F396115

General Info

Members Datasets Scaffolds Average Seq Length
301 177 602 155

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0014626|Ga0495680_0014626_1197_1793
Length 185
Sequence MRSRLVLSAAAGFALSATTVGAALKTVNRPAFVGFYDGHKDTYLNTDVSSKADAKTMHINYSARLKSISGLPEIYLVEGRAAAGQLAVFGSEPGESNYSPLWSETILTWKAGATPVVITSDTQIDKIEKTGKLTERDAHVVLNCPIIKIGTAVGHVPPTASSWRAATCPNISTEVDRTSSPPRRW

Samples

Sample ID Description Type Environment
1 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
68 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
98 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
99 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
100 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
101 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
102 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
143 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
144 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
153 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
171 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.71
Metatranscriptomes 12.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.97
Rhizosphere 91.69
Stem 0
Stem Tuber 0
Unclassified 37.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495680_0014626 3300047322 Bacteria 6792
2 Ga0058863_10027861 3300004799 Bacteria 599
3 Ga0058862_10017469 3300004803 Unclassified 1344
4 Ga0058862_10017689 3300004803 Bacteria 574
5 Ga0058862_10038759 3300004803 Unclassified 552
6 Ga0058862_12648593 3300004803 Unclassified 557
7 Ga0058862_12874458 3300004803 Bacteria 768
8 Ga0070658_10021374 3300005327 Bacteria 5186
9 Ga0070658_10103450 3300005327 Bacteria 2355
10 Ga0070658_10229274 3300005327 Unclassified 1572
11 Ga0070683_100043043 3300005329 Bacteria 4160
12 Ga0070683_100378834 3300005329 Bacteria 1348
13 Ga0068869_101069663 3300005334 Bacteria 705
14 Ga0070680_100002541 3300005336 Bacteria 13513
15 Ga0070680_100257620 3300005336 Bacteria 1475
16 Ga0070682_100054312 3300005337 Bacteria 2513
17 Ga0070682_100956688 3300005337 Unclassified 708
18 Ga0070682_101274419 3300005337 Bacteria 623
19 Ga0070660_100142231 3300005339 Unclassified 1925
20 Ga0070660_100150458 3300005339 Unclassified 1871
21 Ga0070661_100023208 3300005344 Bacteria 4446
22 Ga0070671_100200269 3300005355 Bacteria 1693
23 Ga0070674_100131393 3300005356 Bacteria 1867
24 Ga0070659_100175595 3300005366 Unclassified 1757
25 Ga0070709_10003994 3300005434 Bacteria 7956
26 Ga0070714_100060033 3300005435 Bacteria 3263
27 Ga0070714_100141716 3300005435 Unclassified 2159
28 Ga0070714_100211510 3300005435 Bacteria 1778
29 Ga0070710_10531313 3300005437 Unclassified 809
30 Ga0070711_100002699 3300005439 Bacteria 10180
31 Ga0070711_100019338 3300005439 Bacteria 4368
32 Ga0070694_100043927 3300005444 Bacteria 2990
33 Ga0070694_100090557 3300005444 Bacteria 2145
34 Ga0070678_100109898 3300005456 Bacteria 2155
35 Ga0070681_10186194 3300005458 Bacteria 1997
36 Ga0070681_10351841 3300005458 Bacteria 1383
37 Ga0070681_10504916 3300005458 Bacteria 1122
38 Ga0070681_11021172 3300005458 Unclassified 747
39 Ga0070681_11458883 3300005458 Bacteria 608
40 Ga0068867_100945948 3300005459 Unclassified 778
41 Ga0070706_100294030 3300005467 Unclassified 1516
42 Ga0070706_100301247 3300005467 Bacteria 1496
43 Ga0070707_100106168 3300005468 Bacteria 2724
44 Ga0070707_100323056 3300005468 Bacteria 1500
45 Ga0070707_101069274 3300005468 Bacteria 773
46 Ga0070698_100152651 3300005471 Bacteria 2256
47 Ga0070698_100867803 3300005471 Bacteria 848
48 Ga0070699_100497581 3300005518 Bacteria 1107
49 Ga0070679_100133519 3300005530 Bacteria 2463
50 Ga0070679_100257766 3300005530 Bacteria 1699
51 Ga0070684_100027885 3300005535 Bacteria 4771
52 Ga0070684_100720540 3300005535 Unclassified 930
53 Ga0068853_100610101 3300005539 Bacteria 1037
54 Ga0070696_100008252 3300005546 Bacteria 6971
55 Ga0068855_100049422 3300005563 Bacteria 4960
56 Ga0068855_100388803 3300005563 Bacteria 1530
57 Ga0070664_100598843 3300005564 Bacteria 1022
58 Ga0068856_100246201 3300005614 Bacteria 1803
59 Ga0070702_100068154 3300005615 Bacteria 2093
60 Ga0068852_100144290 3300005616 Bacteria 2206
61 Ga0068852_100196670 3300005616 Unclassified 1906
62 Ga0068858_100452758 3300005842 Bacteria 1237
63 Ga0070717_11454215 3300006028 Unclassified 622
64 Ga0075432_10201434 3300006058 Unclassified 788
65 Ga0070715_10000365 3300006163 Bacteria 11331
66 Ga0070716_100005705 3300006173 Bacteria 6045
67 Ga0075433_10632528 3300006852 Unclassified 939
68 Ga0075434_101186245 3300006871 Bacteria 776
69 Ga0068865_101306643 3300006881 Bacteria 645
70 Ga0075435_100605594 3300007076 Unclassified 950
71 Ga0075435_100888110 3300007076 Unclassified 777
72 Ga0075435_101130048 3300007076 Unclassified 685
73 Ga0105240_10084018 3300009093 Bacteria 3905
74 Ga0105240_10114108 3300009093 Bacteria 3264
75 Ga0105245_11440221 3300009098 Unclassified 739
76 Ga0114129_10583688 3300009147 Bacteria 1450
77 Ga0105243_10136556 3300009148 Bacteria 2087
78 Ga0105241_11278682 3300009174 Unclassified 698
79 Ga0105242_10265648 3300009176 Bacteria 1552
80 Ga0105237_10014503 3300009545 Bacteria 8237
81 Ga0105237_10943372 3300009545 Bacteria 870
82 Ga0105238_10347161 3300009551 Unclassified 1473
83 Ga0154012_128080 3300013059 Unclassified 720
84 Ga0157373_10261296 3300013100 Bacteria 1225
85 Ga0157371_10524530 3300013102 Bacteria 876
86 Ga0157370_10046230 3300013104 Bacteria 4174
87 Ga0157370_10141260 3300013104 Unclassified 2243
88 Ga0157370_11247472 3300013104 Unclassified 670
89 Ga0157369_10352553 3300013105 Bacteria 1528
90 Ga0157374_10149004 3300013296 Bacteria 2274
91 Ga0157374_10518208 3300013296 Bacteria 1198
92 Ga0157374_11249297 3300013296 Unclassified 764
93 Ga0163162_10306286 3300013306 Unclassified 1721
94 Ga0157372_10390941 3300013307 Bacteria 1621
95 Ga0157372_11294683 3300013307 Unclassified 841
96 Ga0157372_11504439 3300013307 Unclassified 775
97 Ga0157375_11756922 3300013308 Unclassified 735
98 Ga0157375_12220951 3300013308 Bacteria 654
99 Ga0182008_10273649 3300014497 Bacteria 877
100 Ga0157379_10636355 3300014968 Bacteria 998
101 Ga0157376_10549560 3300014969 Unclassified 1143
102 Ga0197907_10001932 3300020069 Bacteria 2272
103 Ga0197907_10929459 3300020069 Bacteria 1709
104 Ga0197907_10937764 3300020069 Unclassified 1002
105 Ga0206356_11394216 3300020070 Bacteria 1034
106 Ga0206356_11871969 3300020070 Unclassified 1349
107 Ga0206349_1325420 3300020075 Unclassified 2254
108 Ga0206349_1478788 3300020075 Bacteria 2594
109 Ga0206349_1928673 3300020075 Unclassified 568
110 Ga0206355_1279313 3300020076 Bacteria 1286
111 Ga0206355_1472004 3300020076 Unclassified 1119
112 Ga0206355_1517385 3300020076 Bacteria 941
113 Ga0206351_10540625 3300020077 Unclassified 718
114 Ga0206350_10656376 3300020080 Unclassified 611
115 Ga0206350_10825078 3300020080 Bacteria 2929
116 Ga0206350_10859636 3300020080 Unclassified 1059
117 Ga0206354_10230124 3300020081 Unclassified 850
118 Ga0206354_10495519 3300020081 Bacteria 630
119 Ga0206354_11392818 3300020081 Unclassified 672
120 Ga0206353_10032887 3300020082 Unclassified 1061
121 Ga0206353_10076620 3300020082 Bacteria 1032
122 Ga0206353_11716739 3300020082 Bacteria 721
123 Ga0206353_12045145 3300020082 Unclassified 1878
124 Ga0154015_1217092 3300020610 Unclassified 770
125 Ga0224712_10064303 3300022467 Unclassified 1471
126 Ga0224712_10074839 3300022467 Unclassified 1384
127 Ga0224712_10303086 3300022467 Unclassified 748
128 Ga0207692_10141201 3300025898 Bacteria 1370
129 Ga0207705_10075256 3300025909 Bacteria 2452
130 Ga0207705_10187867 3300025909 Bacteria 1561
131 Ga0207684_10237967 3300025910 Bacteria 1571
132 Ga0207707_10029938 3300025912 Bacteria 4760
133 Ga0207707_10077994 3300025912 Bacteria 2892
134 Ga0207707_10282193 3300025912 Bacteria 1438
135 Ga0207707_10772527 3300025912 Unclassified 802
136 Ga0207695_10483856 3300025913 Unclassified 1120
137 Ga0207671_10317911 3300025914 Bacteria 1232
138 Ga0207693_10000867 3300025915 Bacteria 27046
139 Ga0207660_10140165 3300025917 Bacteria 1848
140 Ga0207657_10009230 3300025919 Bacteria 9942
141 Ga0207657_10069591 3300025919 Unclassified 2985
142 Ga0207657_10398260 3300025919 Unclassified 1083
143 Ga0207649_10182958 3300025920 Bacteria 1468
144 Ga0207652_10041627 3300025921 Bacteria 3906
145 Ga0207652_10067052 3300025921 Unclassified 3111
146 Ga0207652_10493784 3300025921 Unclassified 1102
147 Ga0207646_10064855 3300025922 Bacteria 3260
148 Ga0207646_10213359 3300025922 Bacteria 1743
149 Ga0207646_10338930 3300025922 Bacteria 1358
150 Ga0207646_10734668 3300025922 Bacteria 881
151 Ga0207694_10157028 3300025924 Unclassified 1835
152 Ga0207664_10270454 3300025929 Bacteria 1489
153 Ga0207664_10331203 3300025929 Bacteria 1345
154 Ga0207664_11642902 3300025929 Unclassified 565
155 Ga0207644_10462113 3300025931 Bacteria 1044
156 Ga0207665_10000490 3300025939 Bacteria 26757
157 Ga0207661_10105571 3300025944 Bacteria 2374
158 Ga0207661_10949897 3300025944 Unclassified 792
159 Ga0207679_10313171 3300025945 Bacteria 1357
160 Ga0207667_10364643 3300025949 Bacteria 1473
161 Ga0207678_10749964 3300026067 Unclassified 861
162 Ga0207702_10471356 3300026078 Bacteria 1221
163 Ga0207698_10849446 3300026142 Bacteria 918
164 Ga0265324_10031983 3300029957 Bacteria 1840
165 Ga0373948_0022835 3300034817 Bacteria 1209
166 Ga0373950_0100178 3300034818 Unclassified 624
167 Ga0373929_0004053 3300035085 Bacteria 2624
168 Ga0373940_0030721 3300035088 Bacteria 1430
169 Ga0373949_0002831 3300035090 Bacteria 4309
170 Ga0373951_0004357 3300035091 Bacteria 3367
171 Ga0373936_0044718 3300035113 Unclassified 1782
172 Ga0373941_0272223 3300035115 Unclassified 667
173 Ga0373945_0022956 3300035116 Unclassified 2153
174 Ga0373960_0012433 3300035121 Bacteria 2115
175 Ga0373943_0014049 3300035170 Bacteria 3620
176 Ga0373946_0031761 3300035171 Unclassified 2118
177 Ga0373942_0002416 3300035207 Bacteria 4537
178 Ga0373931_0002107 3300035691 Bacteria 8761
179 Ga0373935_0198801 3300035692 Bacteria 1384
180 Ga0373947_0006363 3300035725 Bacteria 6863
181 Ga0373947_1054105 3300035725 Unclassified 554
182 Ga0373937_0071688 3300036401 Bacteria 3195
183 Ga0373925_0012583 3300037068 Bacteria 6132
184 Ga0373925_0072678 3300037068 Unclassified 2602
185 Ga0373925_0875313 3300037068 Bacteria 740
186 Ga0395899_0033103 3300037312 Unclassified 3882
187 Ga0395899_0062449 3300037312 Bacteria 2743
188 Ga0395900_0240253 3300037418 Bacteria 1817
189 Ga0395898_0002056 3300037466 Bacteria 25072
190 Ga0395898_0136283 3300037466 Bacteria 2351
191 Ga0395898_0219096 3300037466 Bacteria 1815
192 Ga0395898_0630241 3300037466 Bacteria 1015
193 Ga0395898_1355875 3300037466 Unclassified 640
194 Ga0395905_0047483 3300037471 Bacteria 4024
195 Ga0395905_0131019 3300037471 Unclassified 2358
196 Ga0395905_0703938 3300037471 Unclassified 912
197 Ga0395901_0001232 3300038443 Bacteria 27296
198 Ga0395901_0009210 3300038443 Bacteria 10002
199 Ga0395901_0598024 3300038443 Bacteria 1112
200 Ga0395901_1066736 3300038443 Bacteria 780
201 Ga0436363_1103151 3300039450 Unclassified 821
202 Ga0439448_0140612 3300042005 Bacteria 835
203 Ga0466972_0069624 3300044658 Bacteria 1680
204 Ga0466961_0070798 3300044693 Bacteria 2214
205 Ga0466963_0002436 3300044694 Bacteria 10408
206 Ga0466963_0006469 3300044694 Bacteria 6930
207 Ga0466963_0043247 3300044694 Bacteria 2961
208 Ga0466963_0094091 3300044694 Bacteria 2043
209 Ga0466963_0094638 3300044694 Bacteria 2038
210 Ga0466964_0082182 3300044706 Unclassified 1385
211 Ga0466971_0082658 3300044719 Bacteria 1466
212 Ga0466971_0191278 3300044719 Unclassified 964
213 Ga0466968_0195519 3300044735 Bacteria 945
214 Ga0466957_0012599 3300044842 Bacteria 4896
215 Ga0466957_0098473 3300044842 Unclassified 1840
216 Ga0466957_0110708 3300044842 Bacteria 1741
217 Ga0466960_0061942 3300044901 Bacteria 1838
218 Ga0466959_0344262 3300045049 Unclassified 1017
219 Ga0466959_0376908 3300045049 Bacteria 966
220 Ga0466958_0000168 3300045836 Bacteria 23429
221 Ga0466958_0040680 3300045836 Bacteria 2794
222 Ga0466958_0061052 3300045836 Bacteria 2295
223 Ga0466958_0120818 3300045836 Bacteria 1640
224 Ga0466958_0272056 3300045836 Bacteria 1085
225 Ga0466958_0861027 3300045836 Bacteria 591
226 Ga0466967_0000962 3300045976 Bacteria 15624
227 Ga0466967_0012870 3300045976 Bacteria 6430
228 Ga0466967_0017753 3300045976 Bacteria 5662
229 Ga0466967_0021879 3300045976 Bacteria 5204
230 Ga0466967_0042557 3300045976 Bacteria 3926
231 Ga0466967_0065276 3300045976 Bacteria 3239
232 Ga0466967_0073788 3300045976 Bacteria 3062
233 Ga0466967_0085990 3300045976 Bacteria 2848
234 Ga0466967_0087945 3300045976 Bacteria 2818
235 Ga0466967_0123232 3300045976 Unclassified 2398
236 Ga0466967_0324690 3300045976 Bacteria 1485
237 Ga0466967_0638608 3300045976 Bacteria 1052
238 Ga0466967_1423894 3300045976 Bacteria 690
239 Ga0495592_0249491 3300046454 Unclassified 1174
240 Ga0495651_0143455 3300046462 Unclassified 1729
241 Ga0495651_0158845 3300046462 Bacteria 1622
242 Ga0495653_0170919 3300046463 Unclassified 1500
243 Ga0495608_0029440 3300046511 Unclassified 3724
244 Ga0495630_0075252 3300046517 Unclassified 2544
245 Ga0495630_0539930 3300046517 Unclassified 894
246 Ga0495652_0055193 3300046529 Plasmid 3380
247 Ga0495652_0739365 3300046529 Unclassified 659
248 Ga0495640_0021234 3300046533 Plasmid 4768
249 Ga0495587_0381847 3300046536 Unclassified 784
250 Ga0495634_0023373 3300046642 Plasmid 4346
251 Ga0495657_0040478 3300046675 Bacteria 3196
252 Ga0495657_0060159 3300046675 Unclassified 2518
253 Ga0495599_0174898 3300046678 Unclassified 1324
254 Ga0495623_0439036 3300046679 Unclassified 697
255 Ga0495647_0432779 3300046681 Unclassified 607
256 Ga0495658_0194158 3300046683 Bacteria 1263
257 Ga0495658_0454495 3300046683 Unclassified 818
258 Ga0495613_0233140 3300046689 Unclassified 1289
259 Ga0495613_0422856 3300046689 Unclassified 906
260 Ga0495604_0338535 3300047317 Unclassified 1002
261 Ga0495674_0001541 3300047319 Bacteria 22535
262 Ga0495676_0289362 3300047321 Bacteria 1107
263 Ga0495684_0105086 3300047471 Unclassified 2134
264 Ga0495593_0046966 3300047673 Bacteria 2299
265 Ga0495602_0213467 3300048088 Bacteria 1462
266 Ga0496101_1138908 3300048904 Unclassified 612
267 Ga0496102_0089243 3300048905 Unclassified 2851
268 Ga0496102_0107426 3300048905 Bacteria 2598
269 Ga0496103_0039781 3300048906 Bacteria 2890
270 Ga0496104_0479658 3300048907 Bacteria 1155
271 Ga0496104_1085689 3300048907 Unclassified 704
272 Ga0496105_0066162 3300048908 Bacteria 2983
273 Ga0496105_0601037 3300048908 Unclassified 854
274 Ga0496106_0057855 3300048909 Bacteria 2932
275 Ga0496106_1125449 3300048909 Unclassified 614
276 Ga0496107_0276154 3300048910 Bacteria 1251
277 Ga0496109_0011826 3300048912 Bacteria 7514
278 Ga0496110_0084611 3300048913 Unclassified 2831
279 Ga0496110_0220188 3300048913 Unclassified 1726
280 Ga0496111_0125470 3300048914 Unclassified 1897
281 Ga0496111_0410419 3300048914 Unclassified 1000
282 Ga0496112_0149926 3300048915 Bacteria 2299
283 Ga0496112_0326837 3300048915 Unclassified 1477
284 Ga0496112_0515108 3300048915 Unclassified 1131
285 Ga0496113_0049844 3300048916 Bacteria 3119
286 Ga0496114_0016467 3300048917 Bacteria 5958
287 Ga0496114_0393761 3300048917 Bacteria 1227
288 Ga0496115_0027203 3300048918 Bacteria 4471
289 Ga0496115_0773340 3300048918 Unclassified 749
290 Ga0501067_0036386 3300049583 Bacteria 2733
291 nmdc:mga05p37_855734_c1 3300050507 Unclassified 987
292 nmdc:mga0n895_128721_c1 3300050512 Bacteria 2556
293 nmdc:mga0n895_403671_c1 3300050512 Bacteria 1382
294 nmdc:mga0a205_442714_c1 3300050515 Bacteria 1160
295 Ga0495619_0104779 3300053085 Unclassified 1928
296 Ga0495619_1097103 3300053085 Unclassified 530
297 Ga0587073_0236038 3300059492 Unclassified 566
298 Ga0587083_0091051 3300059505 Unclassified 744
299 Ga0587101_097125 3300059623 Unclassified 581
300 Ga0587075_061867 3300059644 Unclassified 677
301 Ga0466962_0203912 3300061719 Unclassified 967
302 Ga0495680_0014626
303 Ga0058863_10027861
304 Ga0058862_10017469
305 Ga0058862_10017689
306 Ga0058862_10038759
307 Ga0058862_12648593
308 Ga0058862_12874458
309 Ga0070658_10021374
310 Ga0070658_10103450
311 Ga0070658_10229274
312 Ga0070683_100043043
313 Ga0070683_100378834
314 Ga0068869_101069663
315 Ga0070680_100002541
316 Ga0070680_100257620
317 Ga0070682_100054312
318 Ga0070682_100956688
319 Ga0070682_101274419
320 Ga0070660_100142231
321 Ga0070660_100150458
322 Ga0070661_100023208
323 Ga0070671_100200269
324 Ga0070674_100131393
325 Ga0070659_100175595
326 Ga0070709_10003994
327 Ga0070714_100060033
328 Ga0070714_100141716
329 Ga0070714_100211510
330 Ga0070710_10531313
331 Ga0070711_100002699
332 Ga0070711_100019338
333 Ga0070694_100043927
334 Ga0070694_100090557
335 Ga0070678_100109898
336 Ga0070681_10186194
337 Ga0070681_10351841
338 Ga0070681_10504916
339 Ga0070681_11021172
340 Ga0070681_11458883
341 Ga0068867_100945948
342 Ga0070706_100294030
343 Ga0070706_100301247
344 Ga0070707_100106168
345 Ga0070707_100323056
346 Ga0070707_101069274
347 Ga0070698_100152651
348 Ga0070698_100867803
349 Ga0070699_100497581
350 Ga0070679_100133519
351 Ga0070679_100257766
352 Ga0070684_100027885
353 Ga0070684_100720540
354 Ga0068853_100610101
355 Ga0070696_100008252
356 Ga0068855_100049422
357 Ga0068855_100388803
358 Ga0070664_100598843
359 Ga0068856_100246201
360 Ga0070702_100068154
361 Ga0068852_100144290
362 Ga0068852_100196670
363 Ga0068858_100452758
364 Ga0070717_11454215
365 Ga0075432_10201434
366 Ga0070715_10000365
367 Ga0070716_100005705
368 Ga0075433_10632528
369 Ga0075434_101186245
370 Ga0068865_101306643
371 Ga0075435_100605594
372 Ga0075435_100888110
373 Ga0075435_101130048
374 Ga0105240_10084018
375 Ga0105240_10114108
376 Ga0105245_11440221
377 Ga0114129_10583688
378 Ga0105243_10136556
379 Ga0105241_11278682
380 Ga0105242_10265648
381 Ga0105237_10014503
382 Ga0105237_10943372
383 Ga0105238_10347161
384 Ga0154012_128080
385 Ga0157373_10261296
386 Ga0157371_10524530
387 Ga0157370_10046230
388 Ga0157370_10141260
389 Ga0157370_11247472
390 Ga0157369_10352553
391 Ga0157374_10149004
392 Ga0157374_10518208
393 Ga0157374_11249297
394 Ga0163162_10306286
395 Ga0157372_10390941
396 Ga0157372_11294683
397 Ga0157372_11504439
398 Ga0157375_11756922
399 Ga0157375_12220951
400 Ga0182008_10273649
401 Ga0157379_10636355
402 Ga0157376_10549560
403 Ga0197907_10001932
404 Ga0197907_10929459
405 Ga0197907_10937764
406 Ga0206356_11394216
407 Ga0206356_11871969
408 Ga0206349_1325420
409 Ga0206349_1478788
410 Ga0206349_1928673
411 Ga0206355_1279313
412 Ga0206355_1472004
413 Ga0206355_1517385
414 Ga0206351_10540625
415 Ga0206350_10656376
416 Ga0206350_10825078
417 Ga0206350_10859636
418 Ga0206354_10230124
419 Ga0206354_10495519
420 Ga0206354_11392818
421 Ga0206353_10032887
422 Ga0206353_10076620
423 Ga0206353_11716739
424 Ga0206353_12045145
425 Ga0154015_1217092
426 Ga0224712_10064303
427 Ga0224712_10074839
428 Ga0224712_10303086
429 Ga0207692_10141201
430 Ga0207705_10075256
431 Ga0207705_10187867
432 Ga0207684_10237967
433 Ga0207707_10029938
434 Ga0207707_10077994
435 Ga0207707_10282193
436 Ga0207707_10772527
437 Ga0207695_10483856
438 Ga0207671_10317911
439 Ga0207693_10000867
440 Ga0207660_10140165
441 Ga0207657_10009230
442 Ga0207657_10069591
443 Ga0207657_10398260
444 Ga0207649_10182958
445 Ga0207652_10041627
446 Ga0207652_10067052
447 Ga0207652_10493784
448 Ga0207646_10064855
449 Ga0207646_10213359
450 Ga0207646_10338930
451 Ga0207646_10734668
452 Ga0207694_10157028
453 Ga0207664_10270454
454 Ga0207664_10331203
455 Ga0207664_11642902
456 Ga0207644_10462113
457 Ga0207665_10000490
458 Ga0207661_10105571
459 Ga0207661_10949897
460 Ga0207679_10313171
461 Ga0207667_10364643
462 Ga0207678_10749964
463 Ga0207702_10471356
464 Ga0207698_10849446
465 Ga0265324_10031983
466 Ga0373948_0022835
467 Ga0373950_0100178
468 Ga0373929_0004053
469 Ga0373940_0030721
470 Ga0373949_0002831
471 Ga0373951_0004357
472 Ga0373936_0044718
473 Ga0373941_0272223
474 Ga0373945_0022956
475 Ga0373960_0012433
476 Ga0373943_0014049
477 Ga0373946_0031761
478 Ga0373942_0002416
479 Ga0373931_0002107
480 Ga0373935_0198801
481 Ga0373947_0006363
482 Ga0373947_1054105
483 Ga0373937_0071688
484 Ga0373925_0012583
485 Ga0373925_0072678
486 Ga0373925_0875313
487 Ga0395899_0033103
488 Ga0395899_0062449
489 Ga0395900_0240253
490 Ga0395898_0002056
491 Ga0395898_0136283
492 Ga0395898_0219096
493 Ga0395898_0630241
494 Ga0395898_1355875
495 Ga0395905_0047483
496 Ga0395905_0131019
497 Ga0395905_0703938
498 Ga0395901_0001232
499 Ga0395901_0009210
500 Ga0395901_0598024
501 Ga0395901_1066736
502 Ga0436363_1103151
503 Ga0439448_0140612
504 Ga0466972_0069624
505 Ga0466961_0070798
506 Ga0466963_0002436
507 Ga0466963_0006469
508 Ga0466963_0043247
509 Ga0466963_0094091
510 Ga0466963_0094638
511 Ga0466964_0082182
512 Ga0466971_0082658
513 Ga0466971_0191278
514 Ga0466968_0195519
515 Ga0466957_0012599
516 Ga0466957_0098473
517 Ga0466957_0110708
518 Ga0466960_0061942
519 Ga0466959_0344262
520 Ga0466959_0376908
521 Ga0466958_0000168
522 Ga0466958_0040680
523 Ga0466958_0061052
524 Ga0466958_0120818
525 Ga0466958_0272056
526 Ga0466958_0861027
527 Ga0466967_0000962
528 Ga0466967_0012870
529 Ga0466967_0017753
530 Ga0466967_0021879
531 Ga0466967_0042557
532 Ga0466967_0065276
533 Ga0466967_0073788
534 Ga0466967_0085990
535 Ga0466967_0087945
536 Ga0466967_0123232
537 Ga0466967_0324690
538 Ga0466967_0638608
539 Ga0466967_1423894
540 Ga0495592_0249491
541 Ga0495651_0143455
542 Ga0495651_0158845
543 Ga0495653_0170919
544 Ga0495608_0029440
545 Ga0495630_0075252
546 Ga0495630_0539930
547 Ga0495652_0055193
548 Ga0495652_0739365
549 Ga0495640_0021234
550 Ga0495587_0381847
551 Ga0495634_0023373
552 Ga0495657_0040478
553 Ga0495657_0060159
554 Ga0495599_0174898
555 Ga0495623_0439036
556 Ga0495647_0432779
557 Ga0495658_0194158
558 Ga0495658_0454495
559 Ga0495613_0233140
560 Ga0495613_0422856
561 Ga0495604_0338535
562 Ga0495674_0001541
563 Ga0495676_0289362
564 Ga0495684_0105086
565 Ga0495593_0046966
566 Ga0495602_0213467
567 Ga0496101_1138908
568 Ga0496102_0089243
569 Ga0496102_0107426
570 Ga0496103_0039781
571 Ga0496104_0479658
572 Ga0496104_1085689
573 Ga0496105_0066162
574 Ga0496105_0601037
575 Ga0496106_0057855
576 Ga0496106_1125449
577 Ga0496107_0276154
578 Ga0496109_0011826
579 Ga0496110_0084611
580 Ga0496110_0220188
581 Ga0496111_0125470
582 Ga0496111_0410419
583 Ga0496112_0149926
584 Ga0496112_0326837
585 Ga0496112_0515108
586 Ga0496113_0049844
587 Ga0496114_0016467
588 Ga0496114_0393761
589 Ga0496115_0027203
590 Ga0496115_0773340
591 Ga0501067_0036386
592 nmdc:mga05p37_855734_c1
593 nmdc:mga0n895_128721_c1
594 nmdc:mga0n895_403671_c1
595 nmdc:mga0a205_442714_c1
596 Ga0495619_0104779
597 Ga0495619_1097103
598 Ga0587073_0236038
599 Ga0587083_0091051
600 Ga0587101_097125
601 Ga0587075_061867
602 Ga0466962_0203912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24298

37

155

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6q-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 with an insertion of calmodulin-m13 fusion at position 154-156 that mimic the structure of caprola, an calcium gated protein labeling technology 0.6589 30 55
8ooh-assembly1.cif.gz_A cryo-em map of the focused refinement of the subfamily iii haloalkane dehalogenase from haloferax mediterranei dimer forming hexameric assembly. 0.6046 36 59
7ziz-assembly1.cif.gz_A x-ray structure of the dead variant haloalkane dehalogenase halotag7-d106a bound to a pentanol tetramethylrhodamine ligand (tmr-hy5) 0.5333 30 87
3oos-assembly1.cif.gz_A the structure of an alpha/beta fold family hydrolase from bacillus anthracis str. sterne 0.5218 37 55
7o3o-assembly1.cif.gz_A structure of haloalkane dehalogenase mutant dhaa80(t148l, g171q, a172v, c176f) from rhodococcus rhodochrous with ionic liquid 0.507 36 91
ID Description Score Start End Superfamily
af_Q6K4V7_60_325_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6193 33 54 2.120.10.80
af_P9WMS1_7_285_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6145 36 55 3.40.50.1820
af_Q59K07_1_121_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.497 31 56 2.30.30.140
af_P15992_59_207_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.4245 29 54 2.60.40.790
af_B0UYS2_150_250_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.3963 29 66 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A7Y5WXE2-F1-model_v4 Uncharacterized protein 0.9869 32 161
AF-A0A538FVV2-F1-model_v4 Uncharacterized protein 0.9598 23 161
AF-A0A7Y5WXE2-F1-model_v4 Uncharacterized protein 0.9577 32 161
AF-A0A537C911-F1-model_v4 Uncharacterized protein 0.9413 109 151
AF-A0A2E0L275-F1-model_v4 Twin-arginine translocation signal domain-containing protein 0.9377 39 156

Map