F396157

General Info

Members Datasets Scaffolds Average Seq Length
301 193 602 274

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0007941|Ga0501032_0007941_5242_6285
Length 327
Sequence LPEGHTLHRLAAAYRERFAGRPVRVTSPQGGFAAAAALLDGTVLRDSEAHGKHLFLGFGGAPESGAPEGSGGPEHYVHVHLGLFGKVAFEERGDPGTVRLRIATGGPDSPDGGPHQSPAVLADLRGPAACELLTPAEADAVHDRLGPDPLRPADTGDAAWQRISRSRSGLAVLLMDQKVVSGVGNIYRAEVLFRHGIDPHRPGRDLTRPEWDAVWADLRDLMREGVRTGRIDTVRPEHTPEAMGRPPRVDGHGGEVYVYRRAGQPCLVCGTEVRTADLAARNLFWCPGCQAPSSGPAAAGRLPAQKPKGSQGATSQPNAAPSETQPR

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
13 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
14 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
15 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
16 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
17 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
18 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
27 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
28 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
29 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
30 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
31 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
32 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
33 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
34 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
35 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
36 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
37 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
38 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
39 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
40 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
41 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
42 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
43 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
44 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
45 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
46 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
47 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
48 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
49 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
50 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
51 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
52 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
53 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
54 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
57 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
58 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
59 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
60 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
63 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
64 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
65 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
66 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
67 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
68 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
69 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
70 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
71 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
72 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
73 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
74 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
75 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
76 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
79 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
80 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
83 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
84 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
85 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
86 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
87 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
88 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
89 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
90 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
91 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
92 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
93 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
94 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
95 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
101 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
106 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
107 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
108 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
141 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
142 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
143 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
144 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
145 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
146 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
147 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
148 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
149 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
150 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 2517572101 Frankia sp. DC12 Isolate Nodule
155 2547132424 Nocardia nova SH22a Isolate Unclassified
156 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
157 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
158 2643221548 Streptomyces sp. Root55 Isolate Unclassified
159 2643221561 Nocardioides sp. Root151 Isolate Unclassified
160 2643221578 Streptomyces sp. Root63 Isolate Unclassified
161 2643221590 Nocardioides sp. Root682 Isolate Unclassified
162 2643221604 Nocardioides sp. Root190 Isolate Unclassified
163 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
164 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
165 2643221692 Nocardia sp. Root136 Isolate Unclassified
166 2643221696 Nocardioides sp. Root140 Isolate Unclassified
167 2671180195 Frankia sp. CcI49 Isolate Nodule
168 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
169 2739367898 Nocardioides sp. CF479 Isolate Unclassified
170 2773857922 Frankia sp. CcI49 Isolate Nodule
171 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
172 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
173 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
174 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
175 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
176 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
177 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
178 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
179 2867369537 Streptomyces sp. Z26 Isolate Unclassified
180 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
181 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
182 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
183 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
184 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
185 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
186 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
187 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
188 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
189 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
190 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
191 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
192 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
193 8054913762 Frankia gtarii Agncl-10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.05
Metatranscriptomes 0.33
Isolates 13.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.98
Nodule 2.33
Rhizoplane 6.31
Rhizosphere 66.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0007941 3300049569 Bacteria 7729
2 Ga0070668_100000709 3300005347 Bacteria 22813
3 Ga0070659_100138118 3300005366 Bacteria 1983
4 Ga0070714_100008552 3300005435 Bacteria 8003
5 Ga0070713_100014746 3300005436 Bacteria 5814
6 Ga0070663_100502564 3300005455 Bacteria 1007
7 Ga0068853_100006559 3300005539 Bacteria 9268
8 Ga0070665_100002481 3300005548 Bacteria 20316
9 Ga0070665_100025085 3300005548 Bacteria 6009
10 Ga0070664_100037944 3300005564 Bacteria 4053
11 Ga0075365_10039523 3300006038 Bacteria 3072
12 Ga0075365_10197607 3300006038 Bacteria 1408
13 Ga0075367_10098438 3300006178 Bacteria 1786
14 Ga0075431_100207994 3300006847 Bacteria 2000
15 Ga0105248_10000138 3300009177 Bacteria 84478
16 Ga0157372_10092553 3300013307 Bacteria 3439
17 Ga0206353_12036625 3300020082 Bacteria 4526
18 Ga0209758_1012160 3300025297 Bacteria 4857
19 Ga0207426_1003154 3300025302 Bacteria 9351
20 Ga0207659_10482424 3300025926 Bacteria 1048
21 Ga0207700_10029642 3300025928 Bacteria 3864
22 Ga0207664_10014631 3300025929 Bacteria 5675
23 Ga0207711_10000198 3300025941 Bacteria 64434
24 Ga0207668_10009581 3300025972 Bacteria 5813
25 Ga0207678_10036425 3300026067 Bacteria 4283
26 Ga0207678_10338950 3300026067 Bacteria 1295
27 Ga0207698_10112336 3300026142 Bacteria 2287
28 Ga0268266_10001392 3300028379 Bacteria 28952
29 Ga0307517_10003800 3300028786 Bacteria 23438
30 Ga0307517_10018307 3300028786 Bacteria 9067
31 Ga0307515_10002026 3300028794 Bacteria 44830
32 Ga0307515_10228112 3300028794 Bacteria 1662
33 Ga0307511_10001267 3300030521 Bacteria 26758
34 Ga0307511_10044368 3300030521 Bacteria 3695
35 Ga0307511_10197304 3300030521 Bacteria 1052
36 Ga0307512_10177855 3300030522 Bacteria 1203
37 Ga0307509_10008457 3300031507 Bacteria 13110
38 Ga0307508_10005831 3300031616 Bacteria 11637
39 Ga0307508_10056008 3300031616 Bacteria 3492
40 Ga0307508_10159716 3300031616 Bacteria 1857
41 Ga0307514_10014502 3300031649 Bacteria 6521
42 Ga0307514_10039779 3300031649 Bacteria 3712
43 Ga0307514_10132056 3300031649 Bacteria 1717
44 Ga0307516_10052872 3300031730 Bacteria 3975
45 Ga0307516_10120977 3300031730 Bacteria 2408
46 Ga0307518_10071937 3300031838 Bacteria 2504
47 Ga0307416_100073304 3300032002 Bacteria 2854
48 Ga0307507_10023435 3300033179 Bacteria 6776
49 Ga0307507_10159003 3300033179 Bacteria 1675
50 Ga0307507_10228161 3300033179 Bacteria 1239
51 Ga0307510_10036555 3300033180 Bacteria 5464
52 Ga0307510_10073478 3300033180 Bacteria 3387
53 Ga0307510_10091328 3300033180 Bacteria 2887
54 Ga0316584_0298138 3300036712 Bacteria 1168
55 Ga0395898_0108694 3300037466 Bacteria 2659
56 Ga0395898_0316875 3300037466 Bacteria 1488
57 Ga0395905_0411419 3300037471 Bacteria 1248
58 Ga0395905_0555930 3300037471 Bacteria 1049
59 Ga0436364_1279794 3300037853 Bacteria 2318
60 Ga0395901_0330076 3300038443 Bacteria 1577
61 Ga0436365_0158159 3300039437 Bacteria 1150
62 Ga0466972_0003162 3300044658 Bacteria 8177
63 Ga0466965_0036382 3300044683 Bacteria 2415
64 Ga0466965_0143156 3300044683 Bacteria 1246
65 Ga0466966_0010729 3300044684 Bacteria 6091
66 Ga0466961_0045209 3300044693 Bacteria 2817
67 Ga0466961_0126675 3300044693 Bacteria 1602
68 Ga0466961_0200403 3300044693 Bacteria 1235
69 Ga0466963_0031382 3300044694 Bacteria 3435
70 Ga0466963_0062253 3300044694 Bacteria 2496
71 Ga0466964_0047672 3300044706 Bacteria 1749
72 Ga0466964_0065130 3300044706 Bacteria 1526
73 Ga0466971_0019236 3300044719 Bacteria 3031
74 Ga0466971_0031965 3300044719 Bacteria 2358
75 Ga0466971_0059303 3300044719 Bacteria 1728
76 Ga0466970_0006321 3300044765 Bacteria 5915
77 Ga0466970_0010325 3300044765 Bacteria 4738
78 Ga0466970_0038893 3300044765 Bacteria 2524
79 Ga0466970_0070002 3300044765 Bacteria 1886
80 Ga0466957_0047439 3300044842 Bacteria 2610
81 Ga0466957_0139296 3300044842 Bacteria 1562
82 Ga0466957_0193400 3300044842 Bacteria 1334
83 Ga0466959_0038264 3300045049 Bacteria 3545
84 Ga0466958_0042295 3300045836 Bacteria 2744
85 Ga0466967_0002449 3300045976 Bacteria 11556
86 Ga0466967_0016042 3300045976 Bacteria 5893
87 Ga0466967_0112744 3300045976 Bacteria 2500
88 Ga0466967_0178525 3300045976 Bacteria 2001
89 Ga0466967_0178848 3300045976 Bacteria 2000
90 Ga0466967_0532347 3300045976 Bacteria 1155
91 Ga0466967_0897366 3300045976 Bacteria 881
92 Ga0495592_0015988 3300046454 Bacteria 5692
93 Ga0495592_0025554 3300046454 Bacteria 4482
94 Ga0495603_0000262 3300046455 Bacteria 27718
95 Ga0495603_0007519 3300046455 Bacteria 6551
96 Ga0495629_0000568 3300046459 Bacteria 29992
97 Ga0495629_0006885 3300046459 Bacteria 8389
98 Ga0495629_0020591 3300046459 Bacteria 4710
99 Ga0495629_0030504 3300046459 Bacteria 3821
100 Ga0495629_0044422 3300046459 Bacteria 3118
101 Ga0495638_0052045 3300046460 Bacteria 2552
102 Ga0495638_0206321 3300046460 Bacteria 1106
103 Ga0495638_0261995 3300046460 Bacteria 948
104 Ga0495664_0275630 3300046477 Bacteria 1016
105 Ga0495594_0000586 3300046499 Bacteria 18751
106 Ga0495594_0060770 3300046499 Bacteria 2090
107 Ga0495594_0144954 3300046499 Bacteria 1347
108 Ga0495628_0335132 3300046516 Bacteria 1114
109 Ga0495632_0006703 3300046519 Bacteria 7362
110 Ga0495643_0005069 3300046522 Bacteria 9014
111 Ga0495666_0133420 3300046526 Bacteria 1160
112 Ga0495652_0141907 3300046529 Bacteria 1888
113 Ga0495640_0003552 3300046533 Bacteria 12522
114 Ga0495597_0146575 3300046542 Bacteria 971
115 Ga0495622_0036583 3300046557 Bacteria 2288
116 Ga0495622_0092346 3300046557 Bacteria 1390
117 Ga0495667_0121175 3300046559 Bacteria 1689
118 Ga0495634_0002265 3300046642 Bacteria 16131
119 Ga0495634_0167490 3300046642 Bacteria 1382
120 Ga0495611_0068736 3300046648 Bacteria 1617
121 Ga0495635_0047065 3300046663 Bacteria 2975
122 Ga0495588_0049565 3300046674 Bacteria 2159
123 Ga0495588_0055671 3300046674 Bacteria 2041
124 Ga0495657_0020033 3300046675 Bacteria 4815
125 Ga0495646_0060550 3300046680 Bacteria 2257
126 Ga0495647_0028119 3300046681 Bacteria 2072
127 Ga0495613_0001287 3300046689 Bacteria 19142
128 Ga0495613_0007095 3300046689 Bacteria 8340
129 Ga0495613_0051170 3300046689 Bacteria 3045
130 Ga0495670_0026460 3300046691 Bacteria 2871
131 Ga0495671_0008724 3300046692 Bacteria 5693
132 Ga0495649_0125465 3300046694 Bacteria 1356
133 Ga0495589_0138197 3300046794 Bacteria 1168
134 Ga0495589_0140603 3300046794 Bacteria 1156
135 Ga0495600_0143717 3300046809 Bacteria 1547
136 Ga0495600_0184793 3300046809 Bacteria 1342
137 Ga0495581_0017936 3300047315 Bacteria 4113
138 Ga0495604_0002658 3300047317 Bacteria 14345
139 Ga0495676_0004134 3300047321 Bacteria 13229
140 Ga0495676_0004653 3300047321 Bacteria 12570
141 Ga0495676_0005038 3300047321 Bacteria 12118
142 Ga0495676_0010943 3300047321 Bacteria 8201
143 Ga0495687_003543 3300047443 Bacteria 11232
144 Ga0495687_006208 3300047443 Bacteria 7379
145 Ga0495679_015593 3300047446 Bacteria 2775
146 Ga0495685_005480 3300047447 Bacteria 4145
147 Ga0495681_0004834 3300047470 Bacteria 9118
148 Ga0495686_0036838 3300047472 Bacteria 3138
149 Ga0495593_0057431 3300047673 Bacteria 2043
150 Ga0495614_0038705 3300048089 Bacteria 2046
151 Ga0495614_0046403 3300048089 Bacteria 1862
152 Ga0496100_0016177 3300048903 Bacteria 4375
153 Ga0496101_0043692 3300048904 Bacteria 3203
154 Ga0496102_0020185 3300048905 Bacteria 5884
155 Ga0496102_0481331 3300048905 Bacteria 1163
156 Ga0496103_0053869 3300048906 Bacteria 2493
157 Ga0496103_0066310 3300048906 Bacteria 2253
158 Ga0496104_0010288 3300048907 Bacteria 8353
159 Ga0496105_0000828 3300048908 Bacteria 21030
160 Ga0496106_0064239 3300048909 Bacteria 2792
161 Ga0496108_0205651 3300048911 Bacteria 1708
162 Ga0496109_0140482 3300048912 Bacteria 2258
163 Ga0496109_0480067 3300048912 Bacteria 1174
164 Ga0496110_0937157 3300048913 Bacteria 772
165 Ga0496113_0544058 3300048916 Bacteria 931
166 Ga0496114_0024967 3300048917 Bacteria 4880
167 Ga0496114_0028824 3300048917 Bacteria 4559
168 Ga0496114_0042933 3300048917 Bacteria 3749
169 Ga0496115_0012778 3300048918 Bacteria 6329
170 Ga0496115_0302553 3300048918 Bacteria 1310
171 Ga0496118_0022649 3300048921 Bacteria 5483
172 Ga0496121_0003673 3300048924 Bacteria 21566
173 Ga0501031_0029774 3300049568 Bacteria 3562
174 Ga0501031_0050441 3300049568 Bacteria 2711
175 Ga0501032_0023051 3300049569 Bacteria 4309
176 Ga0501032_0141625 3300049569 Bacteria 1583
177 Ga0501033_0067663 3300049570 Bacteria 2626
178 Ga0501033_0069497 3300049570 Bacteria 2588
179 Ga0501034_0024560 3300049571 Bacteria 6130
180 Ga0501034_0029497 3300049571 Bacteria 5576
181 Ga0501034_0123328 3300049571 Bacteria 2577
182 Ga0501036_0010604 3300049572 Bacteria 7615
183 Ga0501036_0020691 3300049572 Bacteria 5527
184 Ga0501036_0035885 3300049572 Bacteria 4195
185 Ga0501037_0078706 3300049573 Bacteria 2392
186 Ga0501037_0099648 3300049573 Bacteria 2098
187 Ga0501037_0526693 3300049573 Bacteria 799
188 Ga0501038_0078854 3300049574 Bacteria 2778
189 Ga0501038_0101632 3300049574 Bacteria 2393
190 Ga0501038_0174209 3300049574 Bacteria 1740
191 Ga0501038_0257441 3300049574 Bacteria 1380
192 Ga0501039_0036312 3300049575 Bacteria 3802
193 Ga0501039_0337756 3300049575 Bacteria 1184
194 Ga0501043_0044121 3300049579 Bacteria 3505
195 Ga0501043_0213432 3300049579 Bacteria 1495
196 Ga0501046_0305096 3300049580 Bacteria 1162
197 Ga0501047_0019088 3300049581 Bacteria 6578
198 Ga0501047_0044875 3300049581 Bacteria 4272
199 Ga0501067_0001526 3300049583 Bacteria 12612
200 Ga0501068_0001932 3300049584 Bacteria 11016
201 Ga0501068_0004854 3300049584 Bacteria 7322
202 Ga0501069_0021342 3300049585 Bacteria 3513
203 Ga0501069_0052833 3300049585 Bacteria 2263
204 Ga0501070_0001766 3300049586 Bacteria 19131
205 Ga0501070_0004840 3300049586 Bacteria 11504
206 Ga0501070_0016295 3300049586 Bacteria 6244
207 Ga0501070_0129455 3300049586 Bacteria 2085
208 Ga0501070_0166551 3300049586 Bacteria 1816
209 Ga0501071_0004926 3300049587 Bacteria 8522
210 Ga0501072_0002545 3300049588 Bacteria 13663
211 Ga0501072_0130525 3300049588 Bacteria 2002
212 Ga0501072_0155931 3300049588 Bacteria 1821
213 Ga0501073_0003406 3300049589 Bacteria 11960
214 Ga0501073_0114081 3300049589 Bacteria 1873
215 Ga0501074_0002866 3300049590 Bacteria 12079
216 Ga0501074_0005254 3300049590 Bacteria 9316
217 Ga0501074_0009114 3300049590 Bacteria 7208
218 Ga0501074_0026033 3300049590 Bacteria 4242
219 Ga0501077_0001085 3300049593 Bacteria 16408
220 Ga0501077_0024544 3300049593 Bacteria 3829
221 Ga0501079_0007427 3300049741 Bacteria 8294
222 Ga0501079_0097387 3300049741 Bacteria 2281
223 Ga0501080_0017448 3300049742 Bacteria 6638
224 Ga0501080_0039065 3300049742 Bacteria 4429
225 Ga0501080_0174012 3300049742 Bacteria 1984
226 Ga0501080_0419839 3300049742 Bacteria 1202
227 Ga0501083_0004399 3300049744 Bacteria 9933
228 Ga0501035_0007043 3300049822 Bacteria 10508
229 Ga0501035_0022321 3300049822 Bacteria 5811
230 Ga0501035_0083650 3300049822 Bacteria 2815
231 Ga0501035_0107427 3300049822 Bacteria 2447
232 Ga0501035_0317509 3300049822 Bacteria 1309
233 Ga0501044_0040244 3300049823 Bacteria 4872
234 Ga0501044_0046661 3300049823 Bacteria 4484
235 Ga0501044_0245699 3300049823 Bacteria 1732
236 Ga0501045_0077517 3300049824 Bacteria 2449
237 nmdc:mga03n38_151311_c1 3300050490 Bacteria 1168
238 nmdc:mga00v17_37522_c1 3300050491 Bacteria 2895
239 nmdc:mga0yw44_154766_c1 3300050492 Bacteria 1497
240 nmdc:mga0yw44_248735_c1 3300050492 Bacteria 1183
241 nmdc:mga07m45_5541_c1 3300050496 Bacteria 6297
242 Ga0495655_0004158 3300053083 Bacteria 2454
243 Ga0495619_0043251 3300053085 Bacteria 2952
244 Ga0500578_0009710 3300053086 Bacteria 6250
245 Ga0500644_0000315 3300053088 Bacteria 25229
246 Ga0500640_033131 3300053095 Bacteria 2269
247 Ga0500560_006362 3300053107 Bacteria 2697
248 Ga0500569_013156 3300053109 Bacteria 2019
249 Ga0500658_0028250 3300053134 Bacteria 2175
250 Ga0500579_017070 3300053143 Bacteria 4693
251 Ga0500600_0009525 3300053149 Bacteria 5863
252 Ga0500616_0070559 3300053153 Bacteria 1782
253 Ga0500633_0005923 3300053160 Bacteria 2953
254 Ga0500634_0000949 3300053161 Bacteria 10434
255 Ga0501084_0012734 3300054114 Bacteria 6968
256 Ga0501082_0037564 3300060353 Bacteria 4175
257 Ga0501082_0239098 3300060353 Bacteria 1580
258 Ga0466962_0010291 3300061719 Bacteria 4493
259 Ga0466962_0103197 3300061719 Bacteria 1370
260 Ga0466962_0218583 3300061719 Bacteria 933
261 2517762162 2517572101 Bacteria 6884336
262 2548698370 2547132424 Bacteria 8348532
263 2554258560 2554235005 Bacteria 6457341
264 2586063277 2585427649 Bacteria 9053857
265 2643759779 2643221548 Bacteria 8053412
266 2643828089 2643221561 Bacteria 4984412
267 2643897904 2643221578 Bacteria 9213798
268 2643961475 2643221590 Bacteria 5214697
269 2644032410 2643221604 Bacteria 5014917
270 2644409049 2643221673 Bacteria 9196637
271 2644462802 2643221682 Bacteria 6743283
272 2644516968 2643221692 Bacteria 7282860
273 2644531178 2643221696 Bacteria 5431823
274 2671839900 2671180195 Bacteria 9757215
275 2689991680 2687453743 Bacteria 8361025
276 2689991687 2687453743 Bacteria 8361025
277 2740166609 2739367898 Bacteria 4367674
278 2774858056 2773857922 Bacteria 9757215
279 2785368611 2784746768 Bacteria 10036182
280 2809587575 2808606522 Bacteria 9488490
281 2812334135 2811994874 Bacteria 5367947
282 2837272386 2837268691 Bacteria 7850704
283 2862184871 2862178590 Bacteria 8583590
284 2862383869 2862382967 Bacteria 10317375
285 2863405509 2863404153 Bacteria 9672205
286 2867348157 2867346516 Bacteria 7608576
287 2867371117 2867369537 Bacteria 6501581
288 2870790995 2870782633 Bacteria 9624083
289 2875393815 2875391855 Bacteria 7600475
290 2877681900 2877676314 Bacteria 9512378
291 2891331362 2891326441 Bacteria 6439512
292 2895887716 2895880812 Bacteria 11255272
293 2899362847 2899359706 Bacteria 10940472
294 2919715568 2919713450 Bacteria 7431245
295 2946050837 2946045630 Bacteria 8527308
296 2947230317 2947224130 Bacteria 9938529
297 3006399661 3006393351 Bacteria 6615579
298 8003320150 8003314358 Bacteria 10575343
299 8025536973 8025530807 Bacteria 8495698
300 8054165026 8054160619 Bacteria 7783213
301 8054919851 8054913762 Bacteria 7713009
302 Ga0501032_0007941
303 Ga0070668_100000709
304 Ga0070659_100138118
305 Ga0070714_100008552
306 Ga0070713_100014746
307 Ga0070663_100502564
308 Ga0068853_100006559
309 Ga0070665_100002481
310 Ga0070665_100025085
311 Ga0070664_100037944
312 Ga0075365_10039523
313 Ga0075365_10197607
314 Ga0075367_10098438
315 Ga0075431_100207994
316 Ga0105248_10000138
317 Ga0157372_10092553
318 Ga0206353_12036625
319 Ga0209758_1012160
320 Ga0207426_1003154
321 Ga0207659_10482424
322 Ga0207700_10029642
323 Ga0207664_10014631
324 Ga0207711_10000198
325 Ga0207668_10009581
326 Ga0207678_10036425
327 Ga0207678_10338950
328 Ga0207698_10112336
329 Ga0268266_10001392
330 Ga0307517_10003800
331 Ga0307517_10018307
332 Ga0307515_10002026
333 Ga0307515_10228112
334 Ga0307511_10001267
335 Ga0307511_10044368
336 Ga0307511_10197304
337 Ga0307512_10177855
338 Ga0307509_10008457
339 Ga0307508_10005831
340 Ga0307508_10056008
341 Ga0307508_10159716
342 Ga0307514_10014502
343 Ga0307514_10039779
344 Ga0307514_10132056
345 Ga0307516_10052872
346 Ga0307516_10120977
347 Ga0307518_10071937
348 Ga0307416_100073304
349 Ga0307507_10023435
350 Ga0307507_10159003
351 Ga0307507_10228161
352 Ga0307510_10036555
353 Ga0307510_10073478
354 Ga0307510_10091328
355 Ga0316584_0298138
356 Ga0395898_0108694
357 Ga0395898_0316875
358 Ga0395905_0411419
359 Ga0395905_0555930
360 Ga0436364_1279794
361 Ga0395901_0330076
362 Ga0436365_0158159
363 Ga0466972_0003162
364 Ga0466965_0036382
365 Ga0466965_0143156
366 Ga0466966_0010729
367 Ga0466961_0045209
368 Ga0466961_0126675
369 Ga0466961_0200403
370 Ga0466963_0031382
371 Ga0466963_0062253
372 Ga0466964_0047672
373 Ga0466964_0065130
374 Ga0466971_0019236
375 Ga0466971_0031965
376 Ga0466971_0059303
377 Ga0466970_0006321
378 Ga0466970_0010325
379 Ga0466970_0038893
380 Ga0466970_0070002
381 Ga0466957_0047439
382 Ga0466957_0139296
383 Ga0466957_0193400
384 Ga0466959_0038264
385 Ga0466958_0042295
386 Ga0466967_0002449
387 Ga0466967_0016042
388 Ga0466967_0112744
389 Ga0466967_0178525
390 Ga0466967_0178848
391 Ga0466967_0532347
392 Ga0466967_0897366
393 Ga0495592_0015988
394 Ga0495592_0025554
395 Ga0495603_0000262
396 Ga0495603_0007519
397 Ga0495629_0000568
398 Ga0495629_0006885
399 Ga0495629_0020591
400 Ga0495629_0030504
401 Ga0495629_0044422
402 Ga0495638_0052045
403 Ga0495638_0206321
404 Ga0495638_0261995
405 Ga0495664_0275630
406 Ga0495594_0000586
407 Ga0495594_0060770
408 Ga0495594_0144954
409 Ga0495628_0335132
410 Ga0495632_0006703
411 Ga0495643_0005069
412 Ga0495666_0133420
413 Ga0495652_0141907
414 Ga0495640_0003552
415 Ga0495597_0146575
416 Ga0495622_0036583
417 Ga0495622_0092346
418 Ga0495667_0121175
419 Ga0495634_0002265
420 Ga0495634_0167490
421 Ga0495611_0068736
422 Ga0495635_0047065
423 Ga0495588_0049565
424 Ga0495588_0055671
425 Ga0495657_0020033
426 Ga0495646_0060550
427 Ga0495647_0028119
428 Ga0495613_0001287
429 Ga0495613_0007095
430 Ga0495613_0051170
431 Ga0495670_0026460
432 Ga0495671_0008724
433 Ga0495649_0125465
434 Ga0495589_0138197
435 Ga0495589_0140603
436 Ga0495600_0143717
437 Ga0495600_0184793
438 Ga0495581_0017936
439 Ga0495604_0002658
440 Ga0495676_0004134
441 Ga0495676_0004653
442 Ga0495676_0005038
443 Ga0495676_0010943
444 Ga0495687_003543
445 Ga0495687_006208
446 Ga0495679_015593
447 Ga0495685_005480
448 Ga0495681_0004834
449 Ga0495686_0036838
450 Ga0495593_0057431
451 Ga0495614_0038705
452 Ga0495614_0046403
453 Ga0496100_0016177
454 Ga0496101_0043692
455 Ga0496102_0020185
456 Ga0496102_0481331
457 Ga0496103_0053869
458 Ga0496103_0066310
459 Ga0496104_0010288
460 Ga0496105_0000828
461 Ga0496106_0064239
462 Ga0496108_0205651
463 Ga0496109_0140482
464 Ga0496109_0480067
465 Ga0496110_0937157
466 Ga0496113_0544058
467 Ga0496114_0024967
468 Ga0496114_0028824
469 Ga0496114_0042933
470 Ga0496115_0012778
471 Ga0496115_0302553
472 Ga0496118_0022649
473 Ga0496121_0003673
474 Ga0501031_0029774
475 Ga0501031_0050441
476 Ga0501032_0023051
477 Ga0501032_0141625
478 Ga0501033_0067663
479 Ga0501033_0069497
480 Ga0501034_0024560
481 Ga0501034_0029497
482 Ga0501034_0123328
483 Ga0501036_0010604
484 Ga0501036_0020691
485 Ga0501036_0035885
486 Ga0501037_0078706
487 Ga0501037_0099648
488 Ga0501037_0526693
489 Ga0501038_0078854
490 Ga0501038_0101632
491 Ga0501038_0174209
492 Ga0501038_0257441
493 Ga0501039_0036312
494 Ga0501039_0337756
495 Ga0501043_0044121
496 Ga0501043_0213432
497 Ga0501046_0305096
498 Ga0501047_0019088
499 Ga0501047_0044875
500 Ga0501067_0001526
501 Ga0501068_0001932
502 Ga0501068_0004854
503 Ga0501069_0021342
504 Ga0501069_0052833
505 Ga0501070_0001766
506 Ga0501070_0004840
507 Ga0501070_0016295
508 Ga0501070_0129455
509 Ga0501070_0166551
510 Ga0501071_0004926
511 Ga0501072_0002545
512 Ga0501072_0130525
513 Ga0501072_0155931
514 Ga0501073_0003406
515 Ga0501073_0114081
516 Ga0501074_0002866
517 Ga0501074_0005254
518 Ga0501074_0009114
519 Ga0501074_0026033
520 Ga0501077_0001085
521 Ga0501077_0024544
522 Ga0501079_0007427
523 Ga0501079_0097387
524 Ga0501080_0017448
525 Ga0501080_0039065
526 Ga0501080_0174012
527 Ga0501080_0419839
528 Ga0501083_0004399
529 Ga0501035_0007043
530 Ga0501035_0022321
531 Ga0501035_0083650
532 Ga0501035_0107427
533 Ga0501035_0317509
534 Ga0501044_0040244
535 Ga0501044_0046661
536 Ga0501044_0245699
537 Ga0501045_0077517
538 nmdc:mga03n38_151311_c1
539 nmdc:mga00v17_37522_c1
540 nmdc:mga0yw44_154766_c1
541 nmdc:mga0yw44_248735_c1
542 nmdc:mga07m45_5541_c1
543 Ga0495655_0004158
544 Ga0495619_0043251
545 Ga0500578_0009710
546 Ga0500644_0000315
547 Ga0500640_033131
548 Ga0500560_006362
549 Ga0500569_013156
550 Ga0500658_0028250
551 Ga0500579_017070
552 Ga0500600_0009525
553 Ga0500616_0070559
554 Ga0500633_0005923
555 Ga0500634_0000949
556 Ga0501084_0012734
557 Ga0501082_0037564
558 Ga0501082_0239098
559 Ga0466962_0010291
560 Ga0466962_0103197
561 Ga0466962_0218583
562 2517762162
563 2548698370
564 2554258560
565 2586063277
566 2643759779
567 2643828089
568 2643897904
569 2643961475
570 2644032410
571 2644409049
572 2644462802
573 2644516968
574 2644531178
575 2671839900
576 2689991680
577 2689991687
578 2740166609
579 2774858056
580 2785368611
581 2809587575
582 2812334135
583 2837272386
584 2862184871
585 2862383869
586 2863405509
587 2867348157
588 2867371117
589 2870790995
590 2875393815
591 2877681900
592 2891331362
593 2895887716
594 2899362847
595 2919715568
596 2946050837
597 2947230317
598 3006399661
599 8003320150
600 8025536973
601 8054165026
602 8054919851

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

263

292

0.97

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

145

236

0.97

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

1

129

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eth-assembly1.cif.gz_5 ytm1 associated 60s nascent ribosome state 1b 0.7762 36 69
8glv-assembly1.cif.gz_Do 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.7225 40 70
3twl-assembly1.cif.gz_A crystal structure of arabidopsis thaliana fpg 0.6663 2 184
6fbu-assembly1.cif.gz_A crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (e2q) in complex with ap-site containing dna substrate 0.6271 4 251
2opf-assembly1.cif.gz_A crystal structure of the dna repair enzyme endonuclease-viii (nei) from e. coli (r252a) in complex with ap-site containing dna substrate 0.626 2 251
ID Description Score Start End Superfamily
af_P9WNB9_2_120_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9865 4 115 3.20.190.10
af_P9WNB9_2_120_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.9213 4 115 3.20.190.10
1q39A01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8502 6 121 3.20.190.10
af_P9WNC1_2_123_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8475 4 121 3.20.190.10
af_P9WNC1_2_123_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8155 4 121 3.20.190.10
ID Description Score Start End GO Terms
AF-A0A6B3H099-F1-model_v4 Fpg/Nei family DNA glycosylase 0.984 20 116 GO:0000703
GO:0003906
GO:0006284
GO:0008270
AF-A0A0L8QG26-F1-model_v4 deleted 0.9757 1 124
AF-A0A0L8QG26-F1-model_v4 deleted 0.968 1 124
AF-A0A6B3H099-F1-model_v4 Fpg/Nei family DNA glycosylase 0.9644 20 116 GO:0000703
GO:0003906
GO:0006284
GO:0008270
AF-A0A7Y8X104-F1-model_v4 Fpg/Nei family DNA glycosylase 0.961 1 75 GO:0000703
GO:0003906
GO:0006284
GO:0008270

Map