteria | 1786 |
| 14 | Ga0075431_100207994 | 3300006847 | Bacteria | 2000 |
| 15 | Ga0105248_10000138 | 3300009177 | Bacteria | 84478 |
| 16 | Ga0157372_10092553 | 3300013307 | Bacteria | 3439 |
| 17 | Ga0206353_12036625 | 3300020082 | Bacteria | 4526 |
| 18 | Ga0209758_1012160 | 3300025297 | Bacteria | 4857 |
| 19 | Ga0207426_1003154 | 3300025302 | Bacteria | 9351 |
| 20 | Ga0207659_10482424 | 3300025926 | Bacteria | 1048 |
| 21 | Ga0207700_10029642 | 3300025928 | Bacteria | 3864 |
| 22 | Ga0207664_10014631 | 3300025929 | Bacteria | 5675 |
| 23 | Ga0207711_10000198 | 3300025941 | Bacteria | 64434 |
| 24 | Ga0207668_10009581 | 3300025972 | Bacteria | 5813 |
| 25 | Ga0207678_10036425 | 3300026067 | Bacteria | 4283 |
| 26 | Ga0207678_10338950 | 3300026067 | Bacteria | 1295 |
| 27 | Ga0207698_10112336 | 3300026142 | Bacteria | 2287 |
| 28 | Ga0268266_10001392 | 3300028379 | Bacteria | 28952 |
| 29 | Ga0307517_10003800 | 3300028786 | Bacteria | 23438 |
| 30 | Ga0307517_10018307 | 3300028786 | Bacteria | 9067 |
| 31 | Ga0307515_10002026 | 3300028794 | Bacteria | 44830 |
| 32 | Ga0307515_10228112 | 3300028794 | Bacteria | 1662 |
| 33 | Ga0307511_10001267 | 3300030521 | Bacteria | 26758 |
| 34 | Ga0307511_10044368 | 3300030521 | Bacteria | 3695 |
| 35 | Ga0307511_10197304 | 3300030521 | Bacteria | 1052 |
| 36 | Ga0307512_10177855 | 3300030522 | Bacteria | 1203 |
| 37 | Ga0307509_10008457 | 3300031507 | Bacteria | 13110 |
| 38 | Ga0307508_10005831 | 3300031616 | Bacteria | 11637 |
| 39 | Ga0307508_10056008 | 3300031616 | Bacteria | 3492 |
| 40 | Ga0307508_10159716 | 3300031616 | Bacteria | 1857 |
| 41 | Ga0307514_10014502 | 3300031649 | Bacteria | 6521 |
| 42 | Ga0307514_10039779 | 3300031649 | Bacteria | 3712 |
| 43 | Ga0307514_10132056 | 3300031649 | Bacteria | 1717 |
| 44 | Ga0307516_10052872 | 3300031730 | Bacteria | 3975 |
| 45 | Ga0307516_10120977 | 3300031730 | Bacteria | 2408 |
| 46 | Ga0307518_10071937 | 3300031838 | Bacteria | 2504 |
| 47 | Ga0307416_100073304 | 3300032002 | Bacteria | 2854 |
| 48 | Ga0307507_10023435 | 3300033179 | Bacteria | 6776 |
| 49 | Ga0307507_10159003 | 3300033179 | Bacteria | 1675 |
| 50 | Ga0307507_10228161 | 3300033179 | Bacteria | 1239 |
| 51 | Ga0307510_10036555 | 3300033180 | Bacteria | 5464 |
| 52 | Ga0307510_10073478 | 3300033180 | Bacteria | 3387 |
| 53 | Ga0307510_10091328 | 3300033180 | Bacteria | 2887 |
| 54 | Ga0316584_0298138 | 3300036712 | Bacteria | 1168 |
| 55 | Ga0395898_0108694 | 3300037466 | Bacteria | 2659 |
| 56 | Ga0395898_0316875 | 3300037466 | Bacteria | 1488 |
| 57 | Ga0395905_0411419 | 3300037471 | Bacteria | 1248 |
| 58 | Ga0395905_0555930 | 3300037471 | Bacteria | 1049 |
| 59 | Ga0436364_1279794 | 3300037853 | Bacteria | 2318 |
| 60 | Ga0395901_0330076 | 3300038443 | Bacteria | 1577 |
| 61 | Ga0436365_0158159 | 3300039437 | Bacteria | 1150 |
| 62 | Ga0466972_0003162 | 3300044658 | Bacteria | 8177 |
| 63 | Ga0466965_0036382 | 3300044683 | Bacteria | 2415 |
| 64 | Ga0466965_0143156 | 3300044683 | Bacteria | 1246 |
| 65 | Ga0466966_0010729 | 3300044684 | Bacteria | 6091 |
| 66 | Ga0466961_0045209 | 3300044693 | Bacteria | 2817 |
| 67 | Ga0466961_0126675 | 3300044693 | Bacteria | 1602 |
| 68 | Ga0466961_0200403 | 3300044693 | Bacteria | 1235 |
| 69 | Ga0466963_0031382 | 3300044694 | Bacteria | 3435 |
| 70 | Ga0466963_0062253 | 3300044694 | Bacteria | 2496 |
| 71 | Ga0466964_0047672 | 3300044706 | Bacteria | 1749 |
| 72 | Ga0466964_0065130 | 3300044706 | Bacteria | 1526 |
| 73 | Ga0466971_0019236 | 3300044719 | Bacteria | 3031 |
| 74 | Ga0466971_0031965 | 3300044719 | Bacteria | 2358 |
| 75 | Ga0466971_0059303 | 3300044719 | Bacteria | 1728 |
| 76 | Ga0466970_0006321 | 3300044765 | Bacteria | 5915 |
| 77 | Ga0466970_0010325 | 3300044765 | Bacteria | 4738 |
| 78 | Ga0466970_0038893 | 3300044765 | Bacteria | 2524 |
| 79 | Ga0466970_0070002 | 3300044765 | Bacteria | 1886 |
| 80 | Ga0466957_0047439 | 3300044842 | Bacteria | 2610 |
| 81 | Ga0466957_0139296 | 3300044842 | Bacteria | 1562 |
| 82 | Ga0466957_0193400 | 3300044842 | Bacteria | 1334 |
| 83 | Ga0466959_0038264 | 3300045049 | Bacteria | 3545 |
| 84 | Ga0466958_0042295 | 3300045836 | Bacteria | 2744 |
| 85 | Ga0466967_0002449 | 3300045976 | Bacteria | 11556 |
| 86 | Ga0466967_0016042 | 3300045976 | Bacteria | 5893 |
| 87 | Ga0466967_0112744 | 3300045976 | Bacteria | 2500 |
| 88 | Ga0466967_0178525 | 3300045976 | Bacteria | 2001 |
| 89 | Ga0466967_0178848 | 3300045976 | Bacteria | 2000 |
| 90 | Ga0466967_0532347 | 3300045976 | Bacteria | 1155 |
| 91 | Ga0466967_0897366 | 3300045976 | Bacteria | 881 |
| 92 | Ga0495592_0015988 | 3300046454 | Bacteria | 5692 |
| 93 | Ga0495592_0025554 | 3300046454 | Bacteria | 4482 |
| 94 | Ga0495603_0000262 | 3300046455 | Bacteria | 27718 |
| 95 | Ga0495603_0007519 | 3300046455 | Bacteria | 6551 |
| 96 | Ga0495629_0000568 | 3300046459 | Bacteria | 29992 |
| 97 | Ga0495629_0006885 | 3300046459 | Bacteria | 8389 |
| 98 | Ga0495629_0020591 | 3300046459 | Bacteria | 4710 |
| 99 | Ga0495629_0030504 | 3300046459 | Bacteria | 3821 |
| 100 | Ga0495629_0044422 | 3300046459 | Bacteria | 3118 |
| 101 | Ga0495638_0052045 | 3300046460 | Bacteria | 2552 |
| 102 | Ga0495638_0206321 | 3300046460 | Bacteria | 1106 |
| 103 | Ga0495638_0261995 | 3300046460 | Bacteria | 948 |
| 104 | Ga0495664_0275630 | 3300046477 | Bacteria | 1016 |
| 105 | Ga0495594_0000586 | 3300046499 | Bacteria | 18751 |
| 106 | Ga0495594_0060770 | 3300046499 | Bacteria | 2090 |
| 107 | Ga0495594_0144954 | 3300046499 | Bacteria | 1347 |
| 108 | Ga0495628_0335132 | 3300046516 | Bacteria | 1114 |
| 109 | Ga0495632_0006703 | 3300046519 | Bacteria | 7362 |
| 110 | Ga0495643_0005069 | 3300046522 | Bacteria | 9014 |
| 111 | Ga0495666_0133420 | 3300046526 | Bacteria | 1160 |
| 112 | Ga0495652_0141907 | 3300046529 | Bacteria | 1888 |
| 113 | Ga0495640_0003552 | 3300046533 | Bacteria | 12522 |
| 114 | Ga0495597_0146575 | 3300046542 | Bacteria | 971 |
| 115 | Ga0495622_0036583 | 3300046557 | Bacteria | 2288 |
| 116 | Ga0495622_0092346 | 3300046557 | Bacteria | 1390 |
| 117 | Ga0495667_0121175 | 3300046559 | Bacteria | 1689 |
| 118 | Ga0495634_0002265 | 3300046642 | Bacteria | 16131 |
| 119 | Ga0495634_0167490 | 3300046642 | Bacteria | 1382 |
| 120 | Ga0495611_0068736 | 3300046648 | Bacteria | 1617 |
| 121 | Ga0495635_0047065 | 3300046663 | Bacteria | 2975 |
| 122 | Ga0495588_0049565 | 3300046674 | Bacteria | 2159 |
| 123 | Ga0495588_0055671 | 3300046674 | Bacteria | 2041 |
| 124 | Ga0495657_0020033 | 3300046675 | Bacteria | 4815 |
| 125 | Ga0495646_0060550 | 3300046680 | Bacteria | 2257 |
| 126 | Ga0495647_0028119 | 3300046681 | Bacteria | 2072 |
| 127 | Ga0495613_0001287 | 3300046689 | Bacteria | 19142 |
| 128 | Ga0495613_0007095 | 3300046689 | Bacteria | 8340 |
| 129 | Ga0495613_0051170 | 3300046689 | Bacteria | 3045 |
| 130 | Ga0495670_0026460 | 3300046691 | Bacteria | 2871 |
| 131 | Ga0495671_0008724 | 3300046692 | Bacteria | 5693 |
| 132 | Ga0495649_0125465 | 3300046694 | Bacteria | 1356 |
| 133 | Ga0495589_0138197 | 3300046794 | Bacteria | 1168 |
| 134 | Ga0495589_0140603 | 3300046794 | Bacteria | 1156 |
| 135 | Ga0495600_0143717 | 3300046809 | Bacteria | 1547 |
| 136 | Ga0495600_0184793 | 3300046809 | Bacteria | 1342 |
| 137 | Ga0495581_0017936 | 3300047315 | Bacteria | 4113 |
| 138 | Ga0495604_0002658 | 3300047317 | Bacteria | 14345 |
| 139 | Ga0495676_0004134 | 3300047321 | Bacteria | 13229 |
| 140 | Ga0495676_0004653 | 3300047321 | Bacteria | 12570 |
| 141 | Ga0495676_0005038 | 3300047321 | Bacteria | 12118 |
| 142 | Ga0495676_0010943 | 3300047321 | Bacteria | 8201 |
| 143 | Ga0495687_003543 | 3300047443 | Bacteria | 11232 |
| 144 | Ga0495687_006208 | 3300047443 | Bacteria | 7379 |
| 145 | Ga0495679_015593 | 3300047446 | Bacteria | 2775 |
| 146 | Ga0495685_005480 | 3300047447 | Bacteria | 4145 |
| 147 | Ga0495681_0004834 | 3300047470 | Bacteria | 9118 |
| 148 | Ga0495686_0036838 | 3300047472 | Bacteria | 3138 |
| 149 | Ga0495593_0057431 | 3300047673 | Bacteria | 2043 |
| 150 | Ga0495614_0038705 | 3300048089 | Bacteria | 2046 |
| 151 | Ga0495614_0046403 | 3300048089 | Bacteria | 1862 |
| 152 | Ga0496100_0016177 | 3300048903 | Bacteria | 4375 |
| 153 | Ga0496101_0043692 | 3300048904 | Bacteria | 3203 |
| 154 | Ga0496102_0020185 | 3300048905 | Bacteria | 5884 |
| 155 | Ga0496102_0481331 | 3300048905 | Bacteria | 1163 |
| 156 | Ga0496103_0053869 | 3300048906 | Bacteria | 2493 |
| 157 | Ga0496103_0066310 | 3300048906 | Bacteria | 2253 |
| 158 | Ga0496104_0010288 | 3300048907 | Bacteria | 8353 |
| 159 | Ga0496105_0000828 | 3300048908 | Bacteria | 21030 |
| 160 | Ga0496106_0064239 | 3300048909 | Bacteria | 2792 |
| 161 | Ga0496108_0205651 | 3300048911 | Bacteria | 1708 |
| 162 | Ga0496109_0140482 | 3300048912 | Bacteria | 2258 |
| 163 | Ga0496109_0480067 | 3300048912 | Bacteria | 1174 |
| 164 | Ga0496110_0937157 | 3300048913 | Bacteria | 772 |
| 165 | Ga0496113_0544058 | 3300048916 | Bacteria | 931 |
| 166 | Ga0496114_0024967 | 3300048917 | Bacteria | 4880 |
| 167 | Ga0496114_0028824 | 3300048917 | Bacteria | 4559 |
| 168 | Ga0496114_0042933 | 3300048917 | Bacteria | 3749 |
| 169 | Ga0496115_0012778 | 3300048918 | Bacteria | 6329 |
| 170 | Ga0496115_0302553 | 3300048918 | Bacteria | 1310 |
| 171 | Ga0496118_0022649 | 3300048921 | Bacteria | 5483 |
| 172 | Ga0496121_0003673 | 3300048924 | Bacteria | 21566 |
| 173 | Ga0501031_0029774 | 3300049568 | Bacteria | 3562 |
| 174 | Ga0501031_0050441 | 3300049568 | Bacteria | 2711 |
| 175 | Ga0501032_0023051 | 3300049569 | Bacteria | 4309 |
| 176 | Ga0501032_0141625 | 3300049569 | Bacteria | 1583 |
| 177 | Ga0501033_0067663 | 3300049570 | Bacteria | 2626 |
| 178 | Ga0501033_0069497 | 3300049570 | Bacteria | 2588 |
| 179 | Ga0501034_0024560 | 3300049571 | Bacteria | 6130 |
| 180 | Ga0501034_0029497 | 3300049571 | Bacteria | 5576 |
| 181 | Ga0501034_0123328 | 3300049571 | Bacteria | 2577 |
| 182 | Ga0501036_0010604 | 3300049572 | Bacteria | 7615 |
| 183 | Ga0501036_0020691 | 3300049572 | Bacteria | 5527 |
| 184 | Ga0501036_0035885 | 3300049572 | Bacteria | 4195 |
| 185 | Ga0501037_0078706 | 3300049573 | Bacteria | 2392 |
| 186 | Ga0501037_0099648 | 3300049573 | Bacteria | 2098 |
| 187 | Ga0501037_0526693 | 3300049573 | Bacteria | 799 |
| 188 | Ga0501038_0078854 | 3300049574 | Bacteria | 2778 |
| 189 | Ga0501038_0101632 | 3300049574 | Bacteria | 2393 |
| 190 | Ga0501038_0174209 | 3300049574 | Bacteria | 1740 |
| 191 | Ga0501038_0257441 | 3300049574 | Bacteria | 1380 |
| 192 | Ga0501039_0036312 | 3300049575 | Bacteria | 3802 |
| 193 | Ga0501039_0337756 | 3300049575 | Bacteria | 1184 |
| 194 | Ga0501043_0044121 | 3300049579 | Bacteria | 3505 |
| 195 | Ga0501043_0213432 | 3300049579 | Bacteria | 1495 |
| 196 | Ga0501046_0305096 | 3300049580 | Bacteria | 1162 |
| 197 | Ga0501047_0019088 | 3300049581 | Bacteria | 6578 |
| 198 | Ga0501047_0044875 | 3300049581 | Bacteria | 4272 |
| 199 | Ga0501067_0001526 | 3300049583 | Bacteria | 12612 |
| 200 | Ga0501068_0001932 | 3300049584 | Bacteria | 11016 |
| 201 | Ga0501068_0004854 | 3300049584 | Bacteria | 7322 |
| 202 | Ga0501069_0021342 | 3300049585 | Bacteria | 3513 |
| 203 | Ga0501069_0052833 | 3300049585 | Bacteria | 2263 |
| 204 | Ga0501070_0001766 | 3300049586 | Bacteria | 19131 |
| 205 | Ga0501070_0004840 | 3300049586 | Bacteria | 11504 |
| 206 | Ga0501070_0016295 | 3300049586 | Bacteria | 6244 |
| 207 | Ga0501070_0129455 | 3300049586 | Bacteria | 2085 |
| 208 | Ga0501070_0166551 | 3300049586 | Bacteria | 1816 |
| 209 | Ga0501071_0004926 | 3300049587 | Bacteria | 8522 |
| 210 | Ga0501072_0002545 | 3300049588 | Bacteria | 13663 |
| 211 | Ga0501072_0130525 | 3300049588 | Bacteria | 2002 |
| 212 | Ga0501072_0155931 | 3300049588 | Bacteria | 1821 |
| 213 | Ga0501073_0003406 | 3300049589 | Bacteria | 11960 |
| 214 | Ga0501073_0114081 | 3300049589 | Bacteria | 1873 |
| 215 | Ga0501074_0002866 | 3300049590 | Bacteria | 12079 |
| 216 | Ga0501074_0005254 | 3300049590 | Bacteria | 9316 |
| 217 | Ga0501074_0009114 | 3300049590 | Bacteria | 7208 |
| 218 | Ga0501074_0026033 | 3300049590 | Bacteria | 4242 |
| 219 | Ga0501077_0001085 | 3300049593 | Bacteria | 16408 |
| 220 | Ga0501077_0024544 | 3300049593 | Bacteria | 3829 |
| 221 | Ga0501079_0007427 | 3300049741 | Bacteria | 8294 |
| 222 | Ga0501079_0097387 | 3300049741 | Bacteria | 2281 |
| 223 | Ga0501080_0017448 | 3300049742 | Bacteria | 6638 |
| 224 | Ga0501080_0039065 | 3300049742 | Bacteria | 4429 |
| 225 | Ga0501080_0174012 | 3300049742 | Bacteria | 1984 |
| 226 | Ga0501080_0419839 | 3300049742 | Bacteria | 1202 |
| 227 | Ga0501083_0004399 | 3300049744 | Bacteria | 9933 |
| 228 | Ga0501035_0007043 | 3300049822 | Bacteria | 10508 |
| 229 | Ga0501035_0022321 | 3300049822 | Bacteria | 5811 |
| 230 | Ga0501035_0083650 | 3300049822 | Bacteria | 2815 |
| 231 | Ga0501035_0107427 | 3300049822 | Bacteria | 2447 |
| 232 | Ga0501035_0317509 | 3300049822 | Bacteria | 1309 |
| 233 | Ga0501044_0040244 | 3300049823 | Bacteria | 4872 |
| 234 | Ga0501044_0046661 | 3300049823 | Bacteria | 4484 |
| 235 | Ga0501044_0245699 | 3300049823 | Bacteria | 1732 |
| 236 | Ga0501045_0077517 | 3300049824 | Bacteria | 2449 |
| 237 | nmdc:mga03n38_151311_c1 | 3300050490 | Bacteria | 1168 |
| 238 | nmdc:mga00v17_37522_c1 | 3300050491 | Bacteria | 2895 |
| 239 | nmdc:mga0yw44_154766_c1 | 3300050492 | Bacteria | 1497 |
| 240 | nmdc:mga0yw44_248735_c1 | 3300050492 | Bacteria | 1183 |
| 241 | nmdc:mga07m45_5541_c1 | 3300050496 | Bacteria | 6297 |
| 242 | Ga0495655_0004158 | 3300053083 | Bacteria | 2454 |
| 243 | Ga0495619_0043251 | 3300053085 | Bacteria | 2952 |
| 244 | Ga0500578_0009710 | 3300053086 | Bacteria | 6250 |
| 245 | Ga0500644_0000315 | 3300053088 | Bacteria | 25229 |
| 246 | Ga0500640_033131 | 3300053095 | Bacteria | 2269 |
| 247 | Ga0500560_006362 | 3300053107 | Bacteria | 2697 |
| 248 | Ga0500569_013156 | 3300053109 | Bacteria | 2019 |
| 249 | Ga0500658_0028250 | 3300053134 | Bacteria | 2175 |
| 250 | Ga0500579_017070 | 3300053143 | Bacteria | 4693 |
| 251 | Ga0500600_0009525 | 3300053149 | Bacteria | 5863 |
| 252 | Ga0500616_0070559 | 3300053153 | Bacteria | 1782 |
| 253 | Ga0500633_0005923 | 3300053160 | Bacteria | 2953 |
| 254 | Ga0500634_0000949 | 3300053161 | Bacteria | 10434 |
| 255 | Ga0501084_0012734 | 3300054114 | Bacteria | 6968 |
| 256 | Ga0501082_0037564 | 3300060353 | Bacteria | 4175 |
| 257 | Ga0501082_0239098 | 3300060353 | Bacteria | 1580 |
| 258 | Ga0466962_0010291 | 3300061719 | Bacteria | 4493 |
| 259 | Ga0466962_0103197 | 3300061719 | Bacteria | 1370 |
| 260 | Ga0466962_0218583 | 3300061719 | Bacteria | 933 |
| 261 | 2517762162 | 2517572101 | Bacteria | 6884336 |
| 262 | 2548698370 | 2547132424 | Bacteria | 8348532 |
| 263 | 2554258560 | 2554235005 | Bacteria | 6457341 |
| 264 | 2586063277 | 2585427649 | Bacteria | 9053857 |
| 265 | 2643759779 | 2643221548 | Bacteria | 8053412 |
| 266 | 2643828089 | 2643221561 | Bacteria | 4984412 |
| 267 | 2643897904 | 2643221578 | Bacteria | 9213798 |
| 268 | 2643961475 | 2643221590 | Bacteria | 5214697 |
| 269 | 2644032410 | 2643221604 | Bacteria | 5014917 |
| 270 | 2644409049 | 2643221673 | Bacteria | 9196637 |
| 271 | 2644462802 | 2643221682 | Bacteria | 6743283 |
| 272 | 2644516968 | 2643221692 | Bacteria | 7282860 |
| 273 | 2644531178 | 2643221696 | Bacteria | 5431823 |
| 274 | 2671839900 | 2671180195 | Bacteria | 9757215 |
| 275 | 2689991680 | 2687453743 | Bacteria | 8361025 |
| 276 | 2689991687 | 2687453743 | Bacteria | 8361025 |
| 277 | 2740166609 | 2739367898 | Bacteria | 4367674 |
| 278 | 2774858056 | 2773857922 | Bacteria | 9757215 |
| 279 | 2785368611 | 2784746768 | Bacteria | 10036182 |
| 280 | 2809587575 | 2808606522 | Bacteria | 9488490 |
| 281 | 2812334135 | 2811994874 | Bacteria | 5367947 |
| 282 | 2837272386 | 2837268691 | Bacteria | 7850704 |
| 283 | 2862184871 | 2862178590 | Bacteria | 8583590 |
| 284 | 2862383869 | 2862382967 | Bacteria | 10317375 |
| 285 | 2863405509 | 2863404153 | Bacteria | 9672205 |
| 286 | 2867348157 | 2867346516 | Bacteria | 7608576 |
| 287 | 2867371117 | 2867369537 | Bacteria | 6501581 |
| 288 | 2870790995 | 2870782633 | Bacteria | 9624083 |
| 289 | 2875393815 | 2875391855 | Bacteria | 7600475 |
| 290 | 2877681900 | 2877676314 | Bacteria | 9512378 |
| 291 | 2891331362 | 2891326441 | Bacteria | 6439512 |
| 292 | 2895887716 | 2895880812 | Bacteria | 11255272 |
| 293 | 2899362847 | 2899359706 | Bacteria | 10940472 |
| 294 | 2919715568 | 2919713450 | Bacteria | 7431245 |
| 295 | 2946050837 | 2946045630 | Bacteria | 8527308 |
| 296 | 2947230317 | 2947224130 | Bacteria | 9938529 |
| 297 | 3006399661 | 3006393351 | Bacteria | 6615579 |
| 298 | 8003320150 | 8003314358 | Bacteria | 10575343 |
| 299 | 8025536973 | 8025530807 | Bacteria | 8495698 |
| 300 | 8054165026 | 8054160619 | Bacteria | 7783213 |
| 301 | 8054919851 | 8054913762 | Bacteria | 7713009 |
| 302 | Ga0501032_0007941 | |||
| 303 | Ga0070668_100000709 | |||
| 304 | Ga0070659_100138118 | |||
| 305 | Ga0070714_100008552 | |||
| 306 | Ga0070713_100014746 | |||
| 307 | Ga0070663_100502564 | |||
| 308 | Ga0068853_100006559 | |||
| 309 | Ga0070665_100002481 | |||
| 310 | Ga0070665_100025085 | |||
| 311 | Ga0070664_100037944 | |||
| 312 | Ga0075365_10039523 | |||
| 313 | Ga0075365_10197607 | |||
| 314 | Ga0075367_10098438 | |||
| 315 | Ga0075431_100207994 | |||
| 316 | Ga0105248_10000138 | |||
| 317 | Ga0157372_10092553 | |||
| 318 | Ga0206353_12036625 | |||
| 319 | Ga0209758_1012160 | |||
| 320 | Ga0207426_1003154 | |||
| 321 | Ga0207659_10482424 | |||
| 322 | Ga0207700_10029642 | |||
| 323 | Ga0207664_10014631 | |||
| 324 | Ga0207711_10000198 | |||
| 325 | Ga0207668_10009581 | |||
| 326 | Ga0207678_10036425 | |||
| 327 | Ga0207678_10338950 | |||
| 328 | Ga0207698_10112336 | |||
| 329 | Ga0268266_10001392 | |||
| 330 | Ga0307517_10003800 | |||
| 331 | Ga0307517_10018307 | |||
| 332 | Ga0307515_10002026 | |||
| 333 | Ga0307515_10228112 | |||
| 334 | Ga0307511_10001267 | |||
| 335 | Ga0307511_10044368 | |||
| 336 | Ga0307511_10197304 | |||
| 337 | Ga0307512_10177855 | |||
| 338 | Ga0307509_10008457 | |||
| 339 | Ga0307508_10005831 | |||
| 340 | Ga0307508_10056008 | |||
| 341 | Ga0307508_10159716 | |||
| 342 | Ga0307514_10014502 | |||
| 343 | Ga0307514_10039779 | |||
| 344 | Ga0307514_10132056 | |||
| 345 | Ga0307516_10052872 | |||
| 346 | Ga0307516_10120977 | |||
| 347 | Ga0307518_10071937 | |||
| 348 | Ga0307416_100073304 | |||
| 349 | Ga0307507_10023435 | |||
| 350 | Ga0307507_10159003 | |||
| 351 | Ga0307507_10228161 | |||
| 352 | Ga0307510_10036555 | |||
| 353 | Ga0307510_10073478 | |||
| 354 | Ga0307510_10091328 | |||
| 355 | Ga0316584_0298138 | |||
| 356 | Ga0395898_0108694 | |||
| 357 | Ga0395898_0316875 | |||
| 358 | Ga0395905_0411419 | |||
| 359 | Ga0395905_0555930 | |||
| 360 | Ga0436364_1279794 | |||
| 361 | Ga0395901_0330076 | |||
| 362 | Ga0436365_0158159 | |||
| 363 | Ga0466972_0003162 | |||
| 364 | Ga0466965_0036382 | |||
| 365 | Ga0466965_0143156 | |||
| 366 | Ga0466966_0010729 | |||
| 367 | Ga0466961_0045209 | |||
| 368 | Ga0466961_0126675 | |||
| 369 | Ga0466961_0200403 | |||
| 370 | Ga0466963_0031382 | |||
| 371 | Ga0466963_0062253 | |||
| 372 | Ga0466964_0047672 | |||
| 373 | Ga0466964_0065130 | |||
| 374 | Ga0466971_0019236 | |||
| 375 | Ga0466971_0031965 | |||
| 376 | Ga0466971_0059303 | |||
| 377 | Ga0466970_0006321 | |||
| 378 | Ga0466970_0010325 | |||
| 379 | Ga0466970_0038893 | |||
| 380 | Ga0466970_0070002 | |||
| 381 | Ga0466957_0047439 | |||
| 382 | Ga0466957_0139296 | |||
| 383 | Ga0466957_0193400 | |||
| 384 | Ga0466959_0038264 | |||
| 385 | Ga0466958_0042295 | |||
| 386 | Ga0466967_0002449 | |||
| 387 | Ga0466967_0016042 | |||
| 388 | Ga0466967_0112744 | |||
| 389 | Ga0466967_0178525 | |||
| 390 | Ga0466967_0178848 | |||
| 391 | Ga0466967_0532347 | |||
| 392 | Ga0466967_0897366 | |||
| 393 | Ga0495592_0015988 | |||
| 394 | Ga0495592_0025554 | |||
| 395 | Ga0495603_0000262 | |||
| 396 | Ga0495603_0007519 | |||
| 397 | Ga0495629_0000568 | |||
| 398 | Ga0495629_0006885 | |||
| 399 | Ga0495629_0020591 | |||
| 400 | Ga0495629_0030504 | |||
| 401 | Ga0495629_0044422 | |||
| 402 | Ga0495638_0052045 | |||
| 403 | Ga0495638_0206321 | |||
| 404 | Ga0495638_0261995 | |||
| 405 | Ga0495664_0275630 | |||
| 406 | Ga0495594_0000586 | |||
| 407 | Ga0495594_0060770 | |||
| 408 | Ga0495594_0144954 | |||
| 409 | Ga0495628_0335132 | |||
| 410 | Ga0495632_0006703 | |||
| 411 | Ga0495643_0005069 | |||
| 412 | Ga0495666_0133420 | |||
| 413 | Ga0495652_0141907 | |||
| 414 | Ga0495640_0003552 | |||
| 415 | Ga0495597_0146575 | |||
| 416 | Ga0495622_0036583 | |||
| 417 | Ga0495622_0092346 | |||
| 418 | Ga0495667_0121175 | |||
| 419 | Ga0495634_0002265 | |||
| 420 | Ga0495634_0167490 | |||
| 421 | Ga0495611_0068736 | |||
| 422 | Ga0495635_0047065 | |||
| 423 | Ga0495588_0049565 | |||
| 424 | Ga0495588_0055671 | |||
| 425 | Ga0495657_0020033 | |||
| 426 | Ga0495646_0060550 | |||
| 427 | Ga0495647_0028119 | |||
| 428 | Ga0495613_0001287 | |||
| 429 | Ga0495613_0007095 | |||
| 430 | Ga0495613_0051170 | |||
| 431 | Ga0495670_0026460 | |||
| 432 | Ga0495671_0008724 | |||
| 433 | Ga0495649_0125465 | |||
| 434 | Ga0495589_0138197 | |||
| 435 | Ga0495589_0140603 | |||
| 436 | Ga0495600_0143717 | |||
| 437 | Ga0495600_0184793 | |||
| 438 | Ga0495581_0017936 | |||
| 439 | Ga0495604_0002658 | |||
| 440 | Ga0495676_0004134 | |||
| 441 | Ga0495676_0004653 | |||
| 442 | Ga0495676_0005038 | |||
| 443 | Ga0495676_0010943 | |||
| 444 | Ga0495687_003543 | |||
| 445 | Ga0495687_006208 | |||
| 446 | Ga0495679_015593 | |||
| 447 | Ga0495685_005480 | |||
| 448 | Ga0495681_0004834 | |||
| 449 | Ga0495686_0036838 | |||
| 450 | Ga0495593_0057431 | |||
| 451 | Ga0495614_0038705 | |||
| 452 | Ga0495614_0046403 | |||
| 453 | Ga0496100_0016177 | |||
| 454 | Ga0496101_0043692 | |||
| 455 | Ga0496102_0020185 | |||
| 456 | Ga0496102_0481331 | |||
| 457 | Ga0496103_0053869 | |||
| 458 | Ga0496103_0066310 | |||
| 459 | Ga0496104_0010288 | |||
| 460 | Ga0496105_0000828 | |||
| 461 | Ga0496106_0064239 | |||
| 462 | Ga0496108_0205651 | |||
| 463 | Ga0496109_0140482 | |||
| 464 | Ga0496109_0480067 | |||
| 465 | Ga0496110_0937157 | |||
| 466 | Ga0496113_0544058 | |||
| 467 | Ga0496114_0024967 | |||
| 468 | Ga0496114_0028824 | |||
| 469 | Ga0496114_0042933 | |||
| 470 | Ga0496115_0012778 | |||
| 471 | Ga0496115_0302553 | |||
| 472 | Ga0496118_0022649 | |||
| 473 | Ga0496121_0003673 | |||
| 474 | Ga0501031_0029774 | |||
| 475 | Ga0501031_0050441 | |||
| 476 | Ga0501032_0023051 | |||
| 477 | Ga0501032_0141625 | |||
| 478 | Ga0501033_0067663 | |||
| 479 | Ga0501033_0069497 | |||
| 480 | Ga0501034_0024560 | |||
| 481 | Ga0501034_0029497 | |||
| 482 | Ga0501034_0123328 | |||
| 483 | Ga0501036_0010604 | |||
| 484 | Ga0501036_0020691 | |||
| 485 | Ga0501036_0035885 | |||
| 486 | Ga0501037_0078706 | |||
| 487 | Ga0501037_0099648 | |||
| 488 | Ga0501037_0526693 | |||
| 489 | Ga0501038_0078854 | |||
| 490 | Ga0501038_0101632 | |||
| 491 | Ga0501038_0174209 | |||
| 492 | Ga0501038_0257441 | |||
| 493 | Ga0501039_0036312 | |||
| 494 | Ga0501039_0337756 | |||
| 495 | Ga0501043_0044121 | |||
| 496 | Ga0501043_0213432 | |||
| 497 | Ga0501046_0305096 | |||
| 498 | Ga0501047_0019088 | |||
| 499 | Ga0501047_0044875 | |||
| 500 | Ga0501067_0001526 | |||
| 501 | Ga0501068_0001932 | |||
| 502 | Ga0501068_0004854 | |||
| 503 | Ga0501069_0021342 | |||
| 504 | Ga0501069_0052833 | |||
| 505 | Ga0501070_0001766 | |||
| 506 | Ga0501070_0004840 | |||
| 507 | Ga0501070_0016295 | |||
| 508 | Ga0501070_0129455 | |||
| 509 | Ga0501070_0166551 | |||
| 510 | Ga0501071_0004926 | |||
| 511 | Ga0501072_0002545 | |||
| 512 | Ga0501072_0130525 | |||
| 513 | Ga0501072_0155931 | |||
| 514 | Ga0501073_0003406 | |||
| 515 | Ga0501073_0114081 | |||
| 516 | Ga0501074_0002866 | |||
| 517 | Ga0501074_0005254 | |||
| 518 | Ga0501074_0009114 | |||
| 519 | Ga0501074_0026033 | |||
| 520 | Ga0501077_0001085 | |||
| 521 | Ga0501077_0024544 | |||
| 522 | Ga0501079_0007427 | |||
| 523 | Ga0501079_0097387 | |||
| 524 | Ga0501080_0017448 | |||
| 525 | Ga0501080_0039065 | |||
| 526 | Ga0501080_0174012 | |||
| 527 | Ga0501080_0419839 | |||
| 528 | Ga0501083_0004399 | |||
| 529 | Ga0501035_0007043 | |||
| 530 | Ga0501035_0022321 | |||
| 531 | Ga0501035_0083650 | |||
| 532 | Ga0501035_0107427 | |||
| 533 | Ga0501035_0317509 | |||
| 534 | Ga0501044_0040244 | |||
| 535 | Ga0501044_0046661 | |||
| 536 | Ga0501044_0245699 | |||
| 537 | Ga0501045_0077517 | |||
| 538 | nmdc:mga03n38_151311_c1 | |||
| 539 | nmdc:mga00v17_37522_c1 | |||
| 540 | nmdc:mga0yw44_154766_c1 | |||
| 541 | nmdc:mga0yw44_248735_c1 | |||
| 542 | nmdc:mga07m45_5541_c1 | |||
| 543 | Ga0495655_0004158 | |||
| 544 | Ga0495619_0043251 | |||
| 545 | Ga0500578_0009710 | |||
| 546 | Ga0500644_0000315 | |||
| 547 | Ga0500640_033131 | |||
| 548 | Ga0500560_006362 | |||
| 549 | Ga0500569_013156 | |||
| 550 | Ga0500658_0028250 | |||
| 551 | Ga0500579_017070 | |||
| 552 | Ga0500600_0009525 | |||
| 553 | Ga0500616_0070559 | |||
| 554 | Ga0500633_0005923 | |||
| 555 | Ga0500634_0000949 | |||
| 556 | Ga0501084_0012734 | |||
| 557 | Ga0501082_0037564 | |||
| 558 | Ga0501082_0239098 | |||
| 559 | Ga0466962_0010291 | |||
| 560 | Ga0466962_0103197 | |||
| 561 | Ga0466962_0218583 | |||
| 562 | 2517762162 | |||
| 563 | 2548698370 | |||
| 564 | 2554258560 | |||
| 565 | 2586063277 | |||
| 566 | 2643759779 | |||
| 567 | 2643828089 | |||
| 568 | 2643897904 | |||
| 569 | 2643961475 | |||
| 570 | 2644032410 | |||
| 571 | 2644409049 | |||
| 572 | 2644462802 | |||
| 573 | 2644516968 | |||
| 574 | 2644531178 | |||
| 575 | 2671839900 | |||
| 576 | 2689991680 | |||
| 577 | 2689991687 | |||
| 578 | 2740166609 | |||
| 579 | 2774858056 | |||
| 580 | 2785368611 | |||
| 581 | 2809587575 | |||
| 582 | 2812334135 | |||
| 583 | 2837272386 | |||
| 584 | 2862184871 | |||
| 585 | 2862383869 | |||
| 586 | 2863405509 | |||
| 587 | 2867348157 | |||
| 588 | 2867371117 | |||
| 589 | 2870790995 | |||
| 590 | 2875393815 | |||
| 591 | 2877681900 | |||
| 592 | 2891331362 | |||
| 593 | 2895887716 | |||
| 594 | 2899362847 | |||
| 595 | 2919715568 | |||
| 596 | 2946050837 | |||
| 597 | 2947230317 | |||
| 598 | 3006399661 | |||
| 599 | 8003320150 | |||
| 600 | 8025536973 | |||
| 601 | 8054165026 | |||
| 602 | 8054919851 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8eth-assembly1.cif.gz_5 | ytm1 associated 60s nascent ribosome state 1b | 0.7762 | 36 | 69 |
| 8glv-assembly1.cif.gz_Do | 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella | 0.7225 | 40 | 70 |
| 3twl-assembly1.cif.gz_A | crystal structure of arabidopsis thaliana fpg | 0.6663 | 2 | 184 |
| 6fbu-assembly1.cif.gz_A | crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate | 0.6271 | 4 | 251 |
| 2opf-assembly1.cif.gz_A | crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (r252a) in complex with ap-site containing dna substrate | 0.626 | 2 | 251 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNB9_2_120_3.20.190.10 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.9865 | 4 | 115 | 3.20.190.10 |
| af_P9WNB9_2_120_3.20.190.10 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.9213 | 4 | 115 | 3.20.190.10 |
| 1q39A01 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.8502 | 6 | 121 | 3.20.190.10 |
| af_P9WNC1_2_123_3.20.190.10 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.8475 | 4 | 121 | 3.20.190.10 |
| af_P9WNC1_2_123_3.20.190.10 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.8155 | 4 | 121 | 3.20.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3H099-F1-model_v4 | Fpg/Nei family DNA glycosylase | 0.984 | 20 | 116 |
GO:0000703
GO:0003906 GO:0006284 GO:0008270 |
| AF-A0A0L8QG26-F1-model_v4 | deleted | 0.9757 | 1 | 124 |
|
| AF-A0A0L8QG26-F1-model_v4 | deleted | 0.968 | 1 | 124 |
|
| AF-A0A6B3H099-F1-model_v4 | Fpg/Nei family DNA glycosylase | 0.9644 | 20 | 116 |
GO:0000703
GO:0003906 GO:0006284 GO:0008270 |
| AF-A0A7Y8X104-F1-model_v4 | Fpg/Nei family DNA glycosylase | 0.961 | 1 | 75 |
GO:0000703
GO:0003906 GO:0006284 GO:0008270 |