F395892
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 194 | 259 | 205 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10261873|Ga0105237_102618731 |
| Length | 224 |
| Sequence | MRVASRCRTSAAERVGSLVLNAHSASTVTALVLAGGRGSRMGGVDKGMQPFHGEPLALHVMRRIAPQADALLISANRSIEDYERLGAAFGARVIPDTRADYPGPLAGIAAALRAATTQYVLTAPCDAPFVDEHIGVTLMQALDAHGGDVAYAATIDASGQVMAHPVFALLRTSLADDLDAWLDRGERKVRAWYARHKPVEVRFHDERAFYNINDLQQLAELERR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 2 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 3 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 4 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 5 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 6 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 7 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 8 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 9 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 10 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 11 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 12 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 13 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 14 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 15 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 16 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 17 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 18 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 19 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 20 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 21 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 22 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 23 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 24 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 25 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 26 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 27 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 28 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 29 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 30 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 31 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 32 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 33 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 34 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 35 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 36 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 37 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 38 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 39 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 40 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 42 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 43 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 44 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 64 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 68 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 75 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 89 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 90 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 91 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 92 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 93 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 94 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 95 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 96 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 97 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 98 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 99 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 100 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 101 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 102 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 103 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 104 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 105 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 106 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 107 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 162 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 163 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 164 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 165 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 166 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 169 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 170 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 171 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 172 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 175 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 176 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 177 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 178 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 179 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 180 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 181 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 182 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 183 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 184 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 187 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 188 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 189 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 190 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 191 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 192 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 193 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 194 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.39 |
| Metatranscriptomes | 1.66 |
| Isolates | 13.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.65 |
| Nodule | 1.33 |
| Rhizoplane | 10.63 |
| Rhizosphere | 67.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10030154 | 3300001989 | Bacteria | 1881 |
| 2 | JGI25156J39149_1001319 | 3300002705 | Bacteria | 10730 |
| 3 | JGI25156J39149_1004557 | 3300002705 | Bacteria | 4189 |
| 4 | rootH2_10070720 | 3300003320 | Bacteria | 2802 |
| 5 | rootL2_10258975 | 3300003322 | Bacteria | 1584 |
| 6 | rootH1_10037770 | 3300003323 | Bacteria | 1490 |
| 7 | Ga0055532_1000643 | 3300003758 | Bacteria | 13493 |
| 8 | Ga0055527_1003140 | 3300003760 | Bacteria | 2540 |
| 9 | Ga0055535_1001317 | 3300003761 | Bacteria | 13235 |
| 10 | Ga0055542_1001665 | 3300003762 | Bacteria | 9904 |
| 11 | Ga0055529_1000552 | 3300003763 | Bacteria | 31487 |
| 12 | Ga0070666_10245239 | 3300005335 | Bacteria | 1267 |
| 13 | Ga0070660_100048593 | 3300005339 | Bacteria | 3259 |
| 14 | Ga0070668_100312791 | 3300005347 | Bacteria | 1320 |
| 15 | Ga0070659_100127156 | 3300005366 | Bacteria | 2068 |
| 16 | Ga0070678_100153977 | 3300005456 | Bacteria | 1855 |
| 17 | Ga0070678_100304578 | 3300005456 | Bacteria | 1355 |
| 18 | Ga0105251_10000285 | 3300009011 | Bacteria | 50961 |
| 19 | Ga0105251_10073001 | 3300009011 | Bacteria | 1595 |
| 20 | Ga0105244_10104119 | 3300009036 | Bacteria | 1385 |
| 21 | Ga0105240_10969875 | 3300009093 | Bacteria | 911 |
| 22 | Ga0105245_10409356 | 3300009098 | Bacteria | 1357 |
| 23 | Ga0105247_10599779 | 3300009101 | Bacteria | 816 |
| 24 | Ga0105241_10192794 | 3300009174 | Bacteria | 1697 |
| 25 | Ga0105237_10006196 | 3300009545 | Bacteria | 13345 |
| 26 | Ga0105237_10042833 | 3300009545 | Bacteria | 4563 |
| 27 | Ga0105237_10261873 | 3300009545 | Bacteria | 1732 |
| 28 | Ga0105249_10786805 | 3300009553 | Bacteria | 1015 |
| 29 | Ga0157370_10009710 | 3300013104 | Bacteria | 10231 |
| 30 | Ga0157369_10000252 | 3300013105 | Bacteria | 73217 |
| 31 | Ga0157369_10000799 | 3300013105 | Bacteria | 40249 |
| 32 | Ga0157369_10029169 | 3300013105 | Bacteria | 6099 |
| 33 | Ga0157374_10730228 | 3300013296 | Bacteria | 1004 |
| 34 | Ga0163162_10033960 | 3300013306 | Bacteria | 5073 |
| 35 | Ga0157375_10022520 | 3300013308 | Bacteria | 5799 |
| 36 | Ga0183361_10025 | 3300016635 | Bacteria | 72014 |
| 37 | Ga0197907_11478289 | 3300020069 | Bacteria | 2660 |
| 38 | Ga0206356_10059520 | 3300020070 | Bacteria | 6414 |
| 39 | Ga0206354_11201333 | 3300020081 | Bacteria | 2816 |
| 40 | Ga0206353_10720401 | 3300020082 | Bacteria | 5503 |
| 41 | Ga0224712_10000087 | 3300022467 | Bacteria | 14342 |
| 42 | Ga0209674_100424 | 3300025226 | Bacteria | 20459 |
| 43 | Ga0209672_100051 | 3300025228 | Bacteria | 234414 |
| 44 | Ga0209147_100192 | 3300025229 | Bacteria | 70162 |
| 45 | Ga0209258_100031 | 3300025242 | Bacteria | 463572 |
| 46 | Ga0209148_1000027 | 3300025254 | Bacteria | 616374 |
| 47 | Ga0209148_1000400 | 3300025254 | Bacteria | 50569 |
| 48 | Ga0209759_1000147 | 3300025256 | Bacteria | 121320 |
| 49 | Ga0209759_1001732 | 3300025256 | Bacteria | 11236 |
| 50 | Ga0209455_1000213 | 3300025272 | Bacteria | 82040 |
| 51 | Ga0209673_1000201 | 3300025273 | Bacteria | 120059 |
| 52 | Ga0207426_1002525 | 3300025302 | Bacteria | 11483 |
| 53 | Ga0207713_1002521 | 3300025735 | Bacteria | 13264 |
| 54 | Ga0207680_10218614 | 3300025903 | Bacteria | 1305 |
| 55 | Ga0207647_10028534 | 3300025904 | Bacteria | 3622 |
| 56 | Ga0207705_10002820 | 3300025909 | Bacteria | 13287 |
| 57 | Ga0207654_10145099 | 3300025911 | Bacteria | 1518 |
| 58 | Ga0207690_10165573 | 3300025932 | Bacteria | 1652 |
| 59 | Ga0207711_10077806 | 3300025941 | Bacteria | 2892 |
| 60 | Ga0207667_10006660 | 3300025949 | Bacteria | 13964 |
| 61 | Ga0207667_10894446 | 3300025949 | Bacteria | 880 |
| 62 | Ga0207678_10030240 | 3300026067 | Bacteria | 4728 |
| 63 | Ga0207678_10302003 | 3300026067 | Bacteria | 1376 |
| 64 | Ga0209371_1000297 | 3300027312 | Bacteria | 55845 |
| 65 | Ga0268256_1000261 | 3300030500 | Bacteria | 55844 |
| 66 | Ga0395899_0000041 | 3300037312 | Bacteria | 255615 |
| 67 | Ga0395899_0026575 | 3300037312 | Bacteria | 4367 |
| 68 | Ga0395899_0038496 | 3300037312 | Bacteria | 3582 |
| 69 | Ga0395900_0001108 | 3300037418 | Bacteria | 34263 |
| 70 | Ga0395900_0001690 | 3300037418 | Bacteria | 25639 |
| 71 | Ga0395900_0027150 | 3300037418 | Bacteria | 5861 |
| 72 | Ga0395900_0164068 | 3300037418 | Bacteria | 2265 |
| 73 | Ga0395898_0000220 | 3300037466 | Bacteria | 146473 |
| 74 | Ga0395898_0002771 | 3300037466 | Bacteria | 20150 |
| 75 | Ga0395898_0051021 | 3300037466 | Bacteria | 4046 |
| 76 | Ga0395898_0136351 | 3300037466 | Bacteria | 2350 |
| 77 | Ga0395905_0085899 | 3300037471 | Bacteria | 2948 |
| 78 | Ga0395901_0000011 | 3300038443 | Bacteria | 400724 |
| 79 | Ga0395901_0000106 | 3300038443 | Bacteria | 114313 |
| 80 | Ga0395901_0000264 | 3300038443 | Bacteria | 65306 |
| 81 | Ga0466969_0043528 | 3300044656 | Bacteria | 2237 |
| 82 | Ga0466972_0055743 | 3300044658 | Bacteria | 1901 |
| 83 | Ga0466972_0172771 | 3300044658 | Bacteria | 1014 |
| 84 | Ga0466965_0046225 | 3300044683 | Bacteria | 2154 |
| 85 | Ga0466966_0000066 | 3300044684 | Bacteria | 69299 |
| 86 | Ga0466966_0019436 | 3300044684 | Bacteria | 4468 |
| 87 | Ga0466966_0021970 | 3300044684 | Bacteria | 4189 |
| 88 | Ga0466961_0000037 | 3300044693 | Bacteria | 80759 |
| 89 | Ga0466961_0018267 | 3300044693 | Bacteria | 4508 |
| 90 | Ga0466961_0127055 | 3300044693 | Bacteria | 1599 |
| 91 | Ga0466961_0284539 | 3300044693 | Bacteria | 1011 |
| 92 | Ga0466963_0001971 | 3300044694 | Bacteria | 11270 |
| 93 | Ga0466963_0041379 | 3300044694 | Bacteria | 3022 |
| 94 | Ga0466971_0021577 | 3300044719 | Bacteria | 2865 |
| 95 | Ga0466971_0049216 | 3300044719 | Bacteria | 1896 |
| 96 | Ga0466970_0005329 | 3300044765 | Bacteria | 6377 |
| 97 | Ga0466970_0107843 | 3300044765 | Bacteria | 1520 |
| 98 | Ga0466957_0008754 | 3300044842 | Bacteria | 5761 |
| 99 | Ga0466957_0031699 | 3300044842 | Bacteria | 3160 |
| 100 | Ga0466957_0131656 | 3300044842 | Bacteria | 1603 |
| 101 | Ga0466957_0178111 | 3300044842 | Bacteria | 1387 |
| 102 | Ga0466960_0154775 | 3300044901 | Bacteria | 1227 |
| 103 | Ga0466959_0046821 | 3300045049 | Bacteria | 3182 |
| 104 | Ga0466959_0260581 | 3300045049 | Bacteria | 1193 |
| 105 | Ga0466958_0007158 | 3300045836 | Bacteria | 6116 |
| 106 | Ga0466958_0013575 | 3300045836 | Bacteria | 4640 |
| 107 | Ga0466958_0033891 | 3300045836 | Bacteria | 3044 |
| 108 | Ga0466967_0491630 | 3300045976 | Bacteria | 1203 |
| 109 | Ga0495592_0142197 | 3300046454 | Bacteria | 1668 |
| 110 | Ga0495592_0260220 | 3300046454 | Bacteria | 1143 |
| 111 | Ga0495603_0003117 | 3300046455 | Bacteria | 9852 |
| 112 | Ga0495590_0001198 | 3300046457 | Bacteria | 11339 |
| 113 | Ga0495629_0000060 | 3300046459 | Bacteria | 100921 |
| 114 | Ga0495629_0000293 | 3300046459 | Bacteria | 43087 |
| 115 | Ga0495629_0195061 | 3300046459 | Bacteria | 1401 |
| 116 | Ga0495638_0031414 | 3300046460 | Bacteria | 3413 |
| 117 | Ga0495651_0312217 | 3300046462 | Bacteria | 1051 |
| 118 | Ga0495653_0005778 | 3300046463 | Bacteria | 10126 |
| 119 | Ga0495653_0020615 | 3300046463 | Bacteria | 5342 |
| 120 | Ga0495653_0149678 | 3300046463 | Bacteria | 1632 |
| 121 | Ga0495650_0001534 | 3300046471 | Bacteria | 21930 |
| 122 | Ga0495650_0029993 | 3300046471 | Bacteria | 2470 |
| 123 | Ga0495580_0015141 | 3300046472 | Bacteria | 5835 |
| 124 | Ga0495580_0055005 | 3300046472 | Bacteria | 2805 |
| 125 | Ga0495580_0074206 | 3300046472 | Bacteria | 2374 |
| 126 | Ga0495605_0035260 | 3300046474 | Bacteria | 2529 |
| 127 | Ga0495664_0000037 | 3300046477 | Bacteria | 70108 |
| 128 | Ga0495664_0020030 | 3300046477 | Bacteria | 3854 |
| 129 | Ga0495607_0061710 | 3300046501 | Bacteria | 2129 |
| 130 | Ga0495607_0158484 | 3300046501 | Bacteria | 1152 |
| 131 | Ga0495583_0065841 | 3300046506 | Bacteria | 1604 |
| 132 | Ga0495583_0154454 | 3300046506 | Bacteria | 950 |
| 133 | Ga0495606_0044280 | 3300046507 | Bacteria | 2961 |
| 134 | Ga0495606_0069162 | 3300046507 | Bacteria | 2231 |
| 135 | Ga0495618_0036159 | 3300046514 | Bacteria | 3099 |
| 136 | Ga0495620_0030260 | 3300046515 | Bacteria | 2495 |
| 137 | Ga0495628_0084586 | 3300046516 | Bacteria | 2461 |
| 138 | Ga0495628_0488931 | 3300046516 | Bacteria | 890 |
| 139 | Ga0495630_0075338 | 3300046517 | Bacteria | 2543 |
| 140 | Ga0495631_0202808 | 3300046518 | Bacteria | 848 |
| 141 | Ga0495666_0065214 | 3300046526 | Bacteria | 1737 |
| 142 | Ga0495666_0065328 | 3300046526 | Bacteria | 1736 |
| 143 | Ga0495666_0103527 | 3300046526 | Bacteria | 1340 |
| 144 | Ga0495642_0153723 | 3300046528 | Bacteria | 996 |
| 145 | Ga0495652_0114953 | 3300046529 | Bacteria | 2158 |
| 146 | Ga0495652_0343662 | 3300046529 | Bacteria | 1071 |
| 147 | Ga0495654_0077992 | 3300046530 | Bacteria | 1558 |
| 148 | Ga0495665_0024330 | 3300046531 | Bacteria | 3253 |
| 149 | Ga0495665_0189106 | 3300046531 | Bacteria | 1068 |
| 150 | Ga0495597_0010325 | 3300046542 | Bacteria | 4570 |
| 151 | Ga0495645_0002587 | 3300046543 | Bacteria | 12299 |
| 152 | Ga0495645_0029285 | 3300046543 | Bacteria | 4003 |
| 153 | Ga0495645_0036751 | 3300046543 | Bacteria | 3569 |
| 154 | Ga0495661_0070879 | 3300046665 | Bacteria | 2038 |
| 155 | Ga0495588_0081711 | 3300046674 | Bacteria | 1687 |
| 156 | Ga0495599_0239274 | 3300046678 | Bacteria | 1107 |
| 157 | Ga0495646_0021707 | 3300046680 | Bacteria | 4055 |
| 158 | Ga0495646_0152667 | 3300046680 | Bacteria | 1283 |
| 159 | Ga0495646_0212121 | 3300046680 | Bacteria | 1050 |
| 160 | Ga0495669_0081969 | 3300046684 | Bacteria | 1482 |
| 161 | Ga0495613_0275178 | 3300046689 | Bacteria | 1170 |
| 162 | Ga0495624_0012200 | 3300046690 | Bacteria | 5883 |
| 163 | Ga0495624_0049521 | 3300046690 | Bacteria | 2664 |
| 164 | Ga0495624_0111403 | 3300046690 | Bacteria | 1682 |
| 165 | Ga0495624_0203014 | 3300046690 | Bacteria | 1204 |
| 166 | Ga0495670_0003027 | 3300046691 | Bacteria | 8293 |
| 167 | Ga0495671_0026988 | 3300046692 | Bacteria | 2970 |
| 168 | Ga0495649_0009005 | 3300046694 | Bacteria | 5961 |
| 169 | Ga0495649_0221304 | 3300046694 | Bacteria | 979 |
| 170 | Ga0495589_0173548 | 3300046794 | Bacteria | 1024 |
| 171 | Ga0495589_0204091 | 3300046794 | Bacteria | 932 |
| 172 | Ga0495589_0241043 | 3300046794 | Bacteria | 846 |
| 173 | Ga0495600_0037491 | 3300046809 | Bacteria | 3152 |
| 174 | Ga0495604_0244029 | 3300047317 | Bacteria | 1227 |
| 175 | Ga0495604_0360784 | 3300047317 | Bacteria | 964 |
| 176 | Ga0495674_0010551 | 3300047319 | Bacteria | 8744 |
| 177 | Ga0495674_0010793 | 3300047319 | Bacteria | 8643 |
| 178 | Ga0495674_0021606 | 3300047319 | Bacteria | 5950 |
| 179 | Ga0495674_0041704 | 3300047319 | Bacteria | 4098 |
| 180 | Ga0495672_0040557 | 3300047320 | Bacteria | 2822 |
| 181 | Ga0495672_0093439 | 3300047320 | Bacteria | 1647 |
| 182 | Ga0495676_0037922 | 3300047321 | Bacteria | 4007 |
| 183 | Ga0495676_0299143 | 3300047321 | Bacteria | 1085 |
| 184 | Ga0495680_0037364 | 3300047322 | Bacteria | 3890 |
| 185 | Ga0495683_0005878 | 3300047323 | Bacteria | 6743 |
| 186 | Ga0495683_0073165 | 3300047323 | Bacteria | 1681 |
| 187 | Ga0495687_000025 | 3300047443 | Bacteria | 310498 |
| 188 | Ga0495687_013038 | 3300047443 | Bacteria | 4358 |
| 189 | Ga0495687_021773 | 3300047443 | Bacteria | 3091 |
| 190 | Ga0495675_0146102 | 3300047444 | Bacteria | 1463 |
| 191 | Ga0495679_043147 | 3300047446 | Bacteria | 1388 |
| 192 | Ga0495686_0000032 | 3300047472 | Bacteria | 345132 |
| 193 | Ga0495593_0018129 | 3300047673 | Bacteria | 3958 |
| 194 | Ga0495593_0047906 | 3300047673 | Bacteria | 2272 |
| 195 | Ga0495593_0054319 | 3300047673 | Bacteria | 2112 |
| 196 | Ga0495593_0089337 | 3300047673 | Bacteria | 1587 |
| 197 | Ga0495593_0125395 | 3300047673 | Bacteria | 1305 |
| 198 | Ga0495593_0151324 | 3300047673 | Bacteria | 1173 |
| 199 | Ga0495602_0025863 | 3300048088 | Bacteria | 5673 |
| 200 | Ga0495602_0165400 | 3300048088 | Bacteria | 1722 |
| 201 | Ga0495602_0200242 | 3300048088 | Bacteria | 1524 |
| 202 | Ga0495602_0587669 | 3300048088 | Bacteria | 767 |
| 203 | Ga0495614_0015123 | 3300048089 | Bacteria | 3367 |
| 204 | Ga0495614_0055421 | 3300048089 | Bacteria | 1700 |
| 205 | Ga0495626_0127335 | 3300048091 | Bacteria | 1090 |
| 206 | Ga0496100_0004725 | 3300048903 | Bacteria | 7262 |
| 207 | Ga0496100_0045298 | 3300048903 | Bacteria | 2822 |
| 208 | Ga0496100_0347557 | 3300048903 | Bacteria | 1119 |
| 209 | Ga0496101_0064041 | 3300048904 | Bacteria | 2677 |
| 210 | Ga0496102_0014935 | 3300048905 | Bacteria | 6757 |
| 211 | Ga0496102_0014965 | 3300048905 | Bacteria | 6752 |
| 212 | Ga0496102_0112474 | 3300048905 | Bacteria | 2540 |
| 213 | Ga0496103_0039955 | 3300048906 | Bacteria | 2883 |
| 214 | Ga0496104_0108279 | 3300048907 | Bacteria | 2663 |
| 215 | Ga0496104_0173028 | 3300048907 | Bacteria | 2070 |
| 216 | Ga0496106_0000019 | 3300048909 | Bacteria | 174698 |
| 217 | Ga0496106_0007504 | 3300048909 | Bacteria | 8061 |
| 218 | Ga0496106_0093973 | 3300048909 | Bacteria | 2318 |
| 219 | Ga0496106_0113993 | 3300048909 | Bacteria | 2108 |
| 220 | Ga0496107_0009382 | 3300048910 | Bacteria | 6785 |
| 221 | Ga0496107_0379083 | 3300048910 | Bacteria | 1052 |
| 222 | Ga0496108_0455869 | 3300048911 | Bacteria | 1117 |
| 223 | Ga0496108_0496141 | 3300048911 | Bacteria | 1066 |
| 224 | Ga0496109_0022399 | 3300048912 | Bacteria | 5595 |
| 225 | Ga0496110_0001369 | 3300048913 | Bacteria | 17558 |
| 226 | Ga0496110_0141027 | 3300048913 | Bacteria | 2179 |
| 227 | Ga0496111_0110500 | 3300048914 | Bacteria | 2024 |
| 228 | Ga0496112_0004198 | 3300048915 | Bacteria | 12147 |
| 229 | Ga0496113_0002111 | 3300048916 | Bacteria | 11463 |
| 230 | Ga0496114_0010010 | 3300048917 | Bacteria | 7538 |
| 231 | Ga0496114_0642590 | 3300048917 | Bacteria | 934 |
| 232 | Ga0496115_0134173 | 3300048918 | Bacteria | 2041 |
| 233 | Ga0496115_0413479 | 3300048918 | Bacteria | 1093 |
| 234 | Ga0496116_0016509 | 3300048919 | Bacteria | 5772 |
| 235 | Ga0496116_0067889 | 3300048919 | Bacteria | 2275 |
| 236 | Ga0496117_0002293 | 3300048920 | Bacteria | 24665 |
| 237 | Ga0496117_0130760 | 3300048920 | Bacteria | 1522 |
| 238 | Ga0496118_0007277 | 3300048921 | Bacteria | 11784 |
| 239 | Ga0496118_0017806 | 3300048921 | Bacteria | 6447 |
| 240 | Ga0496118_0043531 | 3300048921 | Bacteria | 3527 |
| 241 | Ga0496118_0173453 | 3300048921 | Bacteria | 1314 |
| 242 | Ga0496118_0255320 | 3300048921 | Bacteria | 993 |
| 243 | Ga0496119_0178422 | 3300048922 | Bacteria | 1116 |
| 244 | Ga0496121_0000310 | 3300048924 | Bacteria | 101522 |
| 245 | Ga0496121_0006654 | 3300048924 | Bacteria | 14228 |
| 246 | Ga0496121_0146942 | 3300048924 | Bacteria | 1740 |
| 247 | Ga0496122_0007677 | 3300048925 | Bacteria | 11891 |
| 248 | Ga0496123_0007642 | 3300048926 | Bacteria | 10117 |
| 249 | Ga0496125_0010691 | 3300048928 | Bacteria | 9260 |
| 250 | Ga0496126_0000034 | 3300048929 | Bacteria | 362440 |
| 251 | Ga0496126_0000706 | 3300048929 | Bacteria | 60980 |
| 252 | Ga0496126_0003420 | 3300048929 | Bacteria | 20038 |
| 253 | Ga0496126_0229688 | 3300048929 | Bacteria | 1555 |
| 254 | Ga0496126_0671075 | 3300048929 | Bacteria | 809 |
| 255 | Ga0466983_0357353 | 3300048986 | Bacteria | 1077 |
| 256 | Ga0495678_064518 | 3300049459 | Bacteria | 1363 |
| 257 | Ga0495682_0002263 | 3300049460 | Bacteria | 9241 |
| 258 | Ga0466962_0002067 | 3300061719 | Bacteria | 9498 |
| 259 | Ga0466962_0080690 | 3300061719 | Bacteria | 1555 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045049 | Ga0466959_0260581 | Ga0466959_0260581_13_594 | 151 |
| 2 | 3300044694 | Ga0466963_0041379 | Ga0466963_0041379_1362_1994 | 169 |
| 3 | 3300044656 | Ga0466969_0043528 | Ga0466969_0043528_652_1296 | 171 |
| 4 | 3300044684 | Ga0466966_0000066 | Ga0466966_0000066_15283_15927 | 171 |
| 5 | 3300044693 | Ga0466961_0000037 | Ga0466961_0000037_22122_22766 | 171 |
| 6 | 3300044719 | Ga0466971_0049216 | Ga0466971_0049216_394_1038 | 171 |
| 7 | 3300044842 | Ga0466957_0008754 | Ga0466957_0008754_4661_5305 | 171 |
| 8 | 3300045836 | Ga0466958_0013575 | Ga0466958_0013575_2194_2838 | 171 |
| 9 | 3300061719 | Ga0466962_0002067 | Ga0466962_0002067_5624_6268 | 171 |
| 10 | 3300048920 | Ga0496117_0130760 | Ga0496117_0130760_233_847 | 175 |
| 11 | 3300048929 | Ga0496126_0000706 | Ga0496126_0000706_56598_57212 | 175 |
| 12 | 3300002705 | JGI25156J39149_1001319 | JGI25156J39149_10013198 | 177 |
| 13 | 3300025226 | Ga0209674_100424 | Ga0209674_10042412 | 177 |
| 14 | 3300025256 | Ga0209759_1000147 | Ga0209759_10001473 | 177 |
| 15 | 3300046507 | Ga0495606_0069162 | Ga0495606_0069162_1346_1933 | 178 |
| 16 | 3300046454 | Ga0495592_0260220 | Ga0495592_0260220_358_1002 | 179 |
| 17 | 3300046680 | Ga0495646_0152667 | Ga0495646_0152667_403_1050 | 180 |
| 18 | 3300046678 | Ga0495599_0239274 | Ga0495599_0239274_320_964 | 182 |
| 19 | 3300047317 | Ga0495604_0244029 | Ga0495604_0244029_501_1145 | 182 |
| 20 | 3300048088 | Ga0495602_0025863 | Ga0495602_0025863_4328_4972 | 182 |
| 21 | 3300048921 | Ga0496118_0017806 | Ga0496118_0017806_2281_2895 | 182 |
| 22 | 3300009093 | Ga0105240_10969875 | Ga0105240_109698751 | 184 |
| 23 | 3300009545 | Ga0105237_10042833 | Ga0105237_100428332 | 184 |
| 24 | 3300013104 | Ga0157370_10009710 | Ga0157370_100097105 | 184 |
| 25 | 3300044658 | Ga0466972_0172771 | Ga0466972_0172771_51_632 | 184 |
| 26 | 3300044683 | Ga0466965_0046225 | Ga0466965_0046225_1273_1854 | 184 |
| 27 | 3300044684 | Ga0466966_0019436 | Ga0466966_0019436_1708_2289 | 184 |
| 28 | 3300044693 | Ga0466961_0018267 | Ga0466961_0018267_1144_1725 | 184 |
| 29 | 3300044765 | Ga0466970_0005329 | Ga0466970_0005329_179_760 | 184 |
| 30 | 3300044842 | Ga0466957_0031699 | Ga0466957_0031699_401_982 | 184 |
| 31 | 3300044842 | Ga0466957_0178111 | Ga0466957_0178111_350_1000 | 184 |
| 32 | 3300045049 | Ga0466959_0046821 | Ga0466959_0046821_2458_3039 | 184 |
| 33 | 3300045836 | Ga0466958_0033891 | Ga0466958_0033891_1980_2561 | 184 |
| 34 | 3300046691 | Ga0495670_0003027 | Ga0495670_0003027_3644_4228 | 184 |
| 35 | 3300047319 | Ga0495674_0041704 | Ga0495674_0041704_1668_2222 | 184 |
| 36 | 3300047443 | Ga0495687_000025 | Ga0495687_000025_241817_242371 | 184 |
| 37 | 3300048917 | Ga0496114_0642590 | Ga0496114_0642590_62_616 | 184 |
| 38 | 3300048922 | Ga0496119_0178422 | Ga0496119_0178422_520_1074 | 184 |
| 39 | 3300037312 | Ga0395899_0026575 | Ga0395899_0026575_2282_2926 | 185 |
| 40 | 3300037418 | Ga0395900_0027150 | Ga0395900_0027150_2487_3131 | 185 |
| 41 | 3300037466 | Ga0395898_0051021 | Ga0395898_0051021_1889_2533 | 185 |
| 42 | 3300038443 | Ga0395901_0000106 | Ga0395901_0000106_42242_42886 | 185 |
| 43 | 3300044658 | Ga0466972_0055743 | Ga0466972_0055743_473_1123 | 187 |
| 44 | 3300044684 | Ga0466966_0021970 | Ga0466966_0021970_718_1368 | 187 |
| 45 | 3300044694 | Ga0466963_0001971 | Ga0466963_0001971_2701_3351 | 187 |
| 46 | 3300044719 | Ga0466971_0021577 | Ga0466971_0021577_2167_2817 | 187 |
| 47 | 3300061719 | Ga0466962_0080690 | Ga0466962_0080690_410_1060 | 187 |
| 48 | 3300003320 | rootH2_10070720 | rootH2_100707202 | 188 |
| 49 | 3300003323 | rootH1_10037770 | rootH1_100377702 | 188 |
| 50 | 3300009545 | Ga0105237_10006196 | Ga0105237_1000619610 | 188 |
| 51 | 3300025949 | Ga0207667_10894446 | Ga0207667_108944462 | 188 |
| 52 | 3300037312 | Ga0395899_0000041 | Ga0395899_0000041_58641_59285 | 189 |
| 53 | 3300037418 | Ga0395900_0001690 | Ga0395900_0001690_6946_7590 | 189 |
| 54 | 3300037466 | Ga0395898_0000220 | Ga0395898_0000220_87143_87787 | 189 |
| 55 | 3300037466 | Ga0395898_0136351 | Ga0395898_0136351_338_988 | 190 |
| 56 | 3300038443 | Ga0395901_0000264 | Ga0395901_0000264_2719_3369 | 190 |
| 57 | 3300044693 | Ga0466961_0127055 | Ga0466961_0127055_621_1262 | 190 |
| 58 | 3300045836 | Ga0466958_0007158 | Ga0466958_0007158_2415_3059 | 190 |
| 59 | 3300045976 | Ga0466967_0491630 | Ga0466967_0491630_15_659 | 190 |
| 60 | 3300048919 | Ga0496116_0067889 | Ga0496116_0067889_1327_1908 | 193 |
| 61 | 3300046526 | Ga0495666_0065214 | Ga0495666_0065214_336_950 | 196 |
| 62 | 3300048909 | Ga0496106_0000019 | Ga0496106_0000019_97939_98553 | 196 |
| 63 | 3300048924 | Ga0496121_0000310 | Ga0496121_0000310_76031_76645 | 196 |
| 64 | 3300002705 | JGI25156J39149_1004557 | JGI25156J39149_10045572 | 197 |
| 65 | 3300025256 | Ga0209759_1001732 | Ga0209759_10017323 | 197 |
| 66 | 3300025273 | Ga0209673_1000201 | Ga0209673_100020177 | 197 |
| 67 | 3300003758 | Ga0055532_1000643 | Ga0055532_10006433 | 198 |
| 68 | 3300003760 | Ga0055527_1003140 | Ga0055527_10031401 | 198 |
| 69 | 3300003761 | Ga0055535_1001317 | Ga0055535_10013173 | 198 |
| 70 | 3300003762 | Ga0055542_1001665 | Ga0055542_10016652 | 198 |
| 71 | 3300003763 | Ga0055529_1000552 | Ga0055529_10005523 | 198 |
| 72 | 3300025228 | Ga0209672_100051 | Ga0209672_10005125 | 198 |
| 73 | 3300025229 | Ga0209147_100192 | Ga0209147_10019273 | 198 |
| 74 | 3300025242 | Ga0209258_100031 | Ga0209258_100031369 | 198 |
| 75 | 3300025254 | Ga0209148_1000027 | Ga0209148_1000027369 | 198 |
| 76 | 3300025254 | Ga0209148_1000400 | Ga0209148_10004003 | 198 |
| 77 | 3300025272 | Ga0209455_1000213 | Ga0209455_100021321 | 198 |
| 78 | 3300027312 | Ga0209371_1000297 | Ga0209371_100029758 | 198 |
| 79 | 3300030500 | Ga0268256_1000261 | Ga0268256_10002615 | 198 |
| 80 | 3300048986 | Ga0466983_0357353 | Ga0466983_0357353_205_825 | 200 |
| 81 | iso_pu_bacteria | 2512047030 | 2512345235 | 200 |
| 82 | iso_pu_bacteria | 2513237166 | 2514050944 | 200 |
| 83 | iso_pu_bacteria | 2515154122 | 2515684325 | 200 |
| 84 | iso_pu_bacteria | 2600255067 | 2600810820 | 200 |
| 85 | iso_pu_bacteria | 2744054900 | 2746088169 | 200 |
| 86 | iso_pu_bacteria | 2744054901 | 2746096937 | 200 |
| 87 | iso_pu_bacteria | 2751185846 | 2753571033 | 200 |
| 88 | iso_pu_bacteria | 2885270888 | 2885271095 | 200 |
| 89 | iso_pu_bacteria | 2900634093 | 2900637824 | 200 |
| 90 | iso_pu_bacteria | 2902682994 | 2902687091 | 200 |
| 91 | iso_pu_bacteria | 642555113 | 642622492 | 200 |
| 92 | iso_pu_bacteria | 8039098773 | 8039102766 | 200 |
| 93 | iso_pu_bacteria | 2582581311 | 2585294702 | 201 |
| 94 | iso_pu_bacteria | 2599185239 | 2599738106 | 201 |
| 95 | iso_pu_bacteria | 2599185240 | 2599742522 | 201 |
| 96 | iso_pu_bacteria | 2599185355 | 2600204640 | 201 |
| 97 | iso_pu_bacteria | 2675903129 | 2676741626 | 201 |
| 98 | iso_pu_bacteria | 2816332253 | 2817260396 | 201 |
| 99 | iso_pu_bacteria | 2816332256 | 2817278084 | 201 |
| 100 | iso_pu_bacteria | 2816332286 | 2817455651 | 201 |
| 101 | iso_pu_bacteria | 2818991452 | 2819632922 | 201 |
| 102 | iso_pu_bacteria | 2856287931 | 2856292762 | 201 |
| 103 | iso_pu_bacteria | 2857357740 | 2857360996 | 201 |
| 104 | iso_pu_bacteria | 2863421361 | 2863421933 | 201 |
| 105 | iso_pu_bacteria | 2870068957 | 2870072125 | 201 |
| 106 | iso_pu_bacteria | 2928163908 | 2928164454 | 201 |
| 107 | iso_pu_bacteria | 2928170801 | 2928177562 | 201 |
| 108 | iso_pu_bacteria | 2981990288 | 2981993920 | 201 |
| 109 | iso_pu_bacteria | 8018845410 | 8018850367 | 201 |
| 110 | iso_pu_bacteria | 8020807995 | 8020808851 | 201 |
| 111 | iso_pu_bacteria | 8020945358 | 8020947204 | 201 |
| 112 | iso_pu_bacteria | 8021120328 | 8021122829 | 201 |
| 113 | iso_pu_bacteria | 8040167225 | 8040169302 | 201 |
| 114 | iso_pu_bacteria | 8040173305 | 8040174995 | 201 |
| 115 | 3300046459 | Ga0495629_0195061 | Ga0495629_0195061_518_1147 | 203 |
| 116 | 3300046674 | Ga0495588_0081711 | Ga0495588_0081711_1045_1674 | 203 |
| 117 | 3300048913 | Ga0496110_0141027 | Ga0496110_0141027_1200_1829 | 203 |
| 118 | 3300001989 | JGI24739J22299_10030154 | JGI24739J22299_100301542 | 204 |
| 119 | 3300003322 | rootL2_10258975 | rootL2_102589752 | 204 |
| 120 | 3300005335 | Ga0070666_10245239 | Ga0070666_102452391 | 204 |
| 121 | 3300005339 | Ga0070660_100048593 | Ga0070660_1000485933 | 204 |
| 122 | 3300005347 | Ga0070668_100312791 | Ga0070668_1003127912 | 204 |
| 123 | 3300005366 | Ga0070659_100127156 | Ga0070659_1001271562 | 204 |
| 124 | 3300005456 | Ga0070678_100153977 | Ga0070678_1001539772 | 204 |
| 125 | 3300005456 | Ga0070678_100304578 | Ga0070678_1003045782 | 204 |
| 126 | 3300009011 | Ga0105251_10000285 | Ga0105251_1000028545 | 204 |
| 127 | 3300009011 | Ga0105251_10073001 | Ga0105251_100730012 | 204 |
| 128 | 3300009036 | Ga0105244_10104119 | Ga0105244_101041192 | 204 |
| 129 | 3300009098 | Ga0105245_10409356 | Ga0105245_104093562 | 204 |
| 130 | 3300009101 | Ga0105247_10599779 | Ga0105247_105997791 | 204 |
| 131 | 3300009174 | Ga0105241_10192794 | Ga0105241_101927942 | 204 |
| 132 | 3300009545 | Ga0105237_10261873 | Ga0105237_102618731 | 204 |
| 133 | 3300009553 | Ga0105249_10786805 | Ga0105249_107868051 | 204 |
| 134 | 3300013105 | Ga0157369_10000252 | Ga0157369_1000025227 | 204 |
| 135 | 3300013105 | Ga0157369_10000799 | Ga0157369_100007996 | 204 |
| 136 | 3300013105 | Ga0157369_10029169 | Ga0157369_100291693 | 204 |
| 137 | 3300013296 | Ga0157374_10730228 | Ga0157374_107302282 | 204 |
| 138 | 3300013306 | Ga0163162_10033960 | Ga0163162_100339602 | 204 |
| 139 | 3300013308 | Ga0157375_10022520 | Ga0157375_100225207 | 204 |
| 140 | 3300016635 | Ga0183361_10025 | Ga0183361_1002532 | 204 |
| 141 | 3300020069 | Ga0197907_11478289 | Ga0197907_114782892 | 204 |
| 142 | 3300020070 | Ga0206356_10059520 | Ga0206356_100595202 | 204 |
| 143 | 3300020081 | Ga0206354_11201333 | Ga0206354_112013332 | 204 |
| 144 | 3300020082 | Ga0206353_10720401 | Ga0206353_107204015 | 204 |
| 145 | 3300022467 | Ga0224712_10000087 | Ga0224712_100000876 | 204 |
| 146 | 3300025302 | Ga0207426_1002525 | Ga0207426_10025253 | 204 |
| 147 | 3300025735 | Ga0207713_1002521 | Ga0207713_100252113 | 204 |
| 148 | 3300025903 | Ga0207680_10218614 | Ga0207680_102186142 | 204 |
| 149 | 3300025904 | Ga0207647_10028534 | Ga0207647_100285342 | 204 |
| 150 | 3300025909 | Ga0207705_10002820 | Ga0207705_100028203 | 204 |
| 151 | 3300025911 | Ga0207654_10145099 | Ga0207654_101450992 | 204 |
| 152 | 3300025932 | Ga0207690_10165573 | Ga0207690_101655731 | 204 |
| 153 | 3300025941 | Ga0207711_10077806 | Ga0207711_100778062 | 204 |
| 154 | 3300025949 | Ga0207667_10006660 | Ga0207667_100066609 | 204 |
| 155 | 3300026067 | Ga0207678_10030240 | Ga0207678_100302403 | 204 |
| 156 | 3300026067 | Ga0207678_10302003 | Ga0207678_103020032 | 204 |
| 157 | 3300037312 | Ga0395899_0038496 | Ga0395899_0038496_762_1406 | 204 |
| 158 | 3300037418 | Ga0395900_0001108 | Ga0395900_0001108_10834_11484 | 204 |
| 159 | 3300037418 | Ga0395900_0164068 | Ga0395900_0164068_1040_1690 | 204 |
| 160 | 3300037466 | Ga0395898_0002771 | Ga0395898_0002771_8678_9328 | 204 |
| 161 | 3300037471 | Ga0395905_0085899 | Ga0395905_0085899_653_1327 | 204 |
| 162 | 3300038443 | Ga0395901_0000011 | Ga0395901_0000011_51706_52350 | 204 |
| 163 | 3300044693 | Ga0466961_0284539 | Ga0466961_0284539_231_848 | 204 |
| 164 | 3300044765 | Ga0466970_0107843 | Ga0466970_0107843_644_1261 | 204 |
| 165 | 3300044842 | Ga0466957_0131656 | Ga0466957_0131656_481_1101 | 204 |
| 166 | 3300044901 | Ga0466960_0154775 | Ga0466960_0154775_204_821 | 204 |
| 167 | 3300046454 | Ga0495592_0142197 | Ga0495592_0142197_221_895 | 204 |
| 168 | 3300046455 | Ga0495603_0003117 | Ga0495603_0003117_7352_7975 | 204 |
| 169 | 3300046457 | Ga0495590_0001198 | Ga0495590_0001198_328_999 | 204 |
| 170 | 3300046459 | Ga0495629_0000060 | Ga0495629_0000060_46559_47173 | 204 |
| 171 | 3300046459 | Ga0495629_0000293 | Ga0495629_0000293_20670_21293 | 204 |
| 172 | 3300046460 | Ga0495638_0031414 | Ga0495638_0031414_1924_2571 | 204 |
| 173 | 3300046462 | Ga0495651_0312217 | Ga0495651_0312217_179_802 | 204 |
| 174 | 3300046463 | Ga0495653_0005778 | Ga0495653_0005778_9078_9692 | 204 |
| 175 | 3300046463 | Ga0495653_0020615 | Ga0495653_0020615_1290_1964 | 204 |
| 176 | 3300046463 | Ga0495653_0149678 | Ga0495653_0149678_287_907 | 204 |
| 177 | 3300046471 | Ga0495650_0001534 | Ga0495650_0001534_17864_18487 | 204 |
| 178 | 3300046471 | Ga0495650_0029993 | Ga0495650_0029993_602_1249 | 204 |
| 179 | 3300046472 | Ga0495580_0015141 | Ga0495580_0015141_3497_4120 | 204 |
| 180 | 3300046472 | Ga0495580_0055005 | Ga0495580_0055005_1756_2370 | 204 |
| 181 | 3300046472 | Ga0495580_0074206 | Ga0495580_0074206_1723_2337 | 204 |
| 182 | 3300046474 | Ga0495605_0035260 | Ga0495605_0035260_86_733 | 204 |
| 183 | 3300046477 | Ga0495664_0000037 | Ga0495664_0000037_55385_56059 | 204 |
| 184 | 3300046477 | Ga0495664_0020030 | Ga0495664_0020030_972_1622 | 204 |
| 185 | 3300046501 | Ga0495607_0061710 | Ga0495607_0061710_1360_1983 | 204 |
| 186 | 3300046501 | Ga0495607_0158484 | Ga0495607_0158484_287_934 | 204 |
| 187 | 3300046506 | Ga0495583_0065841 | Ga0495583_0065841_698_1312 | 204 |
| 188 | 3300046506 | Ga0495583_0154454 | Ga0495583_0154454_80_703 | 204 |
| 189 | 3300046507 | Ga0495606_0044280 | Ga0495606_0044280_816_1490 | 204 |
| 190 | 3300046514 | Ga0495618_0036159 | Ga0495618_0036159_2280_2894 | 204 |
| 191 | 3300046515 | Ga0495620_0030260 | Ga0495620_0030260_1509_2129 | 204 |
| 192 | 3300046516 | Ga0495628_0084586 | Ga0495628_0084586_626_1300 | 204 |
| 193 | 3300046516 | Ga0495628_0488931 | Ga0495628_0488931_205_828 | 204 |
| 194 | 3300046517 | Ga0495630_0075338 | Ga0495630_0075338_1140_1760 | 204 |
| 195 | 3300046518 | Ga0495631_0202808 | Ga0495631_0202808_24_671 | 204 |
| 196 | 3300046526 | Ga0495666_0065328 | Ga0495666_0065328_52_672 | 204 |
| 197 | 3300046526 | Ga0495666_0103527 | Ga0495666_0103527_299_913 | 204 |
| 198 | 3300046528 | Ga0495642_0153723 | Ga0495642_0153723_237_878 | 204 |
| 199 | 3300046529 | Ga0495652_0114953 | Ga0495652_0114953_130_744 | 204 |
| 200 | 3300046529 | Ga0495652_0343662 | Ga0495652_0343662_29_703 | 204 |
| 201 | 3300046530 | Ga0495654_0077992 | Ga0495654_0077992_128_751 | 204 |
| 202 | 3300046531 | Ga0495665_0024330 | Ga0495665_0024330_2503_3117 | 204 |
| 203 | 3300046531 | Ga0495665_0189106 | Ga0495665_0189106_435_1049 | 204 |
| 204 | 3300046542 | Ga0495597_0010325 | Ga0495597_0010325_2545_3216 | 204 |
| 205 | 3300046543 | Ga0495645_0002587 | Ga0495645_0002587_5074_5697 | 204 |
| 206 | 3300046543 | Ga0495645_0029285 | Ga0495645_0029285_1652_2302 | 204 |
| 207 | 3300046543 | Ga0495645_0036751 | Ga0495645_0036751_700_1374 | 204 |
| 208 | 3300046665 | Ga0495661_0070879 | Ga0495661_0070879_735_1349 | 204 |
| 209 | 3300046680 | Ga0495646_0021707 | Ga0495646_0021707_3262_3876 | 204 |
| 210 | 3300046680 | Ga0495646_0212121 | Ga0495646_0212121_22_645 | 204 |
| 211 | 3300046684 | Ga0495669_0081969 | Ga0495669_0081969_434_1081 | 204 |
| 212 | 3300046689 | Ga0495613_0275178 | Ga0495613_0275178_351_965 | 204 |
| 213 | 3300046690 | Ga0495624_0012200 | Ga0495624_0012200_436_1050 | 204 |
| 214 | 3300046690 | Ga0495624_0049521 | Ga0495624_0049521_1912_2532 | 204 |
| 215 | 3300046690 | Ga0495624_0111403 | Ga0495624_0111403_633_1247 | 204 |
| 216 | 3300046690 | Ga0495624_0203014 | Ga0495624_0203014_396_1016 | 204 |
| 217 | 3300046692 | Ga0495671_0026988 | Ga0495671_0026988_774_1388 | 204 |
| 218 | 3300046694 | Ga0495649_0009005 | Ga0495649_0009005_2308_2922 | 204 |
| 219 | 3300046694 | Ga0495649_0221304 | Ga0495649_0221304_284_931 | 204 |
| 220 | 3300046794 | Ga0495589_0173548 | Ga0495589_0173548_212_835 | 204 |
| 221 | 3300046794 | Ga0495589_0204091 | Ga0495589_0204091_29_643 | 204 |
| 222 | 3300046794 | Ga0495589_0241043 | Ga0495589_0241043_107_754 | 204 |
| 223 | 3300046809 | Ga0495600_0037491 | Ga0495600_0037491_1461_2084 | 204 |
| 224 | 3300047317 | Ga0495604_0360784 | Ga0495604_0360784_78_728 | 204 |
| 225 | 3300047319 | Ga0495674_0010551 | Ga0495674_0010551_436_1050 | 204 |
| 226 | 3300047319 | Ga0495674_0010793 | Ga0495674_0010793_7522_8136 | 204 |
| 227 | 3300047319 | Ga0495674_0021606 | Ga0495674_0021606_436_1050 | 204 |
| 228 | 3300047320 | Ga0495672_0040557 | Ga0495672_0040557_853_1467 | 204 |
| 229 | 3300047320 | Ga0495672_0093439 | Ga0495672_0093439_467_1138 | 204 |
| 230 | 3300047321 | Ga0495676_0037922 | Ga0495676_0037922_2607_3221 | 204 |
| 231 | 3300047321 | Ga0495676_0299143 | Ga0495676_0299143_73_687 | 204 |
| 232 | 3300047322 | Ga0495680_0037364 | Ga0495680_0037364_767_1387 | 204 |
| 233 | 3300047323 | Ga0495683_0005878 | Ga0495683_0005878_4230_4901 | 204 |
| 234 | 3300047323 | Ga0495683_0073165 | Ga0495683_0073165_76_723 | 204 |
| 235 | 3300047443 | Ga0495687_013038 | Ga0495687_013038_2854_3525 | 204 |
| 236 | 3300047443 | Ga0495687_021773 | Ga0495687_021773_1842_2465 | 204 |
| 237 | 3300047444 | Ga0495675_0146102 | Ga0495675_0146102_339_962 | 204 |
| 238 | 3300047446 | Ga0495679_043147 | Ga0495679_043147_253_900 | 204 |
| 239 | 3300047472 | Ga0495686_0000032 | Ga0495686_0000032_139828_140460 | 204 |
| 240 | 3300047673 | Ga0495593_0018129 | Ga0495593_0018129_755_1375 | 204 |
| 241 | 3300047673 | Ga0495593_0047906 | Ga0495593_0047906_1058_1678 | 204 |
| 242 | 3300047673 | Ga0495593_0054319 | Ga0495593_0054319_266_889 | 204 |
| 243 | 3300047673 | Ga0495593_0089337 | Ga0495593_0089337_954_1568 | 204 |
| 244 | 3300047673 | Ga0495593_0125395 | Ga0495593_0125395_525_1145 | 204 |
| 245 | 3300047673 | Ga0495593_0151324 | Ga0495593_0151324_408_1022 | 204 |
| 246 | 3300048088 | Ga0495602_0165400 | Ga0495602_0165400_349_1023 | 204 |
| 247 | 3300048088 | Ga0495602_0200242 | Ga0495602_0200242_134_754 | 204 |
| 248 | 3300048088 | Ga0495602_0587669 | Ga0495602_0587669_111_725 | 204 |
| 249 | 3300048089 | Ga0495614_0015123 | Ga0495614_0015123_1878_2501 | 204 |
| 250 | 3300048089 | Ga0495614_0055421 | Ga0495614_0055421_706_1320 | 204 |
| 251 | 3300048091 | Ga0495626_0127335 | Ga0495626_0127335_267_914 | 204 |
| 252 | 3300048903 | Ga0496100_0004725 | Ga0496100_0004725_4099_4719 | 204 |
| 253 | 3300048903 | Ga0496100_0045298 | Ga0496100_0045298_244_918 | 204 |
| 254 | 3300048903 | Ga0496100_0347557 | Ga0496100_0347557_291_917 | 204 |
| 255 | 3300048904 | Ga0496101_0064041 | Ga0496101_0064041_486_1157 | 204 |
| 256 | 3300048905 | Ga0496102_0014935 | Ga0496102_0014935_4922_5542 | 204 |
| 257 | 3300048905 | Ga0496102_0014965 | Ga0496102_0014965_2804_3451 | 204 |
| 258 | 3300048905 | Ga0496102_0112474 | Ga0496102_0112474_1497_2117 | 204 |
| 259 | 3300048906 | Ga0496103_0039955 | Ga0496103_0039955_491_1162 | 204 |
| 260 | 3300048907 | Ga0496104_0108279 | Ga0496104_0108279_419_1090 | 204 |
| 261 | 3300048907 | Ga0496104_0173028 | Ga0496104_0173028_1235_1858 | 204 |
| 262 | 3300048909 | Ga0496106_0007504 | Ga0496106_0007504_5548_6219 | 204 |
| 263 | 3300048909 | Ga0496106_0093973 | Ga0496106_0093973_931_1551 | 204 |
| 264 | 3300048909 | Ga0496106_0113993 | Ga0496106_0113993_427_1074 | 204 |
| 265 | 3300048910 | Ga0496107_0009382 | Ga0496107_0009382_1811_2482 | 204 |
| 266 | 3300048910 | Ga0496107_0379083 | Ga0496107_0379083_163_783 | 204 |
| 267 | 3300048911 | Ga0496108_0455869 | Ga0496108_0455869_195_818 | 204 |
| 268 | 3300048911 | Ga0496108_0496141 | Ga0496108_0496141_351_1022 | 204 |
| 269 | 3300048912 | Ga0496109_0022399 | Ga0496109_0022399_3398_4018 | 204 |
| 270 | 3300048913 | Ga0496110_0001369 | Ga0496110_0001369_15864_16535 | 204 |
| 271 | 3300048914 | Ga0496111_0110500 | Ga0496111_0110500_223_843 | 204 |
| 272 | 3300048915 | Ga0496112_0004198 | Ga0496112_0004198_2042_2713 | 204 |
| 273 | 3300048916 | Ga0496113_0002111 | Ga0496113_0002111_8978_9649 | 204 |
| 274 | 3300048917 | Ga0496114_0010010 | Ga0496114_0010010_2588_3211 | 204 |
| 275 | 3300048918 | Ga0496115_0134173 | Ga0496115_0134173_1010_1633 | 204 |
| 276 | 3300048918 | Ga0496115_0413479 | Ga0496115_0413479_77_724 | 204 |
| 277 | 3300048919 | Ga0496116_0016509 | Ga0496116_0016509_1759_2430 | 204 |
| 278 | 3300048920 | Ga0496117_0002293 | Ga0496117_0002293_13134_13766 | 204 |
| 279 | 3300048921 | Ga0496118_0007277 | Ga0496118_0007277_642_1274 | 204 |
| 280 | 3300048921 | Ga0496118_0043531 | Ga0496118_0043531_1642_2313 | 204 |
| 281 | 3300048921 | Ga0496118_0173453 | Ga0496118_0173453_242_862 | 204 |
| 282 | 3300048921 | Ga0496118_0255320 | Ga0496118_0255320_291_938 | 204 |
| 283 | 3300048924 | Ga0496121_0006654 | Ga0496121_0006654_11127_11798 | 204 |
| 284 | 3300048924 | Ga0496121_0146942 | Ga0496121_0146942_839_1453 | 204 |
| 285 | 3300048925 | Ga0496122_0007677 | Ga0496122_0007677_1529_2149 | 204 |
| 286 | 3300048926 | Ga0496123_0007642 | Ga0496123_0007642_8310_8981 | 204 |
| 287 | 3300048928 | Ga0496125_0010691 | Ga0496125_0010691_7928_8599 | 204 |
| 288 | 3300048929 | Ga0496126_0000034 | Ga0496126_0000034_125705_126337 | 204 |
| 289 | 3300048929 | Ga0496126_0003420 | Ga0496126_0003420_3578_4204 | 204 |
| 290 | 3300048929 | Ga0496126_0229688 | Ga0496126_0229688_513_1187 | 204 |
| 291 | 3300048929 | Ga0496126_0671075 | Ga0496126_0671075_122_742 | 204 |
| 292 | 3300049459 | Ga0495678_064518 | Ga0495678_064518_599_1219 | 204 |
| 293 | 3300049460 | Ga0495682_0002263 | Ga0495682_0002263_2586_3200 | 204 |
| 294 | iso_pu_bacteria | 2526164713 | 2527080741 | 204 |
| 295 | iso_pu_bacteria | 2738541298 | 2738830853 | 204 |
| 296 | iso_pu_bacteria | 2738541306 | 2738872380 | 204 |
| 297 | iso_pu_bacteria | 2738543002 | 2739184010 | 204 |
| 298 | iso_pu_bacteria | 2738543008 | 2739218980 | 204 |
| 299 | iso_pu_bacteria | 2808606384 | 2808970015 | 204 |
| 300 | iso_pu_bacteria | 2808606390 | 2809005138 | 204 |
| 301 | iso_pu_bacteria | 2808606391 | 2809011721 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1h4d-assembly1.cif.gz_A | biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba | 0.9102 | 8 | 201 |
| 1e5k-assembly1.cif.gz_A | crystal structure of the molybdenum cofactor biosynthesis protein moba (protein fa) from escherichia coli at near atomic resolution | 0.91 | 8 | 201 |
| 1h4c-assembly1.cif.gz_A | biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba | 0.9094 | 8 | 201 |
| 1h4e-assembly1.cif.gz_A | biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba | 0.9093 | 8 | 201 |
| 1hjj-assembly1.cif.gz_A | biochemical and structural analysis of the molybdenum cofactor biosynthesis protein moba | 0.9091 | 8 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1frwA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9227 | 5 | 202 | 3.90.550.10 |
| 1frwA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9037 | 5 | 202 | 3.90.550.10 |
| af_P9WJQ9_9_197_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8458 | 8 | 199 | 3.90.550.10 |
| 2e8bA00 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8394 | 4 | 193 | 3.90.550.10 |
| af_Q7XCL5_1_80_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.8228 | 129 | 144 | 3.10.20.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2T0KYA5-F1-model_v4 | Molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) | 0.9902 | 1 | 204 |
GO:0005525
GO:0005737 GO:0046872 GO:0061603 GO:1902758 |
| AF-A0A158HR12-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein MobA | 0.9881 | 21 | 204 |
GO:0005525
GO:0016779 GO:1902758 |
| AF-A2WBL2-F1-model_v4 | deleted | 0.9873 | 6 | 204 |
|
| AF-A0A158HR12-F1-model_v4 | Molybdopterin-guanine dinucleotide biosynthesis protein MobA | 0.9828 | 21 | 204 |
GO:0005525
GO:0016779 GO:1902758 |
| AF-E1T5N2-F1-model_v4 | Molybdenum cofactor guanylyltransferase (MoCo guanylyltransferase) (EC 2.7.7.77) (GTP:molybdopterin guanylyltransferase) (Mo-MPT guanylyltransferase) (Molybdopterin guanylyltransferase) (Molybdopterin-guanine dinucleotide synthase) (MGD synthase) | 0.9815 | 2 | 204 |
GO:0005525
GO:0005737 GO:0046872 GO:0061603 GO:1902758 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar