F395817

General Info

Members Datasets Scaffolds Average Seq Length
301 239 602 161

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_100213450|Ga0068862_1002134502
Length 192
Sequence MGHRQKSPQCHEIVMALRYEVVYYHRQLGSGKVDVMAGNESLAGENGGQARRKAVMAVLAHSATADIAGHLATVALPAHEDLREPENGLVMVRGRVGGDGAPFNLGEATVSRAAVRLSTGEVGFGYTLGRDREKARLIALCDAMVQSAELAGAIEARVVAPLRAAMIERQNRKAEEAAATRVDFYTLVRGEG

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
187 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
200 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
206 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
209 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
210 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
211 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
212 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
213 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
216 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
217 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
226 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
227 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
228 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
229 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
230 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
231 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
232 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
233 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
234 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
235 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
236 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
237 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
238 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
239 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0.33
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.28
Nodule 0
Rhizoplane 1.33
Rhizosphere 72.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_100213450 3300005844 Bacteria 1744
2 JGI25158J39367_1000444 3300002739 Bacteria 8576
3 rootH2_10161921 3300003320 Bacteria 1436
4 Ga0055539_1024042 3300003752 Bacteria 714
5 Ga0055540_1005461 3300003792 Bacteria 5335
6 Ga0070658_10205027 3300005327 Bacteria 1665
7 Ga0070676_10236261 3300005328 Bacteria 1214
8 Ga0070683_101373602 3300005329 Bacteria 679
9 Ga0070680_100339354 3300005336 Bacteria 1277
10 Ga0070682_100526198 3300005337 Bacteria 921
11 Ga0068868_100630630 3300005338 Bacteria 952
12 Ga0070691_10255827 3300005341 Bacteria 941
13 Ga0070669_100314207 3300005353 Bacteria 1264
14 Ga0070675_100444639 3300005354 Bacteria 1162
15 Ga0070674_100615173 3300005356 Bacteria 920
16 Ga0070714_100398109 3300005435 Bacteria 1301
17 Ga0070713_100137199 3300005436 Bacteria 2163
18 Ga0070710_10745642 3300005437 Bacteria 695
19 Ga0070663_101678795 3300005455 Bacteria 568
20 Ga0070678_100142178 3300005456 Bacteria 1922
21 Ga0070662_101135447 3300005457 Bacteria 671
22 Ga0070681_10038588 3300005458 Bacteria 4788
23 Ga0070681_10131347 3300005458 Bacteria 2436
24 Ga0070685_10465005 3300005466 Bacteria 889
25 Ga0070679_100061198 3300005530 Bacteria 3752
26 Ga0068853_100418119 3300005539 Bacteria 1257
27 Ga0070665_100023023 3300005548 Bacteria 6273
28 Ga0070665_100178383 3300005548 Bacteria 2125
29 Ga0070665_100683358 3300005548 Bacteria 1039
30 Ga0068855_100082169 3300005563 Bacteria 3734
31 Ga0068855_100134622 3300005563 Bacteria 2820
32 Ga0068857_100162825 3300005577 Bacteria 2025
33 Ga0068854_100238946 3300005578 Bacteria 1446
34 Ga0068854_100747191 3300005578 Bacteria 848
35 Ga0068856_100624036 3300005614 Bacteria 1099
36 Ga0068856_101459682 3300005614 Bacteria 698
37 Ga0068859_100130811 3300005617 Bacteria 2581
38 Ga0068864_101018948 3300005618 Bacteria 822
39 Ga0068861_101718334 3300005719 Bacteria 621
40 Ga0068870_10449875 3300005840 Bacteria 849
41 Ga0068862_100022749 3300005844 Bacteria 5245
42 Ga0068862_101008723 3300005844 Bacteria 824
43 Ga0081455_10040052 3300005937 Bacteria 4136
44 Ga0081538_10024381 3300005981 Bacteria 4311
45 Ga0081540_1156113 3300005983 Bacteria 892
46 Ga0070717_11091363 3300006028 Bacteria 727
47 Ga0075365_10178465 3300006038 Bacteria 1484
48 Ga0075365_10197036 3300006038 Bacteria 1411
49 Ga0075368_10069986 3300006042 Bacteria 1415
50 Ga0075368_10287934 3300006042 Bacteria 707
51 Ga0075363_100103720 3300006048 Bacteria 1576
52 Ga0070712_100661620 3300006175 Bacteria 888
53 Ga0075362_10081092 3300006177 Bacteria 1496
54 Ga0075367_10081302 3300006178 Bacteria 1961
55 Ga0075367_10165545 3300006178 Bacteria 1376
56 Ga0075367_10319308 3300006178 Bacteria 978
57 Ga0075367_10465117 3300006178 Bacteria 802
58 Ga0075369_10015745 3300006186 Bacteria 3040
59 Ga0075370_10326132 3300006353 Bacteria 915
60 Ga0075428_100145528 3300006844 Bacteria 2575
61 Ga0075431_100777089 3300006847 Bacteria 932
62 Ga0097620_100130818 3300006931 Bacteria 2581
63 Ga0099794_10497630 3300007265 Bacteria 641
64 Ga0105240_10041316 3300009093 Bacteria 5887
65 Ga0105240_10421543 3300009093 Bacteria 1499
66 Ga0105240_10592507 3300009093 Bacteria 1221
67 Ga0111539_10011199 3300009094 Bacteria 11272
68 Ga0111539_11108485 3300009094 Bacteria 920
69 Ga0105247_10229958 3300009101 Bacteria 1259
70 Ga0114129_10244512 3300009147 Bacteria 2411
71 Ga0105243_10930746 3300009148 Bacteria 867
72 Ga0105241_10608813 3300009174 Bacteria 988
73 Ga0105249_10309765 3300009553 Bacteria 1587
74 Ga0105249_10518339 3300009553 Bacteria 1239
75 Ga0105239_10923740 3300010375 Bacteria 1002
76 Ga0157370_10064863 3300013104 Bacteria 3456
77 Ga0157370_11475662 3300013104 Bacteria 612
78 Ga0157369_10045066 3300013105 Bacteria 4798
79 Ga0157378_11037396 3300013297 Bacteria 855
80 Ga0163162_10743080 3300013306 Bacteria 1101
81 Ga0157376_10195230 3300014969 Bacteria 1859
82 Ga0206353_10679837 3300020082 Bacteria 3099
83 Ga0213875_10032466 3300021388 Bacteria 2468
84 Ga0209677_100810 3300025253 Bacteria 15627
85 Ga0209130_1042675 3300025284 Bacteria 867
86 Ga0209758_1008017 3300025297 Bacteria 6982
87 Ga0209051_1013862 3300025303 Bacteria 3803
88 Ga0207692_10013846 3300025898 Bacteria 3510
89 Ga0207710_10234292 3300025900 Bacteria 914
90 Ga0207680_10111048 3300025903 Bacteria 1778
91 Ga0207647_10209553 3300025904 Bacteria 1126
92 Ga0207699_10017116 3300025906 Bacteria 3807
93 Ga0207699_10042171 3300025906 Bacteria 2641
94 Ga0207645_10064374 3300025907 Bacteria 2343
95 Ga0207645_10365368 3300025907 Bacteria 967
96 Ga0207643_10097767 3300025908 Bacteria 1718
97 Ga0207705_10266939 3300025909 Bacteria 1308
98 Ga0207707_10028930 3300025912 Bacteria 4843
99 Ga0207695_10394629 3300025913 Bacteria 1268
100 Ga0207695_10476349 3300025913 Bacteria 1130
101 Ga0207693_10032773 3300025915 Bacteria 4100
102 Ga0207663_10098750 3300025916 Bacteria 1956
103 Ga0207652_10035699 3300025921 Bacteria 4198
104 Ga0207681_10187229 3300025923 Bacteria 1581
105 Ga0207694_10142349 3300025924 Bacteria 1929
106 Ga0207687_10601969 3300025927 Bacteria 926
107 Ga0207700_10052332 3300025928 Bacteria 3052
108 Ga0207700_10065124 3300025928 Bacteria 2779
109 Ga0207664_10119381 3300025929 Bacteria 2204
110 Ga0207664_11652519 3300025929 Bacteria 563
111 Ga0207670_10123852 3300025936 Bacteria 1883
112 Ga0207665_10173650 3300025939 Bacteria 1558
113 Ga0207689_10103495 3300025942 Bacteria 2339
114 Ga0207661_11070473 3300025944 Bacteria 743
115 Ga0207679_10507342 3300025945 Bacteria 1077
116 Ga0207667_10133289 3300025949 Bacteria 2559
117 Ga0207667_10145495 3300025949 Bacteria 2440
118 Ga0207651_10569494 3300025960 Bacteria 987
119 Ga0207640_10546541 3300025981 Bacteria 972
120 Ga0207677_10174814 3300026023 Bacteria 1683
121 Ga0207703_10854782 3300026035 Bacteria 870
122 Ga0207639_10710920 3300026041 Bacteria 933
123 Ga0207678_10233477 3300026067 Bacteria 1575
124 Ga0207708_10107818 3300026075 Bacteria 2160
125 Ga0207708_10604795 3300026075 Bacteria 929
126 Ga0207702_10009007 3300026078 Bacteria 8404
127 Ga0207674_10074774 3300026116 Bacteria 3399
128 Ga0207675_100616707 3300026118 Bacteria 1089
129 Ga0207683_10056387 3300026121 Bacteria 3446
130 Ga0207683_10596188 3300026121 Bacteria 1022
131 Ga0209813_10129342 3300027866 Bacteria 887
132 Ga0207428_10945869 3300027907 Bacteria 607
133 Ga0268266_10587508 3300028379 Bacteria 1069
134 Ga0268266_10832845 3300028379 Bacteria 891
135 Ga0268266_10833424 3300028379 Bacteria 891
136 Ga0268265_10201347 3300028380 Bacteria 1727
137 Ga0268265_10334463 3300028380 Bacteria 1376
138 Ga0268265_10442350 3300028380 Bacteria 1212
139 Ga0268264_10729799 3300028381 Bacteria 986
140 Ga0307515_10210776 3300028794 Bacteria 1788
141 Ga0265314_10000997 3300031711 Bacteria 33206
142 Ga0265342_10025412 3300031712 Bacteria 3723
143 Ga0307516_10316376 3300031730 Bacteria 1233
144 Ga0307413_10663937 3300031824 Bacteria 861
145 Ga0307410_10584313 3300031852 Bacteria 930
146 Ga0307410_10716092 3300031852 Bacteria 845
147 Ga0307406_10274874 3300031901 Bacteria 1282
148 Ga0307406_10822811 3300031901 Bacteria 785
149 Ga0307412_10478613 3300031911 Bacteria 1032
150 Ga0307409_100204250 3300031995 Bacteria 1770
151 Ga0307416_100386801 3300032002 Bacteria 1431
152 Ga0307411_10486836 3300032005 Bacteria 1040
153 Ga0307411_10582440 3300032005 Bacteria 959
154 Ga0307415_100406974 3300032126 Bacteria 1163
155 Ga0307415_100948243 3300032126 Bacteria 796
156 Ga0373951_0203754 3300035091 Bacteria 577
157 Ga0373923_0056965 3300035111 Bacteria 1651
158 Ga0373936_0094947 3300035113 Bacteria 1253
159 Ga0373945_0020010 3300035116 Bacteria 2288
160 Ga0373954_0024564 3300035118 Bacteria 2748
161 Ga0373946_0012668 3300035171 Bacteria 3160
162 Ga0373924_0167631 3300035410 Bacteria 964
163 Ga0373935_0033732 3300035692 Bacteria 3187
164 Ga0373927_0004707 3300035695 Bacteria 9511
165 Ga0373927_0027238 3300035695 Bacteria 3733
166 Ga0373933_0086466 3300035724 Bacteria 1929
167 Ga0373947_0020559 3300035725 Bacteria 3812
168 Ga0373947_0195857 3300035725 Bacteria 1320
169 Ga0373937_0255996 3300036401 Bacteria 1650
170 Ga0373925_0064934 3300037068 Bacteria 2748
171 Ga0373925_0643705 3300037068 Bacteria 873
172 Ga0395898_0089842 3300037466 Bacteria 2956
173 Ga0395905_0215360 3300037471 Bacteria 1799
174 Ga0436364_0987031 3300037853 Bacteria 4058
175 Ga0395901_0135579 3300038443 Bacteria 2588
176 Ga0395901_0157739 3300038443 Bacteria 2383
177 Ga0436365_0304188 3300039437 Bacteria 1256
178 Ga0436363_0017006 3300039450 Bacteria 7738
179 Ga0439465_0065845 3300041413 Bacteria 1207
180 Ga0451833_0217103 3300041491 Bacteria 660
181 Ga0466963_0541366 3300044694 Bacteria 822
182 Ga0466963_0673598 3300044694 Bacteria 730
183 Ga0466964_0221750 3300044706 Bacteria 919
184 Ga0466967_0169484 3300045976 Bacteria 2053
185 Ga0495617_083777 3300046452 Bacteria 1044
186 Ga0495617_223291 3300046452 Bacteria 585
187 Ga0495592_0049821 3300046454 Bacteria 3113
188 Ga0495592_0525656 3300046454 Bacteria 731
189 Ga0495603_0178964 3300046455 Bacteria 1227
190 Ga0495629_0082761 3300046459 Bacteria 2240
191 Ga0495638_0349305 3300046460 Bacteria 782
192 Ga0495580_0023706 3300046472 Bacteria 4501
193 Ga0495639_0027100 3300046475 Bacteria 2535
194 Ga0495662_0141559 3300046476 Bacteria 1184
195 Ga0495664_0118976 3300046477 Bacteria 1597
196 Ga0495584_0435757 3300046491 Bacteria 666
197 Ga0495585_0236830 3300046492 Bacteria 915
198 Ga0495616_0140264 3300046513 Bacteria 1101
199 Ga0495618_0042856 3300046514 Bacteria 2854
200 Ga0495628_0093466 3300046516 Bacteria 2326
201 Ga0495630_0022519 3300046517 Bacteria 4653
202 Ga0495632_0329617 3300046519 Bacteria 673
203 Ga0495666_0041698 3300046526 Bacteria 2222
204 Ga0495652_0247331 3300046529 Bacteria 1323
205 Ga0495665_0158929 3300046531 Bacteria 1178
206 Ga0495640_0098958 3300046533 Bacteria 1916
207 Ga0495586_0555299 3300046535 Bacteria 663
208 Ga0495645_0147337 3300046543 Bacteria 1639
209 Ga0495668_0335063 3300046616 Bacteria 830
210 Ga0495634_0018213 3300046642 Bacteria 5003
211 Ga0495611_0120577 3300046648 Bacteria 1223
212 Ga0495625_0188394 3300046660 Bacteria 1368
213 Ga0495625_0472576 3300046660 Bacteria 771
214 Ga0495635_0499977 3300046663 Bacteria 800
215 Ga0495623_0208271 3300046679 Bacteria 1121
216 Ga0495646_0266547 3300046680 Bacteria 914
217 Ga0495613_0030188 3300046689 Bacteria 4027
218 Ga0495624_0092621 3300046690 Bacteria 1864
219 Ga0495671_0053030 3300046692 Bacteria 2014
220 Ga0495649_0287094 3300046694 Bacteria 840
221 Ga0495589_0505447 3300046794 Bacteria 552
222 Ga0495581_0134828 3300047315 Bacteria 1439
223 Ga0495604_0259062 3300047317 Bacteria 1183
224 Ga0495674_0079476 3300047319 Bacteria 2816
225 Ga0495674_0609100 3300047319 Bacteria 864
226 Ga0495676_0065177 3300047321 Bacteria 2829
227 Ga0495680_0550062 3300047322 Bacteria 778
228 Ga0495675_0357426 3300047444 Bacteria 858
229 Ga0495673_0065401 3300047469 Bacteria 1544
230 Ga0495684_0060776 3300047471 Bacteria 2875
231 Ga0495593_0012875 3300047673 Bacteria 4779
232 Ga0496101_0690316 3300048904 Bacteria 806
233 Ga0496107_0377075 3300048910 Bacteria 1055
234 Ga0496114_0809143 3300048917 Bacteria 816
235 Ga0496115_0348467 3300048918 Bacteria 1208
236 Ga0496117_0053072 3300048920 Bacteria 2851
237 Ga0496117_0229885 3300048920 Bacteria 1026
238 Ga0496118_0023344 3300048921 Bacteria 5375
239 Ga0496118_0119743 3300048921 Bacteria 1720
240 Ga0496118_0120498 3300048921 Bacteria 1712
241 Ga0496119_0009856 3300048922 Bacteria 8120
242 Ga0496119_0034542 3300048922 Bacteria 3327
243 Ga0496120_0237630 3300048923 Bacteria 862
244 Ga0496121_0005996 3300048924 Bacteria 15351
245 Ga0496121_0024199 3300048924 Bacteria 5817
246 Ga0496121_0025848 3300048924 Bacteria 5554
247 Ga0496121_0025859 3300048924 Bacteria 5554
248 Ga0496121_0066712 3300048924 Bacteria 2920
249 Ga0496121_0229518 3300048924 Bacteria 1301
250 Ga0496121_0266629 3300048924 Bacteria 1179
251 Ga0496121_0284493 3300048924 Bacteria 1129
252 Ga0496124_0260859 3300048927 Bacteria 1275
253 Ga0496126_0071703 3300048929 Bacteria 3083
254 Ga0496126_0079781 3300048929 Bacteria 2897
255 Ga0496126_0348056 3300048929 Bacteria 1213
256 Ga0496126_0360964 3300048929 Bacteria 1186
257 Ga0496126_0771195 3300048929 Bacteria 740
258 Ga0495682_0073071 3300049460 Bacteria 1234
259 Ga0501039_0473286 3300049575 Bacteria 984
260 Ga0501046_0093729 3300049580 Bacteria 2308
261 Ga0501047_0413078 3300049581 Bacteria 1181
262 Ga0501048_0960806 3300049582 Bacteria 615
263 Ga0501074_0275849 3300049590 Bacteria 1195
264 Ga0501080_0003595 3300049742 Bacteria 13649
265 Ga0501035_0913778 3300049822 Bacteria 695
266 nmdc:mga03683_195385_c1 3300050489 Bacteria 927
267 nmdc:mga03683_344675_c1 3300050489 Bacteria 704
268 nmdc:mga03n38_99516_c1 3300050490 Bacteria 1400
269 nmdc:mga0yw44_539968_c1 3300050492 Bacteria 792
270 nmdc:mga06z11_124216_c1 3300050494 Bacteria 1443
271 nmdc:mga04h51_151716_c1 3300050495 Bacteria 886
272 nmdc:mga07m45_78937_c1 3300050496 Bacteria 1878
273 nmdc:mga05p37_323734_c1 3300050507 Bacteria 1823
274 nmdc:mga0qj67_830273_c1 3300050509 Bacteria 730
275 nmdc:mga06r32_1579265_c1 3300050510 Bacteria 595
276 nmdc:mga08y16_228907_c1 3300050511 Bacteria 1923
277 nmdc:mga08y16_320590_c1 3300050511 Bacteria 1595
278 nmdc:mga0sz30_185308_c1 3300050516 Bacteria 924
279 Ga0495619_0547725 3300053085 Bacteria 794
280 Ga0500643_029445 3300053087 Bacteria 1689
281 Ga0500646_0066782 3300053090 Bacteria 1071
282 Ga0500651_0002542 3300053093 Bacteria 9673
283 Ga0500566_0000929 3300053094 Bacteria 16757
284 Ga0500641_0069867 3300053096 Bacteria 1476
285 Ga0500594_0134047 3300053118 Bacteria 786
286 Ga0500595_001385 3300053119 Bacteria 12987
287 Ga0500595_014126 3300053119 Bacteria 3037
288 Ga0500595_045129 3300053119 Bacteria 1393
289 Ga0500642_0178770 3300053130 Bacteria 992
290 Ga0500579_183139 3300053143 Bacteria 819
291 Ga0500603_003618 3300053150 Bacteria 3310
292 Ga0500638_003972 3300053162 Bacteria 5600
293 Ga0500636_0183387 3300053177 Bacteria 1122
294 Ga0500637_0000193 3300053178 Bacteria 22721
295 Ga0500611_064444 3300053727 Bacteria 877
296 Ga0500609_035291 3300053731 Bacteria 689
297 Ga0500661_000775 3300055283 Bacteria 5968
298 2585267041 2582581306 Bacteria 6450535
299 2585388082 2582581865 Bacteria 6644329
300 2885387003 2885383462 Bacteria 9473874
301 8006987512 8006984368 Bacteria 9651211
302 Ga0068862_100213450
303 JGI25158J39367_1000444
304 rootH2_10161921
305 Ga0055539_1024042
306 Ga0055540_1005461
307 Ga0070658_10205027
308 Ga0070676_10236261
309 Ga0070683_101373602
310 Ga0070680_100339354
311 Ga0070682_100526198
312 Ga0068868_100630630
313 Ga0070691_10255827
314 Ga0070669_100314207
315 Ga0070675_100444639
316 Ga0070674_100615173
317 Ga0070714_100398109
318 Ga0070713_100137199
319 Ga0070710_10745642
320 Ga0070663_101678795
321 Ga0070678_100142178
322 Ga0070662_101135447
323 Ga0070681_10038588
324 Ga0070681_10131347
325 Ga0070685_10465005
326 Ga0070679_100061198
327 Ga0068853_100418119
328 Ga0070665_100023023
329 Ga0070665_100178383
330 Ga0070665_100683358
331 Ga0068855_100082169
332 Ga0068855_100134622
333 Ga0068857_100162825
334 Ga0068854_100238946
335 Ga0068854_100747191
336 Ga0068856_100624036
337 Ga0068856_101459682
338 Ga0068859_100130811
339 Ga0068864_101018948
340 Ga0068861_101718334
341 Ga0068870_10449875
342 Ga0068862_100022749
343 Ga0068862_101008723
344 Ga0081455_10040052
345 Ga0081538_10024381
346 Ga0081540_1156113
347 Ga0070717_11091363
348 Ga0075365_10178465
349 Ga0075365_10197036
350 Ga0075368_10069986
351 Ga0075368_10287934
352 Ga0075363_100103720
353 Ga0070712_100661620
354 Ga0075362_10081092
355 Ga0075367_10081302
356 Ga0075367_10165545
357 Ga0075367_10319308
358 Ga0075367_10465117
359 Ga0075369_10015745
360 Ga0075370_10326132
361 Ga0075428_100145528
362 Ga0075431_100777089
363 Ga0097620_100130818
364 Ga0099794_10497630
365 Ga0105240_10041316
366 Ga0105240_10421543
367 Ga0105240_10592507
368 Ga0111539_10011199
369 Ga0111539_11108485
370 Ga0105247_10229958
371 Ga0114129_10244512
372 Ga0105243_10930746
373 Ga0105241_10608813
374 Ga0105249_10309765
375 Ga0105249_10518339
376 Ga0105239_10923740
377 Ga0157370_10064863
378 Ga0157370_11475662
379 Ga0157369_10045066
380 Ga0157378_11037396
381 Ga0163162_10743080
382 Ga0157376_10195230
383 Ga0206353_10679837
384 Ga0213875_10032466
385 Ga0209677_100810
386 Ga0209130_1042675
387 Ga0209758_1008017
388 Ga0209051_1013862
389 Ga0207692_10013846
390 Ga0207710_10234292
391 Ga0207680_10111048
392 Ga0207647_10209553
393 Ga0207699_10017116
394 Ga0207699_10042171
395 Ga0207645_10064374
396 Ga0207645_10365368
397 Ga0207643_10097767
398 Ga0207705_10266939
399 Ga0207707_10028930
400 Ga0207695_10394629
401 Ga0207695_10476349
402 Ga0207693_10032773
403 Ga0207663_10098750
404 Ga0207652_10035699
405 Ga0207681_10187229
406 Ga0207694_10142349
407 Ga0207687_10601969
408 Ga0207700_10052332
409 Ga0207700_10065124
410 Ga0207664_10119381
411 Ga0207664_11652519
412 Ga0207670_10123852
413 Ga0207665_10173650
414 Ga0207689_10103495
415 Ga0207661_11070473
416 Ga0207679_10507342
417 Ga0207667_10133289
418 Ga0207667_10145495
419 Ga0207651_10569494
420 Ga0207640_10546541
421 Ga0207677_10174814
422 Ga0207703_10854782
423 Ga0207639_10710920
424 Ga0207678_10233477
425 Ga0207708_10107818
426 Ga0207708_10604795
427 Ga0207702_10009007
428 Ga0207674_10074774
429 Ga0207675_100616707
430 Ga0207683_10056387
431 Ga0207683_10596188
432 Ga0209813_10129342
433 Ga0207428_10945869
434 Ga0268266_10587508
435 Ga0268266_10832845
436 Ga0268266_10833424
437 Ga0268265_10201347
438 Ga0268265_10334463
439 Ga0268265_10442350
440 Ga0268264_10729799
441 Ga0307515_10210776
442 Ga0265314_10000997
443 Ga0265342_10025412
444 Ga0307516_10316376
445 Ga0307413_10663937
446 Ga0307410_10584313
447 Ga0307410_10716092
448 Ga0307406_10274874
449 Ga0307406_10822811
450 Ga0307412_10478613
451 Ga0307409_100204250
452 Ga0307416_100386801
453 Ga0307411_10486836
454 Ga0307411_10582440
455 Ga0307415_100406974
456 Ga0307415_100948243
457 Ga0373951_0203754
458 Ga0373923_0056965
459 Ga0373936_0094947
460 Ga0373945_0020010
461 Ga0373954_0024564
462 Ga0373946_0012668
463 Ga0373924_0167631
464 Ga0373935_0033732
465 Ga0373927_0004707
466 Ga0373927_0027238
467 Ga0373933_0086466
468 Ga0373947_0020559
469 Ga0373947_0195857
470 Ga0373937_0255996
471 Ga0373925_0064934
472 Ga0373925_0643705
473 Ga0395898_0089842
474 Ga0395905_0215360
475 Ga0436364_0987031
476 Ga0395901_0135579
477 Ga0395901_0157739
478 Ga0436365_0304188
479 Ga0436363_0017006
480 Ga0439465_0065845
481 Ga0451833_0217103
482 Ga0466963_0541366
483 Ga0466963_0673598
484 Ga0466964_0221750
485 Ga0466967_0169484
486 Ga0495617_083777
487 Ga0495617_223291
488 Ga0495592_0049821
489 Ga0495592_0525656
490 Ga0495603_0178964
491 Ga0495629_0082761
492 Ga0495638_0349305
493 Ga0495580_0023706
494 Ga0495639_0027100
495 Ga0495662_0141559
496 Ga0495664_0118976
497 Ga0495584_0435757
498 Ga0495585_0236830
499 Ga0495616_0140264
500 Ga0495618_0042856
501 Ga0495628_0093466
502 Ga0495630_0022519
503 Ga0495632_0329617
504 Ga0495666_0041698
505 Ga0495652_0247331
506 Ga0495665_0158929
507 Ga0495640_0098958
508 Ga0495586_0555299
509 Ga0495645_0147337
510 Ga0495668_0335063
511 Ga0495634_0018213
512 Ga0495611_0120577
513 Ga0495625_0188394
514 Ga0495625_0472576
515 Ga0495635_0499977
516 Ga0495623_0208271
517 Ga0495646_0266547
518 Ga0495613_0030188
519 Ga0495624_0092621
520 Ga0495671_0053030
521 Ga0495649_0287094
522 Ga0495589_0505447
523 Ga0495581_0134828
524 Ga0495604_0259062
525 Ga0495674_0079476
526 Ga0495674_0609100
527 Ga0495676_0065177
528 Ga0495680_0550062
529 Ga0495675_0357426
530 Ga0495673_0065401
531 Ga0495684_0060776
532 Ga0495593_0012875
533 Ga0496101_0690316
534 Ga0496107_0377075
535 Ga0496114_0809143
536 Ga0496115_0348467
537 Ga0496117_0053072
538 Ga0496117_0229885
539 Ga0496118_0023344
540 Ga0496118_0119743
541 Ga0496118_0120498
542 Ga0496119_0009856
543 Ga0496119_0034542
544 Ga0496120_0237630
545 Ga0496121_0005996
546 Ga0496121_0024199
547 Ga0496121_0025848
548 Ga0496121_0025859
549 Ga0496121_0066712
550 Ga0496121_0229518
551 Ga0496121_0266629
552 Ga0496121_0284493
553 Ga0496124_0260859
554 Ga0496126_0071703
555 Ga0496126_0079781
556 Ga0496126_0348056
557 Ga0496126_0360964
558 Ga0496126_0771195
559 Ga0495682_0073071
560 Ga0501039_0473286
561 Ga0501046_0093729
562 Ga0501047_0413078
563 Ga0501048_0960806
564 Ga0501074_0275849
565 Ga0501080_0003595
566 Ga0501035_0913778
567 nmdc:mga03683_195385_c1
568 nmdc:mga03683_344675_c1
569 nmdc:mga03n38_99516_c1
570 nmdc:mga0yw44_539968_c1
571 nmdc:mga06z11_124216_c1
572 nmdc:mga04h51_151716_c1
573 nmdc:mga07m45_78937_c1
574 nmdc:mga05p37_323734_c1
575 nmdc:mga0qj67_830273_c1
576 nmdc:mga06r32_1579265_c1
577 nmdc:mga08y16_228907_c1
578 nmdc:mga08y16_320590_c1
579 nmdc:mga0sz30_185308_c1
580 Ga0495619_0547725
581 Ga0500643_029445
582 Ga0500646_0066782
583 Ga0500651_0002542
584 Ga0500566_0000929
585 Ga0500641_0069867
586 Ga0500594_0134047
587 Ga0500595_001385
588 Ga0500595_014126
589 Ga0500595_045129
590 Ga0500642_0178770
591 Ga0500579_183139
592 Ga0500603_003618
593 Ga0500638_003972
594 Ga0500636_0183387
595 Ga0500637_0000193
596 Ga0500611_064444
597 Ga0500609_035291
598 Ga0500661_000775
599 2585267041
600 2585388082
601 2885387003
602 8006987512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06754

PhnG

Phosphonate metabolism protein PhnG

50

190

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xb6-assembly1.cif.gz_E structure of the e. coli c-p lyase core complex 0.8823 26 171
7z19-assembly1.cif.gz_A e. coli c-p lyase bound to a single phnk abc domain 0.8782 27 166
7z17-assembly1.cif.gz_E e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.8685 27 168
7z19-assembly1.cif.gz_A e. coli c-p lyase bound to a single phnk abc domain 0.8611 27 166
4xb6-assembly1.cif.gz_E structure of the e. coli c-p lyase core complex 0.86 26 171
ID Description Score Start End Superfamily
af_I1N1P2_56_441_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.6964 86 107 3.40.850.10
af_Q8IMG8_32_291_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.6733 86 107 3.40.850.10
af_A0A1D8PCZ8_263_411_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6356 86 107 2.60.40.640
af_A0A146M1R1_669_734_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6302 57 122 3.30.160.20
af_Q25815_90_159_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6024 57 123 3.30.160.20
ID Description Score Start End GO Terms
AF-A0A1G2X1P8-F1-model_v4 deleted 0.9535 29 143
AF-A0A7C4WSC3-F1-model_v4 Phosphonate C-P lyase system protein PhnG 0.9531 28 144 GO:0015716
GO:0016829
GO:0019634
AF-A0A529HSF8-F1-model_v4 Phosphonate C-P lyase system protein PhnG 0.9404 20 147 GO:0015716
GO:0016829
GO:0019634
AF-M1WUV8-F1-model_v4 Protein phnG (Modular protein) 0.9344 30 171 GO:0015716
GO:0019634
AF-A0A1W9KLQ6-F1-model_v4 deleted 0.9332 29 171

Map