F396057

General Info

Members Datasets Scaffolds Average Seq Length
301 160 602 224

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0064392|Ga0466965_0064392_479_1204
Length 241
Sequence MSLPDWLDLAHDASSVVAHAAEASVGPLRVLIADDHAPTRDDVCRALTEGGLVVCAEAANAARAVQQALETRPDICLLDVRMPGGGVAAAWEISARLPTTKIVMFTVSDEDGDLFRALRAGAASYLLKDIDLDSLPQALRDVAEGKAAIPPALVARLVAQFHSSDPRFRTTEVGAEFGPRLTSREWDVLAGLAEGLSTRDIARRLQLKPSGVRAHISAVVQKLGVADRHEAVAFFQDASNA

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
53 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
54 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
55 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
63 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
64 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
74 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
75 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
84 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
87 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
92 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
96 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
97 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
98 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
99 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
100 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
101 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
102 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
109 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
110 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
111 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
112 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
113 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
114 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
125 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
138 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
139 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
155 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.62
Rhizosphere 87.04
Stem 0
Stem Tuber 0
Unclassified 18.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0064392 3300044683 Bacteria 1835
2 rootH2_10104959 3300003320 Bacteria 1650
3 Ga0070658_10027116 3300005327 Bacteria 4599
4 Ga0070683_100012564 3300005329 Bacteria 7360
5 Ga0070680_100095875 3300005336 Bacteria 2460
6 Ga0068868_100296139 3300005338 Bacteria 1373
7 Ga0070660_100492021 3300005339 Unclassified 1020
8 Ga0070691_10055997 3300005341 Unclassified 1889
9 Ga0070691_10192148 3300005341 Bacteria 1068
10 Ga0070692_10154237 3300005345 Unclassified 1311
11 Ga0070659_100023942 3300005366 Bacteria 4677
12 Ga0070709_10162997 3300005434 Bacteria 1552
13 Ga0070709_10218845 3300005434 Unclassified 1357
14 Ga0070714_100002714 3300005435 Bacteria 13050
15 Ga0070714_100303264 3300005435 Bacteria 1489
16 Ga0070713_100005793 3300005436 Bacteria 8492
17 Ga0070713_100573934 3300005436 Bacteria 1070
18 Ga0070711_100071551 3300005439 Bacteria 2444
19 Ga0070681_10099713 3300005458 Bacteria 2850
20 Ga0070707_100001296 3300005468 Bacteria 24594
21 Ga0070699_100876484 3300005518 Bacteria 822
22 Ga0070679_100060823 3300005530 Unclassified 3765
23 Ga0070679_100136516 3300005530 Bacteria 2433
24 Ga0070684_100009703 3300005535 Bacteria 7595
25 Ga0070684_100457476 3300005535 Bacteria 1180
26 Ga0070695_100001872 3300005545 Bacteria 11885
27 Ga0070693_100056626 3300005547 Unclassified 2263
28 Ga0070664_100034744 3300005564 Unclassified 4229
29 Ga0068856_100019693 3300005614 Bacteria 6548
30 Ga0068856_100347525 3300005614 Bacteria 1502
31 Ga0070702_100444417 3300005615 Bacteria 939
32 Ga0068863_100259981 3300005841 Bacteria 1678
33 Ga0081455_10131107 3300005937 Bacteria 1960
34 Ga0070717_10058683 3300006028 Unclassified 3182
35 Ga0070717_10173217 3300006028 Bacteria 1878
36 Ga0070717_10196207 3300006028 Bacteria 1766
37 Ga0070717_10231402 3300006028 Unclassified 1627
38 Ga0070717_10449589 3300006028 Bacteria 1161
39 Ga0070716_100175056 3300006173 Bacteria 1404
40 Ga0070712_100206788 3300006175 Unclassified 1545
41 Ga0068871_100099938 3300006358 Bacteria 2429
42 Ga0105240_10186726 3300009093 Unclassified 2441
43 Ga0105240_10467097 3300009093 Bacteria 1409
44 Ga0105245_10249938 3300009098 Bacteria 1722
45 Ga0105245_10308353 3300009098 Unclassified 1555
46 Ga0105241_10440362 3300009174 Bacteria 1151
47 Ga0105237_10124387 3300009545 Unclassified 2574
48 Ga0105238_10091850 3300009551 Unclassified 3023
49 Ga0157369_10042361 3300013105 Unclassified 4966
50 Ga0157374_10151909 3300013296 Bacteria 2251
51 Ga0182008_10156134 3300014497 Bacteria 1146
52 Ga0207692_10026451 3300025898 Bacteria 2722
53 Ga0207654_10310984 3300025911 Bacteria 1074
54 Ga0207707_10102985 3300025912 Bacteria 2495
55 Ga0207693_10025905 3300025915 Bacteria 4645
56 Ga0207663_10051341 3300025916 Unclassified 2567
57 Ga0207663_10303681 3300025916 Bacteria 1193
58 Ga0207660_10061629 3300025917 Bacteria 2700
59 Ga0207660_10075529 3300025917 Bacteria 2462
60 Ga0207700_10069397 3300025928 Bacteria 2705
61 Ga0207664_10011279 3300025929 Bacteria 6340
62 Ga0207664_10036028 3300025929 Unclassified 3822
63 Ga0207664_10087278 3300025929 Unclassified 2550
64 Ga0207664_10742783 3300025929 Unclassified 882
65 Ga0207665_10234820 3300025939 Bacteria 1349
66 Ga0207679_10031646 3300025945 Unclassified 3705
67 Ga0207702_10005895 3300026078 Bacteria 10655
68 Ga0207702_10653035 3300026078 Bacteria 1034
69 Ga0207641_10222046 3300026088 Bacteria 1753
70 Ga0207698_10845617 3300026142 Unclassified 920
71 Ga0373937_0126295 3300036401 Unclassified 2386
72 Ga0395900_0049162 3300037418 Bacteria 4344
73 Ga0395900_0468785 3300037418 Bacteria 1213
74 Ga0395898_0008986 3300037466 Bacteria 10521
75 Ga0395898_0086628 3300037466 Bacteria 3018
76 Ga0395905_0051088 3300037471 Bacteria 3872
77 Ga0395901_0010237 3300038443 Bacteria 9499
78 Ga0395901_0031067 3300038443 Bacteria 5506
79 Ga0395901_0274277 3300038443 Bacteria 1754
80 Ga0395901_0567583 3300038443 Bacteria 1148
81 Ga0466969_0033896 3300044656 Unclassified 2589
82 Ga0466966_0093040 3300044684 Bacteria 1870
83 Ga0466961_0020240 3300044693 Bacteria 4281
84 Ga0466961_0033984 3300044693 Bacteria 3276
85 Ga0466963_0000189 3300044694 Bacteria 25856
86 Ga0466963_0002284 3300044694 Bacteria 10657
87 Ga0466963_0007250 3300044694 Bacteria 6613
88 Ga0466963_0007440 3300044694 Bacteria 6528
89 Ga0466963_0010754 3300044694 Bacteria 5554
90 Ga0466963_0029966 3300044694 Bacteria 3506
91 Ga0466963_0062083 3300044694 Bacteria 2499
92 Ga0466963_0073775 3300044694 Unclassified 2301
93 Ga0466963_0140450 3300044694 Bacteria 1673
94 Ga0466963_0148183 3300044694 Bacteria 1629
95 Ga0466963_0185844 3300044694 Bacteria 1451
96 Ga0466963_0228451 3300044694 Bacteria 1304
97 Ga0466963_0455951 3300044694 Bacteria 902
98 Ga0466964_0008710 3300044706 Bacteria 3815
99 Ga0466964_0008834 3300044706 Bacteria 3787
100 Ga0466964_0019143 3300044706 Bacteria 2630
101 Ga0466964_0105581 3300044706 Bacteria 1249
102 Ga0466964_0131819 3300044706 Unclassified 1139
103 Ga0466971_0004591 3300044719 Bacteria 5967
104 Ga0466971_0015043 3300044719 Bacteria 3404
105 Ga0466971_0043608 3300044719 Unclassified 2015
106 Ga0466968_0026814 3300044735 Bacteria 2368
107 Ga0466968_0043779 3300044735 Bacteria 1896
108 Ga0466968_0080047 3300044735 Bacteria 1434
109 Ga0466970_0143548 3300044765 Unclassified 1316
110 Ga0466957_0004399 3300044842 Bacteria 7840
111 Ga0466957_0012316 3300044842 Bacteria 4951
112 Ga0466957_0047115 3300044842 Bacteria 2618
113 Ga0466957_0103366 3300044842 Bacteria 1799
114 Ga0466960_0010803 3300044901 Unclassified 3802
115 Ga0466959_0009803 3300045049 Bacteria 6826
116 Ga0466959_0010183 3300045049 Bacteria 6712
117 Ga0466959_0082341 3300045049 Bacteria 2318
118 Ga0466959_0109199 3300045049 Unclassified 1975
119 Ga0466959_0213909 3300045049 Bacteria 1339
120 Ga0466958_0000982 3300045836 Bacteria 12886
121 Ga0466958_0001940 3300045836 Bacteria 10138
122 Ga0466958_0003061 3300045836 Bacteria 8573
123 Ga0466958_0004482 3300045836 Bacteria 7370
124 Ga0466958_0031117 3300045836 Unclassified 3171
125 Ga0466958_0120995 3300045836 Bacteria 1639
126 Ga0466967_0001735 3300045976 Bacteria 12999
127 Ga0466967_0008987 3300045976 Bacteria 7382
128 Ga0466967_0038201 3300045976 Bacteria 4116
129 Ga0466967_0052420 3300045976 Bacteria 3580
130 Ga0466967_0059477 3300045976 Bacteria 3383
131 Ga0466967_0085466 3300045976 Bacteria 2856
132 Ga0466967_0091853 3300045976 Bacteria 2759
133 Ga0466967_0102265 3300045976 Bacteria 2621
134 Ga0466967_0174525 3300045976 Bacteria 2024
135 Ga0466967_0205611 3300045976 Unclassified 1866
136 Ga0466967_0206989 3300045976 Bacteria 1860
137 Ga0466967_0421235 3300045976 Bacteria 1301
138 Ga0466967_0620982 3300045976 Bacteria 1067
139 Ga0466967_0680721 3300045976 Bacteria 1018
140 Ga0495592_0002039 3300046454 Bacteria 14220
141 Ga0495592_0012083 3300046454 Bacteria 6547
142 Ga0495603_0105983 3300046455 Bacteria 1640
143 Ga0495603_0402332 3300046455 Unclassified 785
144 Ga0495629_0063547 3300046459 Bacteria 2578
145 Ga0495629_0139812 3300046459 Bacteria 1685
146 Ga0495641_0022278 3300046461 Bacteria 3172
147 Ga0495641_0095686 3300046461 Bacteria 1326
148 Ga0495641_0125783 3300046461 Bacteria 1144
149 Ga0495651_0025912 3300046462 Unclassified 4565
150 Ga0495651_0262546 3300046462 Bacteria 1174
151 Ga0495653_0019875 3300046463 Bacteria 5444
152 Ga0495653_0020862 3300046463 Bacteria 5308
153 Ga0495582_0294039 3300046473 Bacteria 933
154 Ga0495662_0099423 3300046476 Bacteria 1422
155 Ga0495664_0057148 3300046477 Bacteria 2321
156 Ga0495664_0279597 3300046477 Bacteria 1009
157 Ga0495608_0005076 3300046511 Bacteria 9406
158 Ga0495618_0040866 3300046514 Bacteria 2920
159 Ga0495618_0106023 3300046514 Bacteria 1799
160 Ga0495618_0170277 3300046514 Bacteria 1386
161 Ga0495628_0001284 3300046516 Bacteria 22994
162 Ga0495628_0014223 3300046516 Bacteria 6678
163 Ga0495630_0044176 3300046517 Bacteria 3329
164 Ga0495630_0069405 3300046517 Unclassified 2651
165 Ga0495630_0075425 3300046517 Bacteria 2541
166 Ga0495644_0142879 3300046523 Bacteria 914
167 Ga0495666_0112895 3300046526 Bacteria 1276
168 Ga0495652_0027759 3300046529 Bacteria 4985
169 Ga0495652_0099488 3300046529 Bacteria 2361
170 Ga0495640_0113123 3300046533 Unclassified 1771
171 Ga0495640_0307552 3300046533 Unclassified 983
172 Ga0495586_0003085 3300046535 Bacteria 8979
173 Ga0495586_0083425 3300046535 Bacteria 1758
174 Ga0495587_0004991 3300046536 Bacteria 8687
175 Ga0495587_0049491 3300046536 Bacteria 2487
176 Ga0495645_0001092 3300046543 Bacteria 18358
177 Ga0495667_0244607 3300046559 Bacteria 1142
178 Ga0495656_0083284 3300046615 Bacteria 1448
179 Ga0495634_0038078 3300046642 Bacteria 3280
180 Ga0495634_0386414 3300046642 Bacteria 833
181 Ga0495657_0002676 3300046675 Bacteria 14899
182 Ga0495599_0001919 3300046678 Bacteria 12038
183 Ga0495599_0006511 3300046678 Bacteria 7045
184 Ga0495623_0001576 3300046679 Bacteria 15357
185 Ga0495623_0041395 3300046679 Bacteria 2938
186 Ga0495646_0002201 3300046680 Bacteria 11874
187 Ga0495646_0155900 3300046680 Bacteria 1267
188 Ga0495647_0025403 3300046681 Bacteria 2164
189 Ga0495658_0015859 3300046683 Bacteria 3872
190 Ga0495658_0105583 3300046683 Unclassified 1687
191 Ga0495613_0046835 3300046689 Bacteria 3196
192 Ga0495613_0078113 3300046689 Bacteria 2408
193 Ga0495613_0147251 3300046689 Bacteria 1680
194 Ga0495624_0112259 3300046690 Bacteria 1675
195 Ga0495600_0031091 3300046809 Bacteria 3458
196 Ga0495600_0048008 3300046809 Bacteria 2785
197 Ga0495604_0001786 3300047317 Bacteria 17518
198 Ga0495674_0020861 3300047319 Bacteria 6066
199 Ga0495674_0032163 3300047319 Bacteria 4761
200 Ga0495674_0060021 3300047319 Bacteria 3319
201 Ga0495674_0112793 3300047319 Bacteria 2303
202 Ga0495676_0030772 3300047321 Bacteria 4549
203 Ga0495680_0032557 3300047322 Unclassified 4229
204 Ga0495680_0121400 3300047322 Bacteria 1929
205 Ga0495675_0000418 3300047444 Bacteria 28883
206 Ga0495684_0087292 3300047471 Bacteria 2364
207 Ga0495684_0266722 3300047471 Bacteria 1240
208 Ga0495602_0009108 3300048088 Bacteria 10334
209 Ga0495602_0033958 3300048088 Bacteria 4778
210 Ga0495602_0412470 3300048088 Bacteria 961
211 Ga0495614_0053271 3300048089 Bacteria 1735
212 Ga0496100_0501277 3300048903 Bacteria 935
213 Ga0496101_0070278 3300048904 Bacteria 2563
214 Ga0496102_0144130 3300048905 Unclassified 2235
215 Ga0496104_0048812 3300048907 Bacteria 3991
216 Ga0496104_0107479 3300048907 Bacteria 2673
217 Ga0496105_0018332 3300048908 Bacteria 5623
218 Ga0496105_0039019 3300048908 Bacteria 3913
219 Ga0496105_0092270 3300048908 Unclassified 2500
220 Ga0496105_0217632 3300048908 Unclassified 1555
221 Ga0496105_0336330 3300048908 Bacteria 1208
222 Ga0496105_0338335 3300048908 Unclassified 1204
223 Ga0496106_0185890 3300048909 Unclassified 1651
224 Ga0496106_0464143 3300048909 Bacteria 1017
225 Ga0496106_0615852 3300048909 Bacteria 869
226 Ga0496107_0373058 3300048910 Bacteria 1061
227 Ga0496108_0009341 3300048911 Bacteria 7940
228 Ga0496108_0184020 3300048911 Unclassified 1809
229 Ga0496109_0003385 3300048912 Bacteria 13345
230 Ga0496109_0005959 3300048912 Unclassified 10234
231 Ga0496109_0034090 3300048912 Unclassified 4582
232 Ga0496109_0365260 3300048912 Bacteria 1363
233 Ga0496109_0564336 3300048912 Unclassified 1073
234 Ga0496111_0174903 3300048914 Bacteria 1596
235 Ga0496111_0319533 3300048914 Unclassified 1150
236 Ga0496112_0024155 3300048915 Bacteria 5817
237 Ga0496112_0050638 3300048915 Bacteria 4073
238 Ga0496112_0224843 3300048915 Unclassified 1832
239 Ga0496112_0630870 3300048915 Bacteria 1002
240 Ga0496113_0003177 3300048916 Bacteria 9784
241 Ga0496113_0023072 3300048916 Bacteria 4409
242 Ga0496114_0531106 3300048917 Bacteria 1040
243 Ga0496114_0532913 3300048917 Bacteria 1038
244 Ga0496114_0591697 3300048917 Unclassified 979
245 Ga0496115_0004470 3300048918 Bacteria 10129
246 Ga0496115_0050228 3300048918 Bacteria 3340
247 Ga0496115_0135970 3300048918 Bacteria 2027
248 Ga0496115_0137030 3300048918 Bacteria 2018
249 Ga0496115_0237021 3300048918 Bacteria 1504
250 Ga0501031_0022683 3300049568 Bacteria 4092
251 Ga0501031_0340885 3300049568 Bacteria 970
252 Ga0501032_0053620 3300049569 Bacteria 2715
253 Ga0501033_0045470 3300049570 Bacteria 3267
254 Ga0501036_0009121 3300049572 Bacteria 8159
255 Ga0501037_0019693 3300049573 Bacteria 4978
256 Ga0501038_0115739 3300049574 Bacteria 2216
257 Ga0501039_0151065 3300049575 Unclassified 1824
258 Ga0501039_0316597 3300049575 Bacteria 1227
259 Ga0501040_0062961 3300049576 Bacteria 2551
260 Ga0501041_0000694 3300049577 Bacteria 17879
261 Ga0501042_0050663 3300049578 Bacteria 2961
262 Ga0501042_0601876 3300049578 Bacteria 799
263 Ga0501043_0025170 3300049579 Bacteria 4669
264 Ga0501046_0004125 3300049580 Bacteria 13243
265 Ga0501048_0007988 3300049582 Bacteria 8008
266 Ga0501048_0336192 3300049582 Bacteria 1076
267 Ga0501067_0013295 3300049583 Bacteria 4559
268 Ga0501068_0021806 3300049584 Bacteria 3743
269 Ga0501069_0015131 3300049585 Bacteria 4133
270 Ga0501070_0014031 3300049586 Bacteria 6744
271 Ga0501071_0005750 3300049587 Bacteria 8000
272 Ga0501071_0596272 3300049587 Bacteria 849
273 Ga0501074_0004827 3300049590 Bacteria 9661
274 Ga0501074_0525562 3300049590 Bacteria 838
275 Ga0501075_0001084 3300049591 Bacteria 17508
276 Ga0501076_0023836 3300049592 Bacteria 4722
277 Ga0501077_0021982 3300049593 Bacteria 4039
278 Ga0501079_0017245 3300049741 Bacteria 5512
279 Ga0501079_1009336 3300049741 Bacteria 655
280 Ga0501080_0167630 3300049742 Bacteria 2026
281 Ga0501081_0232280 3300049743 Bacteria 1343
282 Ga0501083_0092247 3300049744 Bacteria 1999
283 Ga0501035_0009743 3300049822 Bacteria 8935
284 Ga0501045_0035702 3300049824 Bacteria 3609
285 Ga0501045_0275212 3300049824 Bacteria 1253
286 nmdc:mga0n895_33770_c1 3300050512 Bacteria 4918
287 Ga0495601_0000129 3300053077 Bacteria 42829
288 Ga0495601_0002785 3300053077 Bacteria 9933
289 Ga0495601_0048630 3300053077 Unclassified 2671
290 Ga0495601_0278103 3300053077 Bacteria 1091
291 Ga0495612_0019501 3300053078 Bacteria 2715
292 Ga0495612_0111655 3300053078 Unclassified 1170
293 Ga0495595_0002750 3300053084 Bacteria 6907
294 Ga0495595_0103511 3300053084 Bacteria 1375
295 Ga0495595_0204187 3300053084 Unclassified 984
296 Ga0495619_0053476 3300053085 Bacteria 2671
297 Ga0495619_0203789 3300053085 Unclassified 1370
298 Ga0501084_0048640 3300054114 Bacteria 3549
299 Ga0501082_0003852 3300060353 Bacteria 13113
300 Ga0466962_0010358 3300061719 Bacteria 4480
301 Ga0530510_0005263 3300061734 Bacteria 8936
302 Ga0466965_0064392
303 rootH2_10104959
304 Ga0070658_10027116
305 Ga0070683_100012564
306 Ga0070680_100095875
307 Ga0068868_100296139
308 Ga0070660_100492021
309 Ga0070691_10055997
310 Ga0070691_10192148
311 Ga0070692_10154237
312 Ga0070659_100023942
313 Ga0070709_10162997
314 Ga0070709_10218845
315 Ga0070714_100002714
316 Ga0070714_100303264
317 Ga0070713_100005793
318 Ga0070713_100573934
319 Ga0070711_100071551
320 Ga0070681_10099713
321 Ga0070707_100001296
322 Ga0070699_100876484
323 Ga0070679_100060823
324 Ga0070679_100136516
325 Ga0070684_100009703
326 Ga0070684_100457476
327 Ga0070695_100001872
328 Ga0070693_100056626
329 Ga0070664_100034744
330 Ga0068856_100019693
331 Ga0068856_100347525
332 Ga0070702_100444417
333 Ga0068863_100259981
334 Ga0081455_10131107
335 Ga0070717_10058683
336 Ga0070717_10173217
337 Ga0070717_10196207
338 Ga0070717_10231402
339 Ga0070717_10449589
340 Ga0070716_100175056
341 Ga0070712_100206788
342 Ga0068871_100099938
343 Ga0105240_10186726
344 Ga0105240_10467097
345 Ga0105245_10249938
346 Ga0105245_10308353
347 Ga0105241_10440362
348 Ga0105237_10124387
349 Ga0105238_10091850
350 Ga0157369_10042361
351 Ga0157374_10151909
352 Ga0182008_10156134
353 Ga0207692_10026451
354 Ga0207654_10310984
355 Ga0207707_10102985
356 Ga0207693_10025905
357 Ga0207663_10051341
358 Ga0207663_10303681
359 Ga0207660_10061629
360 Ga0207660_10075529
361 Ga0207700_10069397
362 Ga0207664_10011279
363 Ga0207664_10036028
364 Ga0207664_10087278
365 Ga0207664_10742783
366 Ga0207665_10234820
367 Ga0207679_10031646
368 Ga0207702_10005895
369 Ga0207702_10653035
370 Ga0207641_10222046
371 Ga0207698_10845617
372 Ga0373937_0126295
373 Ga0395900_0049162
374 Ga0395900_0468785
375 Ga0395898_0008986
376 Ga0395898_0086628
377 Ga0395905_0051088
378 Ga0395901_0010237
379 Ga0395901_0031067
380 Ga0395901_0274277
381 Ga0395901_0567583
382 Ga0466969_0033896
383 Ga0466966_0093040
384 Ga0466961_0020240
385 Ga0466961_0033984
386 Ga0466963_0000189
387 Ga0466963_0002284
388 Ga0466963_0007250
389 Ga0466963_0007440
390 Ga0466963_0010754
391 Ga0466963_0029966
392 Ga0466963_0062083
393 Ga0466963_0073775
394 Ga0466963_0140450
395 Ga0466963_0148183
396 Ga0466963_0185844
397 Ga0466963_0228451
398 Ga0466963_0455951
399 Ga0466964_0008710
400 Ga0466964_0008834
401 Ga0466964_0019143
402 Ga0466964_0105581
403 Ga0466964_0131819
404 Ga0466971_0004591
405 Ga0466971_0015043
406 Ga0466971_0043608
407 Ga0466968_0026814
408 Ga0466968_0043779
409 Ga0466968_0080047
410 Ga0466970_0143548
411 Ga0466957_0004399
412 Ga0466957_0012316
413 Ga0466957_0047115
414 Ga0466957_0103366
415 Ga0466960_0010803
416 Ga0466959_0009803
417 Ga0466959_0010183
418 Ga0466959_0082341
419 Ga0466959_0109199
420 Ga0466959_0213909
421 Ga0466958_0000982
422 Ga0466958_0001940
423 Ga0466958_0003061
424 Ga0466958_0004482
425 Ga0466958_0031117
426 Ga0466958_0120995
427 Ga0466967_0001735
428 Ga0466967_0008987
429 Ga0466967_0038201
430 Ga0466967_0052420
431 Ga0466967_0059477
432 Ga0466967_0085466
433 Ga0466967_0091853
434 Ga0466967_0102265
435 Ga0466967_0174525
436 Ga0466967_0205611
437 Ga0466967_0206989
438 Ga0466967_0421235
439 Ga0466967_0620982
440 Ga0466967_0680721
441 Ga0495592_0002039
442 Ga0495592_0012083
443 Ga0495603_0105983
444 Ga0495603_0402332
445 Ga0495629_0063547
446 Ga0495629_0139812
447 Ga0495641_0022278
448 Ga0495641_0095686
449 Ga0495641_0125783
450 Ga0495651_0025912
451 Ga0495651_0262546
452 Ga0495653_0019875
453 Ga0495653_0020862
454 Ga0495582_0294039
455 Ga0495662_0099423
456 Ga0495664_0057148
457 Ga0495664_0279597
458 Ga0495608_0005076
459 Ga0495618_0040866
460 Ga0495618_0106023
461 Ga0495618_0170277
462 Ga0495628_0001284
463 Ga0495628_0014223
464 Ga0495630_0044176
465 Ga0495630_0069405
466 Ga0495630_0075425
467 Ga0495644_0142879
468 Ga0495666_0112895
469 Ga0495652_0027759
470 Ga0495652_0099488
471 Ga0495640_0113123
472 Ga0495640_0307552
473 Ga0495586_0003085
474 Ga0495586_0083425
475 Ga0495587_0004991
476 Ga0495587_0049491
477 Ga0495645_0001092
478 Ga0495667_0244607
479 Ga0495656_0083284
480 Ga0495634_0038078
481 Ga0495634_0386414
482 Ga0495657_0002676
483 Ga0495599_0001919
484 Ga0495599_0006511
485 Ga0495623_0001576
486 Ga0495623_0041395
487 Ga0495646_0002201
488 Ga0495646_0155900
489 Ga0495647_0025403
490 Ga0495658_0015859
491 Ga0495658_0105583
492 Ga0495613_0046835
493 Ga0495613_0078113
494 Ga0495613_0147251
495 Ga0495624_0112259
496 Ga0495600_0031091
497 Ga0495600_0048008
498 Ga0495604_0001786
499 Ga0495674_0020861
500 Ga0495674_0032163
501 Ga0495674_0060021
502 Ga0495674_0112793
503 Ga0495676_0030772
504 Ga0495680_0032557
505 Ga0495680_0121400
506 Ga0495675_0000418
507 Ga0495684_0087292
508 Ga0495684_0266722
509 Ga0495602_0009108
510 Ga0495602_0033958
511 Ga0495602_0412470
512 Ga0495614_0053271
513 Ga0496100_0501277
514 Ga0496101_0070278
515 Ga0496102_0144130
516 Ga0496104_0048812
517 Ga0496104_0107479
518 Ga0496105_0018332
519 Ga0496105_0039019
520 Ga0496105_0092270
521 Ga0496105_0217632
522 Ga0496105_0336330
523 Ga0496105_0338335
524 Ga0496106_0185890
525 Ga0496106_0464143
526 Ga0496106_0615852
527 Ga0496107_0373058
528 Ga0496108_0009341
529 Ga0496108_0184020
530 Ga0496109_0003385
531 Ga0496109_0005959
532 Ga0496109_0034090
533 Ga0496109_0365260
534 Ga0496109_0564336
535 Ga0496111_0174903
536 Ga0496111_0319533
537 Ga0496112_0024155
538 Ga0496112_0050638
539 Ga0496112_0224843
540 Ga0496112_0630870
541 Ga0496113_0003177
542 Ga0496113_0023072
543 Ga0496114_0531106
544 Ga0496114_0532913
545 Ga0496114_0591697
546 Ga0496115_0004470
547 Ga0496115_0050228
548 Ga0496115_0135970
549 Ga0496115_0137030
550 Ga0496115_0237021
551 Ga0501031_0022683
552 Ga0501031_0340885
553 Ga0501032_0053620
554 Ga0501033_0045470
555 Ga0501036_0009121
556 Ga0501037_0019693
557 Ga0501038_0115739
558 Ga0501039_0151065
559 Ga0501039_0316597
560 Ga0501040_0062961
561 Ga0501041_0000694
562 Ga0501042_0050663
563 Ga0501042_0601876
564 Ga0501043_0025170
565 Ga0501046_0004125
566 Ga0501048_0007988
567 Ga0501048_0336192
568 Ga0501067_0013295
569 Ga0501068_0021806
570 Ga0501069_0015131
571 Ga0501070_0014031
572 Ga0501071_0005750
573 Ga0501071_0596272
574 Ga0501074_0004827
575 Ga0501074_0525562
576 Ga0501075_0001084
577 Ga0501076_0023836
578 Ga0501077_0021982
579 Ga0501079_0017245
580 Ga0501079_1009336
581 Ga0501080_0167630
582 Ga0501081_0232280
583 Ga0501083_0092247
584 Ga0501035_0009743
585 Ga0501045_0035702
586 Ga0501045_0275212
587 nmdc:mga0n895_33770_c1
588 Ga0495601_0000129
589 Ga0495601_0002785
590 Ga0495601_0048630
591 Ga0495601_0278103
592 Ga0495612_0019501
593 Ga0495612_0111655
594 Ga0495595_0002750
595 Ga0495595_0103511
596 Ga0495595_0204187
597 Ga0495619_0053476
598 Ga0495619_0203789
599 Ga0501084_0048640
600 Ga0501082_0003852
601 Ga0466962_0010358
602 Ga0530510_0005263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

30

140

0.97

PF00196

GerE

Bacterial regulatory proteins, luxR family

179

235

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9872 164 221
6ugl-assembly1.cif.gz_A vqma bound to dpo 0.9745 163 219
6kju-assembly1.cif.gz_A huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors 0.9726 163 219
3p7n-assembly2.cif.gz_B crystal structure of light activated transcription factor el222 from erythrobacter litoralis 0.9573 163 216
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9567 163 223
ID Description Score Start End Superfamily
3qp5D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9727 163 216 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9601 164 219 1.10.10.10
3p7nB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9573 163 216 1.10.10.10
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9532 163 219 1.10.10.10
3ulqB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9524 163 216 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A495W422-F1-model_v4 Response regulator receiver domain-containing protein 0.9688 9 127 GO:0000160
GO:0003677
AF-A0A436BPP7-F1-model_v4 Response regulator transcription factor 0.9653 10 128 GO:0000160
AF-A0A1G7T7L2-F1-model_v4 Response regulator receiver domain-containing protein 0.9595 9 133 GO:0000160
GO:0003677
AF-A0A7K2MLM2-F1-model_v4 Response regulator 0.9542 9 140 GO:0000160
GO:0003677
AF-A0A4S3Q0P3-F1-model_v4 deleted 0.9541 9 132

Map