F395892

General Info

Members Datasets Scaffolds Average Seq Length
301 194 259 205

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10261873|Ga0105237_102618731
Length 224
Sequence MRVASRCRTSAAERVGSLVLNAHSASTVTALVLAGGRGSRMGGVDKGMQPFHGEPLALHVMRRIAPQADALLISANRSIEDYERLGAAFGARVIPDTRADYPGPLAGIAAALRAATTQYVLTAPCDAPFVDEHIGVTLMQALDAHGGDVAYAATIDASGQVMAHPVFALLRTSLADDLDAWLDRGERKVRAWYARHKPVEVRFHDERAFYNINDLQQLAELERR

Samples

Sample ID Description Type Environment
1 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
4 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
5 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
6 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
7 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
8 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
9 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
10 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
11 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
12 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
13 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
14 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
15 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
16 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
17 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
18 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
19 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
20 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
21 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
22 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
23 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
24 2818991452 Burkholderia cepacia 561 Isolate Unclassified
25 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
26 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
27 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
28 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
29 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
30 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
31 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
32 2928163908 Burkholderia sp. 567 Isolate Unclassified
33 2928170801 Burkholderia sp. 572 Isolate Unclassified
34 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
35 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
36 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
39 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
40 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
41 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
42 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
43 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
44 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
64 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
102 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
103 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
106 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
107 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
108 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
109 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
122 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
130 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
131 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
155 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
187 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
188 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
189 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
190 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
191 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
192 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
193 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
194 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.39
Metatranscriptomes 1.66
Isolates 13.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.65
Nodule 1.33
Rhizoplane 10.63
Rhizosphere 67.11
Stem 0
Stem Tuber 0
Unclassified 16.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10030154 3300001989 Bacteria 1881
2 JGI25156J39149_1001319 3300002705 Bacteria 10730
3 JGI25156J39149_1004557 3300002705 Bacteria 4189
4 rootH2_10070720 3300003320 Bacteria 2802
5 rootL2_10258975 3300003322 Bacteria 1584
6 rootH1_10037770 3300003323 Bacteria 1490
7 Ga0055532_1000643 3300003758 Bacteria 13493
8 Ga0055527_1003140 3300003760 Bacteria 2540
9 Ga0055535_1001317 3300003761 Bacteria 13235
10 Ga0055542_1001665 3300003762 Bacteria 9904
11 Ga0055529_1000552 3300003763 Bacteria 31487
12 Ga0070666_10245239 3300005335 Bacteria 1267
13 Ga0070660_100048593 3300005339 Bacteria 3259
14 Ga0070668_100312791 3300005347 Bacteria 1320
15 Ga0070659_100127156 3300005366 Bacteria 2068
16 Ga0070678_100153977 3300005456 Bacteria 1855
17 Ga0070678_100304578 3300005456 Bacteria 1355
18 Ga0105251_10000285 3300009011 Bacteria 50961
19 Ga0105251_10073001 3300009011 Bacteria 1595
20 Ga0105244_10104119 3300009036 Bacteria 1385
21 Ga0105240_10969875 3300009093 Bacteria 911
22 Ga0105245_10409356 3300009098 Bacteria 1357
23 Ga0105247_10599779 3300009101 Bacteria 816
24 Ga0105241_10192794 3300009174 Bacteria 1697
25 Ga0105237_10006196 3300009545 Bacteria 13345
26 Ga0105237_10042833 3300009545 Bacteria 4563
27 Ga0105237_10261873 3300009545 Bacteria 1732
28 Ga0105249_10786805 3300009553 Bacteria 1015
29 Ga0157370_10009710 3300013104 Bacteria 10231
30 Ga0157369_10000252 3300013105 Bacteria 73217
31 Ga0157369_10000799 3300013105 Bacteria 40249
32 Ga0157369_10029169 3300013105 Bacteria 6099
33 Ga0157374_10730228 3300013296 Bacteria 1004
34 Ga0163162_10033960 3300013306 Bacteria 5073
35 Ga0157375_10022520 3300013308 Bacteria 5799
36 Ga0183361_10025 3300016635 Bacteria 72014
37 Ga0197907_11478289 3300020069 Bacteria 2660
38 Ga0206356_10059520 3300020070 Bacteria 6414
39 Ga0206354_11201333 3300020081 Bacteria 2816
40 Ga0206353_10720401 3300020082 Bacteria 5503
41 Ga0224712_10000087 3300022467 Bacteria 14342
42 Ga0209674_100424 3300025226 Bacteria 20459
43 Ga0209672_100051 3300025228 Bacteria 234414
44 Ga0209147_100192 3300025229 Bacteria 70162
45 Ga0209258_100031 3300025242 Bacteria 463572
46 Ga0209148_1000027 3300025254 Bacteria 616374
47 Ga0209148_1000400 3300025254 Bacteria 50569
48 Ga0209759_1000147 3300025256 Bacteria 121320
49 Ga0209759_1001732 3300025256 Bacteria 11236
50 Ga0209455_1000213 3300025272 Bacteria 82040
51 Ga0209673_1000201 3300025273 Bacteria 120059
52 Ga0207426_1002525 3300025302 Bacteria 11483
53 Ga0207713_1002521 3300025735 Bacteria 13264
54 Ga0207680_10218614 3300025903 Bacteria 1305
55 Ga0207647_10028534 3300025904 Bacteria 3622
56 Ga0207705_10002820 3300025909 Bacteria 13287
57 Ga0207654_10145099 3300025911 Bacteria 1518
58 Ga0207690_10165573 3300025932 Bacteria 1652
59 Ga0207711_10077806 3300025941 Bacteria 2892
60 Ga0207667_10006660 3300025949 Bacteria 13964
61 Ga0207667_10894446 3300025949 Bacteria 880
62 Ga0207678_10030240 3300026067 Bacteria 4728
63 Ga0207678_10302003 3300026067 Bacteria 1376
64 Ga0209371_1000297 3300027312 Bacteria 55845
65 Ga0268256_1000261 3300030500 Bacteria 55844
66 Ga0395899_0000041 3300037312 Bacteria 255615
67 Ga0395899_0026575 3300037312 Bacteria 4367
68 Ga0395899_0038496 3300037312 Bacteria 3582
69 Ga0395900_0001108 3300037418 Bacteria 34263
70 Ga0395900_0001690 3300037418 Bacteria 25639
71 Ga0395900_0027150 3300037418 Bacteria 5861
72 Ga0395900_0164068 3300037418 Bacteria 2265
73 Ga0395898_0000220 3300037466 Bacteria 146473
74 Ga0395898_0002771 3300037466 Bacteria 20150
75 Ga0395898_0051021 3300037466 Bacteria 4046
76 Ga0395898_0136351 3300037466 Bacteria 2350
77 Ga0395905_0085899 3300037471 Bacteria 2948
78 Ga0395901_0000011 3300038443 Bacteria 400724
79 Ga0395901_0000106 3300038443 Bacteria 114313
80 Ga0395901_0000264 3300038443 Bacteria 65306
81 Ga0466969_0043528 3300044656 Bacteria 2237
82 Ga0466972_0055743 3300044658 Bacteria 1901
83 Ga0466972_0172771 3300044658 Bacteria 1014
84 Ga0466965_0046225 3300044683 Bacteria 2154
85 Ga0466966_0000066 3300044684 Bacteria 69299
86 Ga0466966_0019436 3300044684 Bacteria 4468
87 Ga0466966_0021970 3300044684 Bacteria 4189
88 Ga0466961_0000037 3300044693 Bacteria 80759
89 Ga0466961_0018267 3300044693 Bacteria 4508
90 Ga0466961_0127055 3300044693 Bacteria 1599
91 Ga0466961_0284539 3300044693 Bacteria 1011
92 Ga0466963_0001971 3300044694 Bacteria 11270
93 Ga0466963_0041379 3300044694 Bacteria 3022
94 Ga0466971_0021577 3300044719 Bacteria 2865
95 Ga0466971_0049216 3300044719 Bacteria 1896
96 Ga0466970_0005329 3300044765 Bacteria 6377
97 Ga0466970_0107843 3300044765 Bacteria 1520
98 Ga0466957_0008754 3300044842 Bacteria 5761
99 Ga0466957_0031699 3300044842 Bacteria 3160
100 Ga0466957_0131656 3300044842 Bacteria 1603
101 Ga0466957_0178111 3300044842 Bacteria 1387
102 Ga0466960_0154775 3300044901 Bacteria 1227
103 Ga0466959_0046821 3300045049 Bacteria 3182
104 Ga0466959_0260581 3300045049 Bacteria 1193
105 Ga0466958_0007158 3300045836 Bacteria 6116
106 Ga0466958_0013575 3300045836 Bacteria 4640
107 Ga0466958_0033891 3300045836 Bacteria 3044
108 Ga0466967_0491630 3300045976 Bacteria 1203
109 Ga0495592_0142197 3300046454 Bacteria 1668
110 Ga0495592_0260220 3300046454 Bacteria 1143
111 Ga0495603_0003117 3300046455 Bacteria 9852
112 Ga0495590_0001198 3300046457 Bacteria 11339
113 Ga0495629_0000060 3300046459 Bacteria 100921
114 Ga0495629_0000293 3300046459 Bacteria 43087
115 Ga0495629_0195061 3300046459 Bacteria 1401
116 Ga0495638_0031414 3300046460 Bacteria 3413
117 Ga0495651_0312217 3300046462 Bacteria 1051
118 Ga0495653_0005778 3300046463 Bacteria 10126
119 Ga0495653_0020615 3300046463 Bacteria 5342
120 Ga0495653_0149678 3300046463 Bacteria 1632
121 Ga0495650_0001534 3300046471 Bacteria 21930
122 Ga0495650_0029993 3300046471 Bacteria 2470
123 Ga0495580_0015141 3300046472 Bacteria 5835
124 Ga0495580_0055005 3300046472 Bacteria 2805
125 Ga0495580_0074206 3300046472 Bacteria 2374
126 Ga0495605_0035260 3300046474 Bacteria 2529
127 Ga0495664_0000037 3300046477 Bacteria 70108
128 Ga0495664_0020030 3300046477 Bacteria 3854
129 Ga0495607_0061710 3300046501 Bacteria 2129
130 Ga0495607_0158484 3300046501 Bacteria 1152
131 Ga0495583_0065841 3300046506 Bacteria 1604
132 Ga0495583_0154454 3300046506 Bacteria 950
133 Ga0495606_0044280 3300046507 Bacteria 2961
134 Ga0495606_0069162 3300046507 Bacteria 2231
135 Ga0495618_0036159 3300046514 Bacteria 3099
136 Ga0495620_0030260 3300046515 Bacteria 2495
137 Ga0495628_0084586 3300046516 Bacteria 2461
138 Ga0495628_0488931 3300046516 Bacteria 890
139 Ga0495630_0075338 3300046517 Bacteria 2543
140 Ga0495631_0202808 3300046518 Bacteria 848
141 Ga0495666_0065214 3300046526 Bacteria 1737
142 Ga0495666_0065328 3300046526 Bacteria 1736
143 Ga0495666_0103527 3300046526 Bacteria 1340
144 Ga0495642_0153723 3300046528 Bacteria 996
145 Ga0495652_0114953 3300046529 Bacteria 2158
146 Ga0495652_0343662 3300046529 Bacteria 1071
147 Ga0495654_0077992 3300046530 Bacteria 1558
148 Ga0495665_0024330 3300046531 Bacteria 3253
149 Ga0495665_0189106 3300046531 Bacteria 1068
150 Ga0495597_0010325 3300046542 Bacteria 4570
151 Ga0495645_0002587 3300046543 Bacteria 12299
152 Ga0495645_0029285 3300046543 Bacteria 4003
153 Ga0495645_0036751 3300046543 Bacteria 3569
154 Ga0495661_0070879 3300046665 Bacteria 2038
155 Ga0495588_0081711 3300046674 Bacteria 1687
156 Ga0495599_0239274 3300046678 Bacteria 1107
157 Ga0495646_0021707 3300046680 Bacteria 4055
158 Ga0495646_0152667 3300046680 Bacteria 1283
159 Ga0495646_0212121 3300046680 Bacteria 1050
160 Ga0495669_0081969 3300046684 Bacteria 1482
161 Ga0495613_0275178 3300046689 Bacteria 1170
162 Ga0495624_0012200 3300046690 Bacteria 5883
163 Ga0495624_0049521 3300046690 Bacteria 2664
164 Ga0495624_0111403 3300046690 Bacteria 1682
165 Ga0495624_0203014 3300046690 Bacteria 1204
166 Ga0495670_0003027 3300046691 Bacteria 8293
167 Ga0495671_0026988 3300046692 Bacteria 2970
168 Ga0495649_0009005 3300046694 Bacteria 5961
169 Ga0495649_0221304 3300046694 Bacteria 979
170 Ga0495589_0173548 3300046794 Bacteria 1024
171 Ga0495589_0204091 3300046794 Bacteria 932
172 Ga0495589_0241043 3300046794 Bacteria 846
173 Ga0495600_0037491 3300046809 Bacteria 3152
174 Ga0495604_0244029 3300047317 Bacteria 1227
175 Ga0495604_0360784 3300047317 Bacteria 964
176 Ga0495674_0010551 3300047319 Bacteria 8744
177 Ga0495674_0010793 3300047319 Bacteria 8643
178 Ga0495674_0021606 3300047319 Bacteria 5950
179 Ga0495674_0041704 3300047319 Bacteria 4098
180 Ga0495672_0040557 3300047320 Bacteria 2822
181 Ga0495672_0093439 3300047320 Bacteria 1647
182 Ga0495676_0037922 3300047321 Bacteria 4007
183 Ga0495676_0299143 3300047321 Bacteria 1085
184 Ga0495680_0037364 3300047322 Bacteria 3890
185 Ga0495683_0005878 3300047323 Bacteria 6743
186 Ga0495683_0073165 3300047323 Bacteria 1681
187 Ga0495687_000025 3300047443 Bacteria 310498
188 Ga0495687_013038 3300047443 Bacteria 4358
189 Ga0495687_021773 3300047443 Bacteria 3091
190 Ga0495675_0146102 3300047444 Bacteria 1463
191 Ga0495679_043147 3300047446 Bacteria 1388
192 Ga0495686_0000032 3300047472 Bacteria 345132
193 Ga0495593_0018129 3300047673 Bacteria 3958
194 Ga0495593_0047906 3300047673 Bacteria 2272
195 Ga0495593_0054319 3300047673 Bacteria 2112
196 Ga0495593_0089337 3300047673 Bacteria 1587
197 Ga0495593_0125395 3300047673 Bacteria 1305
198 Ga0495593_0151324 3300047673 Bacteria 1173
199 Ga0495602_0025863 3300048088 Bacteria 5673
200 Ga0495602_0165400 3300048088 Bacteria 1722
201 Ga0495602_0200242 3300048088 Bacteria 1524
202 Ga0495602_0587669 3300048088 Bacteria 767
203 Ga0495614_0015123 3300048089 Bacteria 3367
204 Ga0495614_0055421 3300048089 Bacteria 1700
205 Ga0495626_0127335 3300048091 Bacteria 1090
206 Ga0496100_0004725 3300048903 Bacteria 7262
207 Ga0496100_0045298 3300048903 Bacteria 2822
208 Ga0496100_0347557 3300048903 Bacteria 1119
209 Ga0496101_0064041 3300048904 Bacteria 2677
210 Ga0496102_0014935 3300048905 Bacteria 6757
211 Ga0496102_0014965 3300048905 Bacteria 6752
212 Ga0496102_0112474 3300048905 Bacteria 2540
213 Ga0496103_0039955 3300048906 Bacteria 2883
214 Ga0496104_0108279 3300048907 Bacteria 2663
215 Ga0496104_0173028 3300048907 Bacteria 2070
216 Ga0496106_0000019 3300048909 Bacteria 174698
217 Ga0496106_0007504 3300048909 Bacteria 8061
218 Ga0496106_0093973 3300048909 Bacteria 2318
219 Ga0496106_0113993 3300048909 Bacteria 2108
220 Ga0496107_0009382 3300048910 Bacteria 6785
221 Ga0496107_0379083 3300048910 Bacteria 1052
222 Ga0496108_0455869 3300048911 Bacteria 1117
223 Ga0496108_0496141 3300048911 Bacteria 1066
224 Ga0496109_0022399 3300048912 Bacteria 5595
225 Ga0496110_0001369 3300048913 Bacteria 17558
226 Ga0496110_0141027 3300048913 Bacteria 2179
227 Ga0496111_0110500 3300048914 Bacteria 2024
228 Ga0496112_0004198 3300048915 Bacteria 12147
229 Ga0496113_0002111 3300048916 Bacteria 11463
230 Ga0496114_0010010 3300048917 Bacteria 7538
231 Ga0496114_0642590 3300048917 Bacteria 934
232 Ga0496115_0134173 3300048918 Bacteria 2041
233 Ga0496115_0413479 3300048918 Bacteria 1093
234 Ga0496116_0016509 3300048919 Bacteria 5772
235 Ga0496116_0067889 3300048919 Bacteria 2275
236 Ga0496117_0002293 3300048920 Bacteria 24665
237 Ga0496117_0130760 3300048920 Bacteria 1522
238 Ga0496118_0007277 3300048921 Bacteria 11784
239 Ga0496118_0017806 3300048921 Bacteria 6447
240 Ga0496118_0043531 3300048921 Bacteria 3527
241 Ga0496118_0173453 3300048921 Bacteria 1314
242 Ga0496118_0255320 3300048921 Bacteria 993
243 Ga0496119_0178422 3300048922 Bacteria 1116
244 Ga0496121_0000310 3300048924 Bacteria 101522
245 Ga0496121_0006654 3300048924 Bacteria 14228
246 Ga0496121_0146942 3300048924 Bacteria 1740
247 Ga0496122_0007677 3300048925 Bacteria 11891
248 Ga0496123_0007642 3300048926 Bacteria 10117
249 Ga0496125_0010691 3300048928 Bacteria 9260
250 Ga0496126_0000034 3300048929 Bacteria 362440
251 Ga0496126_0000706 3300048929 Bacteria 60980
252 Ga0496126_0003420 3300048929 Bacteria 20038
253 Ga0496126_0229688 3300048929 Bacteria 1555
254 Ga0496126_0671075 3300048929 Bacteria 809
255 Ga0466983_0357353 3300048986 Bacteria 1077
256 Ga0495678_064518 3300049459 Bacteria 1363
257 Ga0495682_0002263 3300049460 Bacteria 9241
258 Ga0466962_0002067 3300061719 Bacteria 9498
259 Ga0466962_0080690 3300061719 Bacteria 1555

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0260581 Ga0466959_0260581_13_594 151
2 3300044694 Ga0466963_0041379 Ga0466963_0041379_1362_1994 169
3 3300044656 Ga0466969_0043528 Ga0466969_0043528_652_1296 171
4 3300044684 Ga0466966_0000066 Ga0466966_0000066_15283_15927 171
5 3300044693 Ga0466961_0000037 Ga0466961_0000037_22122_22766 171
6 3300044719 Ga0466971_0049216 Ga0466971_0049216_394_1038 171
7 3300044842 Ga0466957_0008754 Ga0466957_0008754_4661_5305 171
8 3300045836 Ga0466958_0013575 Ga0466958_0013575_2194_2838 171
9 3300061719 Ga0466962_0002067 Ga0466962_0002067_5624_6268 171
10 3300048920 Ga0496117_0130760 Ga0496117_0130760_233_847 175
11 3300048929 Ga0496126_0000706 Ga0496126_0000706_56598_57212 175
12 3300002705 JGI25156J39149_1001319 JGI25156J39149_10013198 177
13 3300025226 Ga0209674_100424 Ga0209674_10042412 177
14 3300025256 Ga0209759_1000147 Ga0209759_10001473 177
15 3300046507 Ga0495606_0069162 Ga0495606_0069162_1346_1933 178
16 3300046454 Ga0495592_0260220 Ga0495592_0260220_358_1002 179
17 3300046680 Ga0495646_0152667 Ga0495646_0152667_403_1050 180
18 3300046678 Ga0495599_0239274 Ga0495599_0239274_320_964 182
19 3300047317 Ga0495604_0244029 Ga0495604_0244029_501_1145 182
20 3300048088 Ga0495602_0025863 Ga0495602_0025863_4328_4972 182
21 3300048921 Ga0496118_0017806 Ga0496118_0017806_2281_2895 182
22 3300009093 Ga0105240_10969875 Ga0105240_109698751 184
23 3300009545 Ga0105237_10042833 Ga0105237_100428332 184
24 3300013104 Ga0157370_10009710 Ga0157370_100097105 184
25 3300044658 Ga0466972_0172771 Ga0466972_0172771_51_632 184
26 3300044683 Ga0466965_0046225 Ga0466965_0046225_1273_1854 184
27 3300044684 Ga0466966_0019436 Ga0466966_0019436_1708_2289 184
28 3300044693 Ga0466961_0018267 Ga0466961_0018267_1144_1725 184
29 3300044765 Ga0466970_0005329 Ga0466970_0005329_179_760 184
30 3300044842 Ga0466957_0031699 Ga0466957_0031699_401_982 184
31 3300044842 Ga0466957_0178111 Ga0466957_0178111_350_1000 184
32 3300045049 Ga0466959_0046821 Ga0466959_0046821_2458_3039 184
33 3300045836 Ga0466958_0033891 Ga0466958_0033891_1980_2561 184
34 3300046691 Ga0495670_0003027 Ga0495670_0003027_3644_4228 184
35 3300047319 Ga0495674_0041704 Ga0495674_0041704_1668_2222 184
36 3300047443 Ga0495687_000025 Ga0495687_000025_241817_242371 184
37 3300048917 Ga0496114_0642590 Ga0496114_0642590_62_616 184
38 3300048922 Ga0496119_0178422 Ga0496119_0178422_520_1074 184
39 3300037312 Ga0395899_0026575 Ga0395899_0026575_2282_2926 185
40 3300037418 Ga0395900_0027150 Ga0395900_0027150_2487_3131 185
41 3300037466 Ga0395898_0051021 Ga0395898_0051021_1889_2533 185
42 3300038443 Ga0395901_0000106 Ga0395901_0000106_42242_42886 185
43 3300044658 Ga0466972_0055743 Ga0466972_0055743_473_1123 187
44 3300044684 Ga0466966_0021970 Ga0466966_0021970_718_1368 187
45 3300044694 Ga0466963_0001971 Ga0466963_0001971_2701_3351 187
46 3300044719 Ga0466971_0021577 Ga0466971_0021577_2167_2817 187
47 3300061719 Ga0466962_0080690 Ga0466962_0080690_410_1060 187
48 3300003320 rootH2_10070720 rootH2_100707202 188
49 3300003323 rootH1_10037770 rootH1_100377702 188
50 3300009545 Ga0105237_10006196 Ga0105237_1000619610 188
51 3300025949 Ga0207667_10894446 Ga0207667_108944462 188
52 3300037312 Ga0395899_0000041 Ga0395899_0000041_58641_59285 189
53 3300037418 Ga0395900_0001690 Ga0395900_0001690_6946_7590 189
54 3300037466 Ga0395898_0000220 Ga0395898_0000220_87143_87787 189
55 3300037466 Ga0395898_0136351 Ga0395898_0136351_338_988 190
56 3300038443 Ga0395901_0000264 Ga0395901_0000264_2719_3369 190
57 3300044693 Ga0466961_0127055 Ga0466961_0127055_621_1262 190
58 3300045836 Ga0466958_0007158 Ga0466958_0007158_2415_3059 190
59 3300045976 Ga0466967_0491630 Ga0466967_0491630_15_659 190
60 3300048919 Ga0496116_0067889 Ga0496116_0067889_1327_1908 193
61 3300046526 Ga0495666_0065214 Ga0495666_0065214_336_950 196
62 3300048909 Ga0496106_0000019 Ga0496106_0000019_97939_98553 196
63 3300048924 Ga0496121_0000310 Ga0496121_0000310_76031_76645 196
64 3300002705 JGI25156J39149_1004557 JGI25156J39149_10045572 197
65 3300025256 Ga0209759_1001732 Ga0209759_10017323 197
66 3300025273 Ga0209673_1000201 Ga0209673_100020177 197
67 3300003758 Ga0055532_1000643 Ga0055532_10006433 198
68 3300003760 Ga0055527_1003140 Ga0055527_10031401 198
69 3300003761 Ga0055535_1001317 Ga0055535_10013173 198
70 3300003762 Ga0055542_1001665 Ga0055542_10016652 198
71 3300003763 Ga0055529_1000552 Ga0055529_10005523 198
72 3300025228 Ga0209672_100051 Ga0209672_10005125 198
73 3300025229 Ga0209147_100192 Ga0209147_10019273 198
74 3300025242 Ga0209258_100031 Ga0209258_100031369 198
75 3300025254 Ga0209148_1000027 Ga0209148_1000027369 198
76 3300025254 Ga0209148_1000400 Ga0209148_10004003 198
77 3300025272 Ga0209455_1000213 Ga0209455_100021321 198
78 3300027312 Ga0209371_1000297 Ga0209371_100029758 198
79 3300030500 Ga0268256_1000261 Ga0268256_10002615 198
80 3300048986 Ga0466983_0357353 Ga0466983_0357353_205_825 200
81 iso_pu_bacteria 2512047030 2512345235 200
82 iso_pu_bacteria 2513237166 2514050944 200
83 iso_pu_bacteria 2515154122 2515684325 200
84 iso_pu_bacteria 2600255067 2600810820 200
85 iso_pu_bacteria 2744054900 2746088169 200
86 iso_pu_bacteria 2744054901 2746096937 200
87 iso_pu_bacteria 2751185846 2753571033 200
88 iso_pu_bacteria 2885270888 2885271095 200
89 iso_pu_bacteria 2900634093 2900637824 200
90 iso_pu_bacteria 2902682994 2902687091 200
91 iso_pu_bacteria 642555113 642622492 200
92 iso_pu_bacteria 8039098773 8039102766 200
93 iso_pu_bacteria 2582581311 2585294702 201
94 iso_pu_bacteria 2599185239 2599738106 201
95 iso_pu_bacteria 2599185240 2599742522 201
96 iso_pu_bacteria 2599185355 2600204640 201
97 iso_pu_bacteria 2675903129 2676741626 201
98 iso_pu_bacteria 2816332253 2817260396 201
99 iso_pu_bacteria 2816332256 2817278084 201
100 iso_pu_bacteria 2816332286 2817455651 201
101 iso_pu_bacteria 2818991452 2819632922 201
102 iso_pu_bacteria 2856287931 2856292762 201
103 iso_pu_bacteria 2857357740 2857360996 201
104 iso_pu_bacteria 2863421361 2863421933 201
105 iso_pu_bacteria 2870068957 2870072125 201
106 iso_pu_bacteria 2928163908 2928164454 201
107 iso_pu_bacteria 2928170801 2928177562 201
108 iso_pu_bacteria 2981990288 2981993920 201
109 iso_pu_bacteria 8018845410 8018850367 201
110 iso_pu_bacteria 8020807995 8020808851 201
111 iso_pu_bacteria 8020945358 8020947204 201
112 iso_pu_bacteria 8021120328 8021122829 201
113 iso_pu_bacteria 8040167225 8040169302 201
114 iso_pu_bacteria 8040173305 8040174995 201
115 3300046459 Ga0495629_0195061 Ga0495629_0195061_518_1147 203
116 3300046674 Ga0495588_0081711 Ga0495588_0081711_1045_1674 203
117 3300048913 Ga0496110_0141027 Ga0496110_0141027_1200_1829 203
118 3300001989 JGI24739J22299_10030154 JGI24739J22299_100301542 204
119 3300003322 rootL2_10258975 rootL2_102589752 204
120 3300005335 Ga0070666_10245239 Ga0070666_102452391 204
121 3300005339 Ga0070660_100048593 Ga0070660_1000485933 204
122 3300005347 Ga0070668_100312791 Ga0070668_1003127912 204
123 3300005366 Ga0070659_100127156 Ga0070659_1001271562 204
124 3300005456 Ga0070678_100153977 Ga0070678_1001539772 204
125 3300005456 Ga0070678_100304578 Ga0070678_1003045782 204
126 3300009011 Ga0105251_10000285 Ga0105251_1000028545 204
127 3300009011 Ga0105251_10073001 Ga0105251_100730012 204
128 3300009036 Ga0105244_10104119 Ga0105244_101041192 204
129 3300009098 Ga0105245_10409356 Ga0105245_104093562 204
130 3300009101 Ga0105247_10599779 Ga0105247_105997791 204
131 3300009174 Ga0105241_10192794 Ga0105241_101927942 204
132 3300009545 Ga0105237_10261873 Ga0105237_102618731 204
133 3300009553 Ga0105249_10786805 Ga0105249_107868051 204
134 3300013105 Ga0157369_10000252 Ga0157369_1000025227 204
135 3300013105 Ga0157369_10000799 Ga0157369_100007996 204
136 3300013105 Ga0157369_10029169 Ga0157369_100291693 204
137 3300013296 Ga0157374_10730228 Ga0157374_107302282 204
138 3300013306 Ga0163162_10033960 Ga0163162_100339602 204
139 3300013308 Ga0157375_10022520 Ga0157375_100225207 204
140 3300016635 Ga0183361_10025 Ga0183361_1002532 204
141 3300020069 Ga0197907_11478289 Ga0197907_114782892 204
142 3300020070 Ga0206356_10059520 Ga0206356_100595202 204
143 3300020081 Ga0206354_11201333 Ga0206354_112013332 204
144 3300020082 Ga0206353_10720401 Ga0206353_107204015 204
145 3300022467 Ga0224712_10000087 Ga0224712_100000876 204
146 3300025302 Ga0207426_1002525 Ga0207426_10025253 204
147 3300025735 Ga0207713_1002521 Ga0207713_100252113 204
148 3300025903 Ga0207680_10218614 Ga0207680_102186142 204
149 3300025904 Ga0207647_10028534 Ga0207647_100285342 204
150 3300025909 Ga0207705_10002820 Ga0207705_100028203 204
151 3300025911 Ga0207654_10145099 Ga0207654_101450992 204
152 3300025932 Ga0207690_10165573 Ga0207690_101655731 204
153 3300025941 Ga0207711_10077806 Ga0207711_100778062 204
154 3300025949 Ga0207667_10006660 Ga0207667_100066609 204
155 3300026067 Ga0207678_10030240 Ga0207678_100302403 204
156 3300026067 Ga0207678_10302003 Ga0207678_103020032 204
157 3300037312 Ga0395899_0038496 Ga0395899_0038496_762_1406 204
158 3300037418 Ga0395900_0001108 Ga0395900_0001108_10834_11484 204
159 3300037418 Ga0395900_0164068 Ga0395900_0164068_1040_1690 204
160 3300037466 Ga0395898_0002771 Ga0395898_0002771_8678_9328 204
161 3300037471 Ga0395905_0085899 Ga0395905_0085899_653_1327 204
162 3300038443 Ga0395901_0000011 Ga0395901_0000011_51706_52350 204
163 3300044693 Ga0466961_0284539 Ga0466961_0284539_231_848 204
164 3300044765 Ga0466970_0107843 Ga0466970_0107843_644_1261 204
165 3300044842 Ga0466957_0131656 Ga0466957_0131656_481_1101 204
166 3300044901 Ga0466960_0154775 Ga0466960_0154775_204_821 204
167 3300046454 Ga0495592_0142197 Ga0495592_0142197_221_895 204
168 3300046455 Ga0495603_0003117 Ga0495603_0003117_7352_7975 204
169 3300046457 Ga0495590_0001198 Ga0495590_0001198_328_999 204
170 3300046459 Ga0495629_0000060 Ga0495629_0000060_46559_47173 204
171 3300046459 Ga0495629_0000293 Ga0495629_0000293_20670_21293 204
172 3300046460 Ga0495638_0031414 Ga0495638_0031414_1924_2571 204
173 3300046462 Ga0495651_0312217 Ga0495651_0312217_179_802 204
174 3300046463 Ga0495653_0005778 Ga0495653_0005778_9078_9692 204
175 3300046463 Ga0495653_0020615 Ga0495653_0020615_1290_1964 204
176 3300046463 Ga0495653_0149678 Ga0495653_0149678_287_907 204
177 3300046471 Ga0495650_0001534 Ga0495650_0001534_17864_18487 204
178 3300046471 Ga0495650_0029993 Ga0495650_0029993_602_1249 204
179 3300046472 Ga0495580_0015141 Ga0495580_0015141_3497_4120 204
180 3300046472 Ga0495580_0055005 Ga0495580_0055005_1756_2370 204
181 3300046472 Ga0495580_0074206 Ga0495580_0074206_1723_2337 204
182 3300046474 Ga0495605_0035260 Ga0495605_0035260_86_733 204
183 3300046477 Ga0495664_0000037 Ga0495664_0000037_55385_56059 204
184 3300046477 Ga0495664_0020030 Ga0495664_0020030_972_1622 204
185 3300046501 Ga0495607_0061710 Ga0495607_0061710_1360_1983 204
186 3300046501 Ga0495607_0158484 Ga0495607_0158484_287_934 204
187 3300046506 Ga0495583_0065841 Ga0495583_0065841_698_1312 204
188 3300046506 Ga0495583_0154454 Ga0495583_0154454_80_703 204
189 3300046507 Ga0495606_0044280 Ga0495606_0044280_816_1490 204
190 3300046514 Ga0495618_0036159 Ga0495618_0036159_2280_2894 204
191 3300046515 Ga0495620_0030260 Ga0495620_0030260_1509_2129 204
192 3300046516 Ga0495628_0084586 Ga0495628_0084586_626_1300 204
193 3300046516 Ga0495628_0488931 Ga0495628_0488931_205_828 204
194 3300046517 Ga0495630_0075338 Ga0495630_0075338_1140_1760 204
195 3300046518 Ga0495631_0202808 Ga0495631_0202808_24_671 204
196 3300046526 Ga0495666_0065328 Ga0495666_0065328_52_672 204
197 3300046526 Ga0495666_0103527 Ga0495666_0103527_299_913 204
198 3300046528 Ga0495642_0153723 Ga0495642_0153723_237_878 204
199 3300046529 Ga0495652_0114953 Ga0495652_0114953_130_744 204
200 3300046529 Ga0495652_0343662 Ga0495652_0343662_29_703 204
201 3300046530 Ga0495654_0077992 Ga0495654_0077992_128_751 204
202 3300046531 Ga0495665_0024330 Ga0495665_0024330_2503_3117 204
203 3300046531 Ga0495665_0189106 Ga0495665_0189106_435_1049 204
204 3300046542 Ga0495597_0010325 Ga0495597_0010325_2545_3216 204
205 3300046543 Ga0495645_0002587 Ga0495645_0002587_5074_5697 204
206 3300046543 Ga0495645_0029285 Ga0495645_0029285_1652_2302 204
207 3300046543 Ga0495645_0036751 Ga0495645_0036751_700_1374 204
208 3300046665 Ga0495661_0070879 Ga0495661_0070879_735_1349 204
209 3300046680 Ga0495646_0021707 Ga0495646_0021707_3262_3876 204
210 3300046680 Ga0495646_0212121 Ga0495646_0212121_22_645 204
211 3300046684 Ga0495669_0081969 Ga0495669_0081969_434_1081 204
212 3300046689 Ga0495613_0275178 Ga0495613_0275178_351_965 204
213 3300046690 Ga0495624_0012200 Ga0495624_0012200_436_1050 204
214 3300046690 Ga0495624_0049521 Ga0495624_0049521_1912_2532 204
215 3300046690 Ga0495624_0111403 Ga0495624_0111403_633_1247 204
216 3300046690 Ga0495624_0203014 Ga0495624_0203014_396_1016 204
217 3300046692 Ga0495671_0026988 Ga0495671_0026988_774_1388 204
218 3300046694 Ga0495649_0009005 Ga0495649_0009005_2308_2922 204
219 3300046694 Ga0495649_0221304 Ga0495649_0221304_284_931 204
220 3300046794 Ga0495589_0173548 Ga0495589_0173548_212_835 204
221 3300046794 Ga0495589_0204091 Ga0495589_0204091_29_643 204
222 3300046794 Ga0495589_0241043 Ga0495589_0241043_107_754 204
223 3300046809 Ga0495600_0037491 Ga0495600_0037491_1461_2084 204
224 3300047317 Ga0495604_0360784 Ga0495604_0360784_78_728 204
225 3300047319 Ga0495674_0010551 Ga0495674_0010551_436_1050 204
226 3300047319 Ga0495674_0010793 Ga0495674_0010793_7522_8136 204
227 3300047319 Ga0495674_0021606 Ga0495674_0021606_436_1050 204
228 3300047320 Ga0495672_0040557 Ga0495672_0040557_853_1467 204
229 3300047320 Ga0495672_0093439 Ga0495672_0093439_467_1138 204
230 3300047321 Ga0495676_0037922 Ga0495676_0037922_2607_3221 204
231 3300047321 Ga0495676_0299143 Ga0495676_0299143_73_687 204
232 3300047322 Ga0495680_0037364 Ga0495680_0037364_767_1387 204
233 3300047323 Ga0495683_0005878 Ga0495683_0005878_4230_4901 204
234 3300047323 Ga0495683_0073165 Ga0495683_0073165_76_723 204
235 3300047443 Ga0495687_013038 Ga0495687_013038_2854_3525 204
236 3300047443 Ga0495687_021773 Ga0495687_021773_1842_2465 204
237 3300047444 Ga0495675_0146102 Ga0495675_0146102_339_962 204
238 3300047446 Ga0495679_043147 Ga0495679_043147_253_900 204
239 3300047472 Ga0495686_0000032 Ga0495686_0000032_139828_140460 204
240 3300047673 Ga0495593_0018129 Ga0495593_0018129_755_1375 204
241 3300047673 Ga0495593_0047906 Ga0495593_0047906_1058_1678 204
242 3300047673 Ga0495593_0054319 Ga0495593_0054319_266_889 204
243 3300047673 Ga0495593_0089337 Ga0495593_0089337_954_1568 204
244 3300047673 Ga0495593_0125395 Ga0495593_0125395_525_1145 204
245 3300047673 Ga0495593_0151324 Ga0495593_0151324_408_1022 204
246 3300048088 Ga0495602_0165400 Ga0495602_0165400_349_1023 204
247 3300048088 Ga0495602_0200242 Ga0495602_0200242_134_754 204
248 3300048088 Ga0495602_0587669 Ga0495602_0587669_111_725 204
249 3300048089 Ga0495614_0015123 Ga0495614_0015123_1878_2501 204
250 3300048089 Ga0495614_0055421 Ga0495614_0055421_706_1320 204
251 3300048091 Ga0495626_0127335 Ga0495626_0127335_267_914 204
252 3300048903 Ga0496100_0004725 Ga0496100_0004725_4099_4719 204
253 3300048903 Ga0496100_0045298 Ga0496100_0045298_244_918 204
254 3300048903 Ga0496100_0347557 Ga0496100_0347557_291_917 204
255 3300048904 Ga0496101_0064041 Ga0496101_0064041_486_1157 204
256 3300048905 Ga0496102_0014935 Ga0496102_0014935_4922_5542 204
257 3300048905 Ga0496102_0014965 Ga0496102_0014965_2804_3451 204
258 3300048905 Ga0496102_0112474 Ga0496102_0112474_1497_2117 204
259 3300048906 Ga0496103_0039955 Ga0496103_0039955_491_1162 204
260 3300048907 Ga0496104_0108279 Ga0496104_0108279_419_1090 204
261 3300048907 Ga0496104_0173028 Ga0496104_0173028_1235_1858 204
262 3300048909 Ga0496106_0007504 Ga0496106_0007504_5548_6219 204
263 3300048909 Ga0496106_0093973 Ga0496106_0093973_931_1551 204
264 3300048909 Ga0496106_0113993 Ga0496106_0113993_427_1074 204
265 3300048910 Ga0496107_0009382 Ga0496107_0009382_1811_2482 204
266 3300048910 Ga0496107_0379083 Ga0496107_0379083_163_783 204
267 3300048911 Ga0496108_0455869 Ga0496108_0455869_195_818 204
268 3300048911 Ga0496108_0496141 Ga0496108_0496141_351_1022 204
269 3300048912 Ga0496109_0022399 Ga0496109_0022399_3398_4018 204
270 3300048913 Ga0496110_0001369 Ga0496110_0001369_15864_16535 204
271 3300048914 Ga0496111_0110500 Ga0496111_0110500_223_843 204
272 3300048915 Ga0496112_0004198 Ga0496112_0004198_2042_2713 204
273 3300048916 Ga0496113_0002111 Ga0496113_0002111_8978_9649 204
274 3300048917 Ga0496114_0010010 Ga0496114_0010010_2588_3211 204
275 3300048918 Ga0496115_0134173 Ga0496115_0134173_1010_1633 204
276 3300048918 Ga0496115_0413479 Ga0496115_0413479_77_724 204
277 3300048919 Ga0496116_0016509 Ga0496116_0016509_1759_2430 204
278 3300048920 Ga0496117_0002293 Ga0496117_0002293_13134_13766 204
279 3300048921 Ga0496118_0007277 Ga0496118_0007277_642_1274 204
280 3300048921 Ga0496118_0043531 Ga0496118_0043531_1642_2313 204
281 3300048921 Ga0496118_0173453 Ga0496118_0173453_242_862 204
282 3300048921 Ga0496118_0255320 Ga0496118_0255320_291_938 204
283 3300048924 Ga0496121_0006654 Ga0496121_0006654_11127_11798 204
284 3300048924 Ga0496121_0146942 Ga0496121_0146942_839_1453 204
285 3300048925 Ga0496122_0007677 Ga0496122_0007677_1529_2149 204
286 3300048926 Ga0496123_0007642 Ga0496123_0007642_8310_8981 204
287 3300048928 Ga0496125_0010691 Ga0496125_0010691_7928_8599 204
288 3300048929 Ga0496126_0000034 Ga0496126_0000034_125705_126337 204
289 3300048929 Ga0496126_0003420 Ga0496126_0003420_3578_4204 204
290 3300048929 Ga0496126_0229688 Ga0496126_0229688_513_1187 204
291 3300048929 Ga0496126_0671075 Ga0496126_0671075_122_742 204
292 3300049459 Ga0495678_064518 Ga0495678_064518_599_1219 204
293 3300049460 Ga0495682_0002263 Ga0495682_0002263_2586_3200 204
294 iso_pu_bacteria 2526164713 2527080741 204
295 iso_pu_bacteria 2738541298 2738830853 204
296 iso_pu_bacteria 2738541306 2738872380 204
297 iso_pu_bacteria 2738543002 2739184010 204
298 iso_pu_bacteria 2738543008 2739218980 204
299 iso_pu_bacteria 2808606384 2808970015 204
300 iso_pu_bacteria 2808606390 2809005138 204
301 iso_pu_bacteria 2808606391 2809011721 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12804

NTP_transf_3

MobA-like NTP transferase domain

30

199

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h4d-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.9102 8 201
1e5k-assembly1.cif.gz_A crystal structure of the molybdenum cofactor biosynthesis protein moba (protein fa) from escherichia coli at near atomic resolution 0.91 8 201
1h4c-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.9094 8 201
1h4e-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.9093 8 201
1hjj-assembly1.cif.gz_A biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba 0.9091 8 201
ID Description Score Start End Superfamily
1frwA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9227 5 202 3.90.550.10
1frwA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9037 5 202 3.90.550.10
af_P9WJQ9_9_197_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8458 8 199 3.90.550.10
2e8bA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8394 4 193 3.90.550.10
af_Q7XCL5_1_80_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8228 129 144 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A2T0KYA5-F1-model_v4 Molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.9902 1 204 GO:0005525
GO:0005737
GO:0046872
GO:0061603
GO:1902758
AF-A0A158HR12-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein MobA 0.9881 21 204 GO:0005525
GO:0016779
GO:1902758
AF-A2WBL2-F1-model_v4 deleted 0.9873 6 204
AF-A0A158HR12-F1-model_v4 Molybdopterin-guanine dinucleotide biosynthesis protein MobA 0.9828 21 204 GO:0005525
GO:0016779
GO:1902758
AF-E1T5N2-F1-model_v4 Molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) 0.9815 2 204 GO:0005525
GO:0005737
GO:0046872
GO:0061603
GO:1902758

Feature Viewer

pLDDT pTM Quality
90.62 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map