F395839

General Info

Members Datasets Scaffolds Average Seq Length
301 186 602 156

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100914267|Ga0075428_1009142671
Length 183
Sequence MGAATAIESLAIADPHLLRRGKNGAIAVAKAGMSTIAAALRPVPIPKREALTRDPAAQAFLLVWIVFTVAPILFGLDKFANVLTDDWTRYLAPEFNDIIPGSASDAMHIVGVVEIVAGLVVALTPRFGGLLVAAWLGGIIVSLLLVGGYGDIALRDFGLLAGAVALSRLASAQAGSRRLVPEA

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
142 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
143 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
144 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
145 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
179 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.66
Nodule 0
Rhizoplane 9.3
Rhizosphere 89.04
Stem 0
Stem Tuber 0
Unclassified 3.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100914267 3300006844 Bacteria 930
2 JGI24737J22298_10164218 3300001990 Bacteria 656
3 JGI24743J22301_10080109 3300001991 Bacteria 688
4 JGI24738J21930_10117011 3300002075 Bacteria 577
5 Ga0070683_100019624 3300005329 Bacteria 6005
6 Ga0070670_100487981 3300005331 Bacteria 1095
7 Ga0070682_100025006 3300005337 Bacteria 3561
8 Ga0070682_100406161 3300005337 Bacteria 1031
9 Ga0068868_100203599 3300005338 Bacteria 1651
10 Ga0068868_100327020 3300005338 Bacteria 1307
11 Ga0070660_100106840 3300005339 Bacteria 2223
12 Ga0070689_100082226 3300005340 Bacteria 2529
13 Ga0070661_100097226 3300005344 Bacteria 2186
14 Ga0070692_10494150 3300005345 Bacteria 792
15 Ga0070668_100807743 3300005347 Bacteria 834
16 Ga0070669_100183753 3300005353 Bacteria 1637
17 Ga0070674_100006506 3300005356 Bacteria 6824
18 Ga0070688_100573149 3300005365 Bacteria 861
19 Ga0070659_100202979 3300005366 Bacteria 1632
20 Ga0070659_101765335 3300005366 Bacteria 554
21 Ga0070667_100452402 3300005367 Bacteria 1173
22 Ga0070710_10043726 3300005437 Bacteria 2483
23 Ga0070701_10511224 3300005438 Bacteria 781
24 Ga0070663_100757315 3300005455 Bacteria 830
25 Ga0068867_100229660 3300005459 Bacteria 1499
26 Ga0070684_100022121 3300005535 Bacteria 5300
27 Ga0070684_100591771 3300005535 Unclassified 1031
28 Ga0070684_100894449 3300005535 Bacteria 832
29 Ga0070686_100104168 3300005544 Bacteria 1921
30 Ga0070695_100224237 3300005545 Unclassified 1356
31 Ga0070695_101051472 3300005545 Bacteria 664
32 Ga0070704_100365523 3300005549 Bacteria 1222
33 Ga0070664_100255607 3300005564 Bacteria 1576
34 Ga0070664_100651562 3300005564 Bacteria 979
35 Ga0068857_100512176 3300005577 Bacteria 1127
36 Ga0068854_100136157 3300005578 Bacteria 1880
37 Ga0070702_100031193 3300005615 Bacteria 2914
38 Ga0070702_100122633 3300005615 Bacteria 1629
39 Ga0070702_101092758 3300005615 Bacteria 637
40 Ga0068852_100037964 3300005616 Bacteria 4044
41 Ga0068859_100739968 3300005617 Bacteria 1072
42 Ga0068864_100440115 3300005618 Bacteria 1245
43 Ga0068864_100481584 3300005618 Bacteria 1191
44 Ga0068864_101307363 3300005618 Bacteria 725
45 Ga0068866_10059840 3300005718 Bacteria 1972
46 Ga0068861_100028758 3300005719 Bacteria 4058
47 Ga0068861_100538791 3300005719 Bacteria 1062
48 Ga0068861_100964144 3300005719 Bacteria 812
49 Ga0068858_100634092 3300005842 Bacteria 1038
50 Ga0068860_101571469 3300005843 Bacteria 680
51 Ga0068862_100300152 3300005844 Bacteria 1477
52 Ga0081455_10027444 3300005937 Bacteria 5217
53 Ga0081455_10611759 3300005937 Bacteria 708
54 Ga0081538_10020333 3300005981 Bacteria 4891
55 Ga0081538_10021860 3300005981 Bacteria 4654
56 Ga0081540_1052473 3300005983 Bacteria 2007
57 Ga0081539_10060873 3300005985 Bacteria 2071
58 Ga0075365_11191285 3300006038 Bacteria 536
59 Ga0075363_100776693 3300006048 Bacteria 582
60 Ga0075364_10051189 3300006051 Bacteria 2697
61 Ga0070712_100027955 3300006175 Bacteria 3769
62 Ga0075428_100146293 3300006844 Bacteria 2568
63 Ga0075428_100218204 3300006844 Bacteria 2060
64 Ga0075428_101113899 3300006844 Bacteria 833
65 Ga0075430_100196962 3300006846 Bacteria 1673
66 Ga0075430_100356855 3300006846 Bacteria 1207
67 Ga0075431_101231000 3300006847 Bacteria 711
68 Ga0075433_10248987 3300006852 Bacteria 1577
69 Ga0075429_100206987 3300006880 Bacteria 1719
70 Ga0075429_100945626 3300006880 Bacteria 754
71 Ga0068865_100324015 3300006881 Bacteria 1240
72 Ga0068865_101347301 3300006881 Bacteria 636
73 Ga0097620_100739980 3300006931 Bacteria 1072
74 Ga0075435_101027070 3300007076 Bacteria 720
75 Ga0105240_10353330 3300009093 Bacteria 1667
76 Ga0111539_11423491 3300009094 Bacteria 804
77 Ga0105245_10006505 3300009098 Bacteria 10266
78 Ga0105245_10055112 3300009098 Bacteria 3570
79 Ga0105245_10804704 3300009098 Bacteria 978
80 Ga0105245_10984845 3300009098 Bacteria 887
81 Ga0114129_10114637 3300009147 Bacteria 3716
82 Ga0114129_12269128 3300009147 Unclassified 652
83 Ga0105243_10058153 3300009148 Bacteria 3081
84 Ga0105243_10076773 3300009148 Bacteria 2715
85 Ga0105241_10346177 3300009174 Bacteria 1289
86 Ga0105242_10316613 3300009176 Bacteria 1430
87 Ga0105242_10467929 3300009176 Bacteria 1192
88 Ga0105248_10109627 3300009177 Bacteria 3113
89 Ga0105237_10384919 3300009545 Bacteria 1408
90 Ga0105238_10154903 3300009551 Bacteria 2267
91 Ga0105249_10255137 3300009553 Bacteria 1740
92 Ga0105239_10062470 3300010375 Bacteria 4088
93 Ga0105239_10348639 3300010375 Bacteria 1671
94 Ga0105239_11222384 3300010375 Bacteria 866
95 Ga0105246_10197077 3300011119 Bacteria 1563
96 Ga0105246_10468245 3300011119 Bacteria 1063
97 Ga0157338_1016608 3300012515 Bacteria 815
98 Ga0157371_10203640 3300013102 Bacteria 1419
99 Ga0163162_11125613 3300013306 Bacteria 890
100 Ga0157375_10524703 3300013308 Bacteria 1347
101 Ga0157375_11558682 3300013308 Bacteria 780
102 Ga0163163_10139941 3300014325 Bacteria 2462
103 Ga0163163_10222141 3300014325 Bacteria 1938
104 Ga0157377_10021134 3300014745 Bacteria 3420
105 Ga0157377_10493781 3300014745 Bacteria 854
106 Ga0157379_10138940 3300014968 Bacteria 2190
107 Ga0207692_10033066 3300025898 Bacteria 2491
108 Ga0207688_10061614 3300025901 Bacteria 2115
109 Ga0207647_10181858 3300025904 Bacteria 1221
110 Ga0207643_10029344 3300025908 Bacteria 3059
111 Ga0207671_10392653 3300025914 Bacteria 1103
112 Ga0207693_10052029 3300025915 Bacteria 3212
113 Ga0207662_10007038 3300025918 Bacteria 6108
114 Ga0207657_10016992 3300025919 Bacteria 6999
115 Ga0207649_11648523 3300025920 Bacteria 508
116 Ga0207694_10191291 3300025924 Bacteria 1662
117 Ga0207650_10461193 3300025925 Bacteria 1058
118 Ga0207650_11211388 3300025925 Bacteria 643
119 Ga0207659_10302437 3300025926 Bacteria 1314
120 Ga0207687_10019899 3300025927 Bacteria 4452
121 Ga0207687_10394708 3300025927 Bacteria 1137
122 Ga0207687_10676431 3300025927 Bacteria 874
123 Ga0207644_10023682 3300025931 Bacteria 4209
124 Ga0207690_10053394 3300025932 Bacteria 2711
125 Ga0207686_10742912 3300025934 Bacteria 783
126 Ga0207670_11245775 3300025936 Bacteria 630
127 Ga0207669_10021256 3300025937 Bacteria 3422
128 Ga0207669_10049400 3300025937 Bacteria 2507
129 Ga0207704_10486177 3300025938 Bacteria 992
130 Ga0207691_10056212 3300025940 Bacteria 3585
131 Ga0207711_10579126 3300025941 Bacteria 1047
132 Ga0207689_10089431 3300025942 Bacteria 2530
133 Ga0207661_11300618 3300025944 Bacteria 668
134 Ga0207679_10270277 3300025945 Bacteria 1453
135 Ga0207679_10297377 3300025945 Bacteria 1390
136 Ga0207651_10021056 3300025960 Bacteria 3953
137 Ga0207712_10082410 3300025961 Bacteria 2345
138 Ga0207712_10465888 3300025961 Bacteria 1074
139 Ga0207668_10176410 3300025972 Bacteria 1681
140 Ga0207668_10557595 3300025972 Bacteria 993
141 Ga0207658_10365093 3300025986 Bacteria 1261
142 Ga0207677_10901575 3300026023 Bacteria 797
143 Ga0207678_10100296 3300026067 Bacteria 2473
144 Ga0207708_10015984 3300026075 Bacteria 5636
145 Ga0207708_10597605 3300026075 Unclassified 934
146 Ga0207702_10956114 3300026078 Bacteria 849
147 Ga0207648_10040903 3300026089 Bacteria 4072
148 Ga0207676_10197659 3300026095 Bacteria 1774
149 Ga0207676_10375622 3300026095 Bacteria 1322
150 Ga0207674_10011090 3300026116 Bacteria 10133
151 Ga0207674_10514945 3300026116 Bacteria 1156
152 Ga0207674_10830513 3300026116 Bacteria 891
153 Ga0207675_100050646 3300026118 Bacteria 3875
154 Ga0207675_100422682 3300026118 Bacteria 1316
155 Ga0207675_100457790 3300026118 Bacteria 1265
156 Ga0207675_101063251 3300026118 Bacteria 828
157 Ga0207675_101350645 3300026118 Bacteria 733
158 Ga0207683_10104914 3300026121 Bacteria 2526
159 Ga0307405_10078244 3300031731 Bacteria 2152
160 Ga0307405_10464154 3300031731 Bacteria 1007
161 Ga0307413_10034461 3300031824 Bacteria 2894
162 Ga0307410_10055695 3300031852 Bacteria 2686
163 Ga0307410_10139980 3300031852 Bacteria 1789
164 Ga0307406_10101530 3300031901 Bacteria 1961
165 Ga0307406_10226837 3300031901 Bacteria 1392
166 Ga0307406_10291061 3300031901 Unclassified 1250
167 Ga0307406_10438059 3300031901 Bacteria 1045
168 Ga0307406_10445803 3300031901 Bacteria 1037
169 Ga0307406_10816585 3300031901 Bacteria 788
170 Ga0307407_10034097 3300031903 Bacteria 2784
171 Ga0307407_10082298 3300031903 Bacteria 1950
172 Ga0307407_10242101 3300031903 Bacteria 1231
173 Ga0307412_11603950 3300031911 Bacteria 594
174 Ga0307409_100038705 3300031995 Bacteria 3530
175 Ga0307409_100061674 3300031995 Bacteria 2932
176 Ga0307409_100381169 3300031995 Bacteria 1341
177 Ga0307409_100885112 3300031995 Bacteria 906
178 Ga0307416_100023718 3300032002 Bacteria 4460
179 Ga0307416_100036506 3300032002 Unclassified 3770
180 Ga0307416_100253073 3300032002 Bacteria 1716
181 Ga0307416_100258729 3300032002 Bacteria 1700
182 Ga0307416_100839274 3300032002 Bacteria 1016
183 Ga0307416_101408222 3300032002 Bacteria 803
184 Ga0307414_10014480 3300032004 Bacteria 4731
185 Ga0307414_10274035 3300032004 Bacteria 1415
186 Ga0307411_10072793 3300032005 Bacteria 2335
187 Ga0307411_10993920 3300032005 Bacteria 751
188 Ga0307411_11046522 3300032005 Bacteria 733
189 Ga0307415_100298853 3300032126 Bacteria 1333
190 Ga0307415_100453487 3300032126 Bacteria 1109
191 Ga0373958_0059320 3300034819 Bacteria 826
192 Ga0373952_0027363 3300035092 Bacteria 1245
193 Ga0373960_0018525 3300035121 Bacteria 1817
194 Ga0373960_0328251 3300035121 Bacteria 575
195 Ga0373962_0151427 3300035242 Bacteria 760
196 Ga0395900_0325673 3300037418 Bacteria 1516
197 Ga0395900_0520581 3300037418 Bacteria 1137
198 Ga0395898_0027043 3300037466 Bacteria 5763
199 Ga0395898_0054180 3300037466 Bacteria 3915
200 Ga0395898_0161836 3300037466 Unclassified 2141
201 Ga0395898_0217916 3300037466 Bacteria 1821
202 Ga0395898_0218098 3300037466 Bacteria 1820
203 Ga0395905_0003983 3300037471 Bacteria 15532
204 Ga0395901_0003503 3300038443 Bacteria 15812
205 Ga0395901_0033360 3300038443 Bacteria 5315
206 Ga0395901_0160788 3300038443 Bacteria 2359
207 Ga0395901_0651868 3300038443 Bacteria 1056
208 Ga0395901_0673758 3300038443 Bacteria 1035
209 Ga0395901_1304050 3300038443 Bacteria 688
210 Ga0451807_1438938 3300041486 Bacteria 627
211 Ga0439450_009810 3300042008 Bacteria 1830
212 Ga0466963_0468604 3300044694 Bacteria 889
213 Ga0466957_0811299 3300044842 Bacteria 665
214 Ga0466960_0033635 3300044901 Bacteria 2384
215 Ga0466960_0054663 3300044901 Bacteria 1939
216 Ga0466967_0002709 3300045976 Bacteria 11200
217 Ga0466967_0219741 3300045976 Bacteria 1805
218 Ga0466967_1212119 3300045976 Bacteria 752
219 Ga0466967_2606119 3300045976 Bacteria 500
220 Ga0495596_0018442 3300046500 Bacteria 2876
221 Ga0495631_0202749 3300046518 Bacteria 848
222 Ga0495663_0033804 3300046525 Bacteria 1528
223 Ga0495656_0066202 3300046615 Bacteria 1591
224 Ga0496100_0296907 3300048903 Bacteria 1208
225 Ga0496100_0676168 3300048903 Bacteria 805
226 Ga0496101_0097267 3300048904 Bacteria 2198
227 Ga0496102_1530938 3300048905 Bacteria 585
228 Ga0496103_0080121 3300048906 Bacteria 2053
229 Ga0496104_0313925 3300048907 Bacteria 1480
230 Ga0496105_0282606 3300048908 Bacteria 1338
231 Ga0496107_0047145 3300048910 Bacteria 3103
232 Ga0496107_0065642 3300048910 Bacteria 2631
233 Ga0496108_0037079 3300048911 Bacteria 4059
234 Ga0496108_0178024 3300048911 Bacteria 1841
235 Ga0496108_0358152 3300048911 Bacteria 1273
236 Ga0496108_1256904 3300048911 Bacteria 624
237 Ga0496109_0021171 3300048912 Bacteria 5749
238 Ga0496109_0039048 3300048912 Bacteria 4295
239 Ga0496109_0387284 3300048912 Bacteria 1321
240 Ga0496110_0033564 3300048913 Bacteria 4440
241 Ga0496110_0470874 3300048913 Bacteria 1144
242 Ga0496111_0166813 3300048914 Bacteria 1636
243 Ga0496111_0619178 3300048914 Bacteria 791
244 Ga0496111_0770370 3300048914 Bacteria 697
245 Ga0496112_0341183 3300048915 Bacteria 1441
246 Ga0496112_0599501 3300048915 Bacteria 1033
247 Ga0496113_0313359 3300048916 Bacteria 1257
248 Ga0496113_0427854 3300048916 Bacteria 1063
249 Ga0496114_0241281 3300048917 Bacteria 1589
250 Ga0496115_0755161 3300048918 Bacteria 760
251 Ga0501033_0730461 3300049570 Unclassified 672
252 Ga0501036_0042441 3300049572 Bacteria 3851
253 Ga0501037_0386727 3300049573 Bacteria 961
254 Ga0501039_0078077 3300049575 Bacteria 2575
255 Ga0501041_0050002 3300049577 Bacteria 2547
256 Ga0501042_0140334 3300049578 Bacteria 1742
257 Ga0501042_0592720 3300049578 Bacteria 806
258 Ga0501043_0344045 3300049579 Unclassified 1134
259 Ga0501048_0097588 3300049582 Bacteria 2073
260 Ga0501048_0256829 3300049582 Unclassified 1241
261 Ga0501067_0061442 3300049583 Bacteria 2080
262 Ga0501068_0163371 3300049584 Bacteria 1404
263 Ga0501069_0008596 3300049585 Bacteria 5371
264 Ga0501070_0082825 3300049586 Bacteria 2655
265 Ga0501070_0093998 3300049586 Bacteria 2480
266 Ga0501071_0006988 3300049587 Bacteria 7371
267 Ga0501071_0051308 3300049587 Bacteria 2972
268 Ga0501071_0183047 3300049587 Bacteria 1570
269 Ga0501071_0478246 3300049587 Bacteria 954
270 Ga0501072_0006336 3300049588 Bacteria 9013
271 Ga0501072_0022982 3300049588 Bacteria 4841
272 Ga0501072_0099932 3300049588 Bacteria 2306
273 Ga0501072_0107368 3300049588 Bacteria 2220
274 Ga0501072_0602387 3300049588 Bacteria 866
275 Ga0501072_0686344 3300049588 Bacteria 805
276 Ga0501073_0009678 3300049589 Bacteria 7107
277 Ga0501074_0012368 3300049590 Bacteria 6204
278 Ga0501074_0202001 3300049590 Bacteria 1416
279 Ga0501075_0074794 3300049591 Bacteria 2562
280 Ga0501075_0082795 3300049591 Bacteria 2430
281 Ga0501076_0033345 3300049592 Bacteria 4020
282 Ga0501079_0016003 3300049741 Bacteria 5731
283 Ga0501079_0292805 3300049741 Bacteria 1273
284 Ga0501080_0314623 3300049742 Bacteria 1418
285 Ga0501081_0612672 3300049743 Unclassified 815
286 Ga0501083_0614020 3300049744 Bacteria 707
287 Ga0501045_0087374 3300049824 Bacteria 2302
288 nmdc:mga03n38_752992_c1 3300050490 Bacteria 564
289 nmdc:mga0yw44_424382_c1 3300050492 Bacteria 900
290 nmdc:mga05p37_47897_c1 3300050507 Bacteria 5256
291 nmdc:mga05p37_592873_c1 3300050507 Bacteria 1252
292 nmdc:mga05p37_725927_c1 3300050507 Bacteria 1099
293 nmdc:mga08y16_161869_c1 3300050511 Bacteria 2325
294 nmdc:mga0n895_701382_c1 3300050512 Bacteria 1008
295 nmdc:mga0a205_308336_c1 3300050515 Bacteria 1455
296 Ga0501084_0016903 3300054114 Bacteria 6064
297 Ga0501082_0018104 3300060353 Bacteria 6067
298 Ga0501082_0042778 3300060353 Bacteria 3905
299 Ga0501082_1444020 3300060353 Bacteria 601
300 Ga0530510_0009765 3300061734 Bacteria 6735
301 Ga0530510_0014079 3300061734 Bacteria 5639
302 Ga0075428_100914267
303 JGI24737J22298_10164218
304 JGI24743J22301_10080109
305 JGI24738J21930_10117011
306 Ga0070683_100019624
307 Ga0070670_100487981
308 Ga0070682_100025006
309 Ga0070682_100406161
310 Ga0068868_100203599
311 Ga0068868_100327020
312 Ga0070660_100106840
313 Ga0070689_100082226
314 Ga0070661_100097226
315 Ga0070692_10494150
316 Ga0070668_100807743
317 Ga0070669_100183753
318 Ga0070674_100006506
319 Ga0070688_100573149
320 Ga0070659_100202979
321 Ga0070659_101765335
322 Ga0070667_100452402
323 Ga0070710_10043726
324 Ga0070701_10511224
325 Ga0070663_100757315
326 Ga0068867_100229660
327 Ga0070684_100022121
328 Ga0070684_100591771
329 Ga0070684_100894449
330 Ga0070686_100104168
331 Ga0070695_100224237
332 Ga0070695_101051472
333 Ga0070704_100365523
334 Ga0070664_100255607
335 Ga0070664_100651562
336 Ga0068857_100512176
337 Ga0068854_100136157
338 Ga0070702_100031193
339 Ga0070702_100122633
340 Ga0070702_101092758
341 Ga0068852_100037964
342 Ga0068859_100739968
343 Ga0068864_100440115
344 Ga0068864_100481584
345 Ga0068864_101307363
346 Ga0068866_10059840
347 Ga0068861_100028758
348 Ga0068861_100538791
349 Ga0068861_100964144
350 Ga0068858_100634092
351 Ga0068860_101571469
352 Ga0068862_100300152
353 Ga0081455_10027444
354 Ga0081455_10611759
355 Ga0081538_10020333
356 Ga0081538_10021860
357 Ga0081540_1052473
358 Ga0081539_10060873
359 Ga0075365_11191285
360 Ga0075363_100776693
361 Ga0075364_10051189
362 Ga0070712_100027955
363 Ga0075428_100146293
364 Ga0075428_100218204
365 Ga0075428_101113899
366 Ga0075430_100196962
367 Ga0075430_100356855
368 Ga0075431_101231000
369 Ga0075433_10248987
370 Ga0075429_100206987
371 Ga0075429_100945626
372 Ga0068865_100324015
373 Ga0068865_101347301
374 Ga0097620_100739980
375 Ga0075435_101027070
376 Ga0105240_10353330
377 Ga0111539_11423491
378 Ga0105245_10006505
379 Ga0105245_10055112
380 Ga0105245_10804704
381 Ga0105245_10984845
382 Ga0114129_10114637
383 Ga0114129_12269128
384 Ga0105243_10058153
385 Ga0105243_10076773
386 Ga0105241_10346177
387 Ga0105242_10316613
388 Ga0105242_10467929
389 Ga0105248_10109627
390 Ga0105237_10384919
391 Ga0105238_10154903
392 Ga0105249_10255137
393 Ga0105239_10062470
394 Ga0105239_10348639
395 Ga0105239_11222384
396 Ga0105246_10197077
397 Ga0105246_10468245
398 Ga0157338_1016608
399 Ga0157371_10203640
400 Ga0163162_11125613
401 Ga0157375_10524703
402 Ga0157375_11558682
403 Ga0163163_10139941
404 Ga0163163_10222141
405 Ga0157377_10021134
406 Ga0157377_10493781
407 Ga0157379_10138940
408 Ga0207692_10033066
409 Ga0207688_10061614
410 Ga0207647_10181858
411 Ga0207643_10029344
412 Ga0207671_10392653
413 Ga0207693_10052029
414 Ga0207662_10007038
415 Ga0207657_10016992
416 Ga0207649_11648523
417 Ga0207694_10191291
418 Ga0207650_10461193
419 Ga0207650_11211388
420 Ga0207659_10302437
421 Ga0207687_10019899
422 Ga0207687_10394708
423 Ga0207687_10676431
424 Ga0207644_10023682
425 Ga0207690_10053394
426 Ga0207686_10742912
427 Ga0207670_11245775
428 Ga0207669_10021256
429 Ga0207669_10049400
430 Ga0207704_10486177
431 Ga0207691_10056212
432 Ga0207711_10579126
433 Ga0207689_10089431
434 Ga0207661_11300618
435 Ga0207679_10270277
436 Ga0207679_10297377
437 Ga0207651_10021056
438 Ga0207712_10082410
439 Ga0207712_10465888
440 Ga0207668_10176410
441 Ga0207668_10557595
442 Ga0207658_10365093
443 Ga0207677_10901575
444 Ga0207678_10100296
445 Ga0207708_10015984
446 Ga0207708_10597605
447 Ga0207702_10956114
448 Ga0207648_10040903
449 Ga0207676_10197659
450 Ga0207676_10375622
451 Ga0207674_10011090
452 Ga0207674_10514945
453 Ga0207674_10830513
454 Ga0207675_100050646
455 Ga0207675_100422682
456 Ga0207675_100457790
457 Ga0207675_101063251
458 Ga0207675_101350645
459 Ga0207683_10104914
460 Ga0307405_10078244
461 Ga0307405_10464154
462 Ga0307413_10034461
463 Ga0307410_10055695
464 Ga0307410_10139980
465 Ga0307406_10101530
466 Ga0307406_10226837
467 Ga0307406_10291061
468 Ga0307406_10438059
469 Ga0307406_10445803
470 Ga0307406_10816585
471 Ga0307407_10034097
472 Ga0307407_10082298
473 Ga0307407_10242101
474 Ga0307412_11603950
475 Ga0307409_100038705
476 Ga0307409_100061674
477 Ga0307409_100381169
478 Ga0307409_100885112
479 Ga0307416_100023718
480 Ga0307416_100036506
481 Ga0307416_100253073
482 Ga0307416_100258729
483 Ga0307416_100839274
484 Ga0307416_101408222
485 Ga0307414_10014480
486 Ga0307414_10274035
487 Ga0307411_10072793
488 Ga0307411_10993920
489 Ga0307411_11046522
490 Ga0307415_100298853
491 Ga0307415_100453487
492 Ga0373958_0059320
493 Ga0373952_0027363
494 Ga0373960_0018525
495 Ga0373960_0328251
496 Ga0373962_0151427
497 Ga0395900_0325673
498 Ga0395900_0520581
499 Ga0395898_0027043
500 Ga0395898_0054180
501 Ga0395898_0161836
502 Ga0395898_0217916
503 Ga0395898_0218098
504 Ga0395905_0003983
505 Ga0395901_0003503
506 Ga0395901_0033360
507 Ga0395901_0160788
508 Ga0395901_0651868
509 Ga0395901_0673758
510 Ga0395901_1304050
511 Ga0451807_1438938
512 Ga0439450_009810
513 Ga0466963_0468604
514 Ga0466957_0811299
515 Ga0466960_0033635
516 Ga0466960_0054663
517 Ga0466967_0002709
518 Ga0466967_0219741
519 Ga0466967_1212119
520 Ga0466967_2606119
521 Ga0495596_0018442
522 Ga0495631_0202749
523 Ga0495663_0033804
524 Ga0495656_0066202
525 Ga0496100_0296907
526 Ga0496100_0676168
527 Ga0496101_0097267
528 Ga0496102_1530938
529 Ga0496103_0080121
530 Ga0496104_0313925
531 Ga0496105_0282606
532 Ga0496107_0047145
533 Ga0496107_0065642
534 Ga0496108_0037079
535 Ga0496108_0178024
536 Ga0496108_0358152
537 Ga0496108_1256904
538 Ga0496109_0021171
539 Ga0496109_0039048
540 Ga0496109_0387284
541 Ga0496110_0033564
542 Ga0496110_0470874
543 Ga0496111_0166813
544 Ga0496111_0619178
545 Ga0496111_0770370
546 Ga0496112_0341183
547 Ga0496112_0599501
548 Ga0496113_0313359
549 Ga0496113_0427854
550 Ga0496114_0241281
551 Ga0496115_0755161
552 Ga0501033_0730461
553 Ga0501036_0042441
554 Ga0501037_0386727
555 Ga0501039_0078077
556 Ga0501041_0050002
557 Ga0501042_0140334
558 Ga0501042_0592720
559 Ga0501043_0344045
560 Ga0501048_0097588
561 Ga0501048_0256829
562 Ga0501067_0061442
563 Ga0501068_0163371
564 Ga0501069_0008596
565 Ga0501070_0082825
566 Ga0501070_0093998
567 Ga0501071_0006988
568 Ga0501071_0051308
569 Ga0501071_0183047
570 Ga0501071_0478246
571 Ga0501072_0006336
572 Ga0501072_0022982
573 Ga0501072_0099932
574 Ga0501072_0107368
575 Ga0501072_0602387
576 Ga0501072_0686344
577 Ga0501073_0009678
578 Ga0501074_0012368
579 Ga0501074_0202001
580 Ga0501075_0074794
581 Ga0501075_0082795
582 Ga0501076_0033345
583 Ga0501079_0016003
584 Ga0501079_0292805
585 Ga0501080_0314623
586 Ga0501081_0612672
587 Ga0501083_0614020
588 Ga0501045_0087374
589 nmdc:mga03n38_752992_c1
590 nmdc:mga0yw44_424382_c1
591 nmdc:mga05p37_47897_c1
592 nmdc:mga05p37_592873_c1
593 nmdc:mga05p37_725927_c1
594 nmdc:mga08y16_161869_c1
595 nmdc:mga0n895_701382_c1
596 nmdc:mga0a205_308336_c1
597 Ga0501084_0016903
598 Ga0501082_0018104
599 Ga0501082_0042778
600 Ga0501082_1444020
601 Ga0530510_0009765
602 Ga0530510_0014079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d8s-assembly1.cif.gz_K-2 2.55a resolution structure of bfrb (e85a) from pseudomonas aeruginosa 0.387 26 140
6nz1-assembly1.cif.gz_B crystal structure of computationally designed protein xxa_gvdq 0.3861 38 138
2lqg-assembly1.cif.gz_A solution structure of the r4 domain of talin 0.3711 23 140
6nz1-assembly1.cif.gz_B crystal structure of computationally designed protein xxa_gvdq 0.3564 38 138
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.3554 28 136
ID Description Score Start End Superfamily
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7117 26 140 1.10.10.1740
af_I1L7J1_1_138_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6854 26 136 1.20.120.550
af_I1LYI2_1_138_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6778 24 136 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6753 26 140 1.10.10.1740
af_A0A6M3QAV0_1_161_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.6549 21 140 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2H1HYI9-F1-model_v4 DoxX protein 0.9623 24 140 GO:0016020
AF-A0A7W4CUU5-F1-model_v4 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 0.9593 31 140 GO:0016020
AF-X8AU38-F1-model_v4 deleted 0.9578 21 140
AF-A0A3D9CMF6-F1-model_v4 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase 0.9517 24 141 GO:0016020
AF-A0A561PXG5-F1-model_v4 DoxX-like protein 0.9516 24 140 GO:0016020

Map