F395722

General Info

Members Datasets Scaffolds Average Seq Length
301 140 602 128

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_101776005|Ga0070680_1017760051
Length 137
Sequence VRSRPVYASCVRVFLVRHAEAAPGEPDELRRLTSAGRESARALGERLAEEQPTAVVSSPLLRARETADLIARACKLEATTAESLAPGATADTLRESAGDRGGTVVAVAHQPDCSEIVFELTGREVSFPPAGVAELDL

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
34 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
35 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
71 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
72 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
73 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
76 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
79 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
80 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
90 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
91 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
101 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
104 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
105 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
106 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
107 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
124 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 2.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 5.98
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 4.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_101776005 3300005336 Unclassified 534
2 Ga0070658_10800361 3300005327 Bacteria 819
3 Ga0070683_100056020 3300005329 Bacteria 3660
4 Ga0070683_100653296 3300005329 Bacteria 1007
5 Ga0070680_100010146 3300005336 Bacteria 7261
6 Ga0070680_100050066 3300005336 Bacteria 3407
7 Ga0070680_100602549 3300005336 Bacteria 943
8 Ga0070680_100686797 3300005336 Unclassified 881
9 Ga0070682_100160291 3300005337 Bacteria 1553
10 Ga0070682_100338482 3300005337 Bacteria 1118
11 Ga0070682_100479716 3300005337 Bacteria 959
12 Ga0070682_100705276 3300005337 Bacteria 810
13 Ga0070682_100794030 3300005337 Unclassified 768
14 Ga0070660_100140173 3300005339 Bacteria 1939
15 Ga0070660_101188092 3300005339 Bacteria 647
16 Ga0070661_100016727 3300005344 Bacteria 5191
17 Ga0070661_100023202 3300005344 Bacteria 4446
18 Ga0070661_100089934 3300005344 Bacteria 2273
19 Ga0070661_100353291 3300005344 Bacteria 1154
20 Ga0070661_100929790 3300005344 Unclassified 719
21 Ga0070659_100011375 3300005366 Bacteria 6581
22 Ga0070659_100333036 3300005366 Bacteria 1271
23 Ga0070714_100074808 3300005435 Bacteria 2937
24 Ga0070714_100273863 3300005435 Bacteria 1566
25 Ga0070714_100904482 3300005435 Bacteria 857
26 Ga0070710_10653806 3300005437 Unclassified 737
27 Ga0070663_100271799 3300005455 Bacteria 1348
28 Ga0070678_100012715 3300005456 Bacteria 5247
29 Ga0070678_101025565 3300005456 Bacteria 759
30 Ga0070662_100341677 3300005457 Bacteria 1225
31 Ga0070681_10024040 3300005458 Bacteria 6135
32 Ga0070681_10080902 3300005458 Bacteria 3204
33 Ga0070681_10121728 3300005458 Bacteria 2544
34 Ga0070681_10210667 3300005458 Bacteria 1860
35 Ga0070681_10293460 3300005458 Bacteria 1536
36 Ga0070707_100011670 3300005468 Bacteria 8197
37 Ga0070679_100013554 3300005530 Bacteria 7810
38 Ga0070679_100050841 3300005530 Bacteria 4128
39 Ga0070679_100113810 3300005530 Bacteria 2691
40 Ga0070679_100223375 3300005530 Bacteria 1844
41 Ga0070679_100402329 3300005530 Bacteria 1315
42 Ga0070679_100586966 3300005530 Bacteria 1058
43 Ga0070684_100147947 3300005535 Bacteria 2127
44 Ga0070684_100246758 3300005535 Bacteria 1632
45 Ga0070684_100278715 3300005535 Bacteria 1532
46 Ga0068853_100109153 3300005539 Bacteria 2455
47 Ga0068853_100225745 3300005539 Bacteria 1712
48 Ga0068853_100367896 3300005539 Bacteria 1341
49 Ga0068853_101005097 3300005539 Bacteria 803
50 Ga0068855_100079815 3300005563 Bacteria 3794
51 Ga0068855_100219641 3300005563 Bacteria 2132
52 Ga0068855_100242889 3300005563 Bacteria 2011
53 Ga0068855_100565525 3300005563 Bacteria 1229
54 Ga0068857_100025657 3300005577 Bacteria 5189
55 Ga0068857_100191375 3300005577 Bacteria 1863
56 Ga0068857_100196350 3300005577 Bacteria 1839
57 Ga0068856_100224566 3300005614 Bacteria 1893
58 Ga0068856_100504035 3300005614 Bacteria 1231
59 Ga0068852_100013329 3300005616 Bacteria 6289
60 Ga0068852_100194059 3300005616 Bacteria 1918
61 Ga0068852_100248688 3300005616 Bacteria 1702
62 Ga0068852_100796343 3300005616 Bacteria 959
63 Ga0075365_10025251 3300006038 Bacteria 3759
64 Ga0070716_101622226 3300006173 Unclassified 532
65 Ga0075367_10451123 3300006178 Unclassified 815
66 Ga0075434_101846147 3300006871 Bacteria 611
67 Ga0105240_10028335 3300009093 Bacteria 7317
68 Ga0105240_10472707 3300009093 Bacteria 1399
69 Ga0105240_10802223 3300009093 Bacteria 1020
70 Ga0105240_11453350 3300009093 Unclassified 720
71 Ga0111539_10324939 3300009094 Bacteria 1791
72 Ga0111539_11021324 3300009094 Bacteria 961
73 Ga0105241_10499129 3300009174 Bacteria 1085
74 Ga0105242_10379608 3300009176 Bacteria 1313
75 Ga0105242_11606777 3300009176 Bacteria 684
76 Ga0105237_10023365 3300009545 Bacteria 6336
77 Ga0105237_10048550 3300009545 Bacteria 4267
78 Ga0105237_10158528 3300009545 Bacteria 2261
79 Ga0105238_10028595 3300009551 Bacteria 5679
80 Ga0105238_10033167 3300009551 Bacteria 5255
81 Ga0105238_10691497 3300009551 Bacteria 1032
82 Ga0105239_10361810 3300010375 Bacteria 1639
83 Ga0157370_10053383 3300013104 Bacteria 3854
84 Ga0157370_10063750 3300013104 Bacteria 3490
85 Ga0157370_10174297 3300013104 Bacteria 1999
86 Ga0157370_10192939 3300013104 Bacteria 1891
87 Ga0157370_10217985 3300013104 Bacteria 1768
88 Ga0157369_10115279 3300013105 Bacteria 2853
89 Ga0157369_10151897 3300013105 Bacteria 2447
90 Ga0157369_10369226 3300013105 Bacteria 1489
91 Ga0157369_10588254 3300013105 Bacteria 1149
92 Ga0157369_10608841 3300013105 Bacteria 1127
93 Ga0157374_10210782 3300013296 Bacteria 1905
94 Ga0157374_10772280 3300013296 Bacteria 976
95 Ga0157374_11342021 3300013296 Bacteria 737
96 Ga0157378_10699874 3300013297 Bacteria 1033
97 Ga0157372_10061563 3300013307 Bacteria 4203
98 Ga0157372_10099652 3300013307 Bacteria 3314
99 Ga0157372_10105171 3300013307 Bacteria 3228
100 Ga0157372_10149727 3300013307 Bacteria 2693
101 Ga0157372_10452022 3300013307 Bacteria 1497
102 Ga0182008_10085444 3300014497 Bacteria 1554
103 Ga0182007_10197546 3300015262 Bacteria 702
104 Ga0206356_10029089 3300020070 Bacteria 1124
105 Ga0206356_11100878 3300020070 Bacteria 989
106 Ga0206354_10161312 3300020081 Bacteria 1754
107 Ga0206354_10735522 3300020081 Bacteria 1760
108 Ga0206354_11261316 3300020081 Bacteria 1282
109 Ga0206353_10091504 3300020082 Bacteria 1472
110 Ga0206353_10690890 3300020082 Bacteria 1713
111 Ga0206353_11628855 3300020082 Bacteria 755
112 Ga0224712_10118492 3300022467 Bacteria 1144
113 Ga0207705_10429279 3300025909 Bacteria 1024
114 Ga0207707_10008162 3300025912 Bacteria 9085
115 Ga0207707_10011086 3300025912 Bacteria 7838
116 Ga0207707_10142045 3300025912 Bacteria 2099
117 Ga0207707_10173748 3300025912 Bacteria 1882
118 Ga0207707_10429771 3300025912 Bacteria 1131
119 Ga0207707_10465994 3300025912 Bacteria 1080
120 Ga0207707_10706612 3300025912 Bacteria 846
121 Ga0207695_10152514 3300025913 Bacteria 2249
122 Ga0207695_10756648 3300025913 Bacteria 852
123 Ga0207671_10931152 3300025914 Bacteria 686
124 Ga0207660_10008664 3300025917 Bacteria 6579
125 Ga0207660_10030805 3300025917 Bacteria 3689
126 Ga0207660_10098570 3300025917 Bacteria 2180
127 Ga0207660_10871451 3300025917 Bacteria 735
128 Ga0207657_10000184 3300025919 Bacteria 64813
129 Ga0207657_10008652 3300025919 Bacteria 10304
130 Ga0207657_10083693 3300025919 Bacteria 2676
131 Ga0207649_10032749 3300025920 Bacteria 3101
132 Ga0207649_10303908 3300025920 Bacteria 1167
133 Ga0207649_10352504 3300025920 Bacteria 1090
134 Ga0207649_10705604 3300025920 Unclassified 783
135 Ga0207652_10054027 3300025921 Bacteria 3452
136 Ga0207652_10098640 3300025921 Bacteria 2577
137 Ga0207652_10104814 3300025921 Bacteria 2501
138 Ga0207652_10138330 3300025921 Bacteria 2176
139 Ga0207652_10191374 3300025921 Bacteria 1840
140 Ga0207652_10192901 3300025921 Bacteria 1832
141 Ga0207652_10530635 3300025921 Bacteria 1059
142 Ga0207646_10002829 3300025922 Bacteria 20189
143 Ga0207694_10080063 3300025924 Bacteria 2563
144 Ga0207694_10226988 3300025924 Bacteria 1524
145 Ga0207694_10284384 3300025924 Bacteria 1359
146 Ga0207664_10260527 3300025929 Bacteria 1516
147 Ga0207664_11072061 3300025929 Bacteria 721
148 Ga0207690_10056755 3300025932 Bacteria 2643
149 Ga0207690_10170256 3300025932 Bacteria 1631
150 Ga0207686_10253626 3300025934 Bacteria 1286
151 Ga0207665_10578546 3300025939 Unclassified 875
152 Ga0207661_10079486 3300025944 Bacteria 2703
153 Ga0207661_10495493 3300025944 Bacteria 1116
154 Ga0207661_10965147 3300025944 Bacteria 785
155 Ga0207679_10551577 3300025945 Bacteria 1034
156 Ga0207667_10049673 3300025949 Bacteria 4429
157 Ga0207667_10172454 3300025949 Bacteria 2223
158 Ga0207639_10080236 3300026041 Bacteria 2581
159 Ga0207639_10178652 3300026041 Bacteria 1804
160 Ga0207639_10200070 3300026041 Bacteria 1713
161 Ga0207678_10193467 3300026067 Bacteria 1739
162 Ga0207678_10266646 3300026067 Bacteria 1468
163 Ga0207678_11316427 3300026067 Bacteria 639
164 Ga0207648_10544867 3300026089 Bacteria 1065
165 Ga0207674_10004486 3300026116 Bacteria 16777
166 Ga0207674_10067521 3300026116 Bacteria 3600
167 Ga0207683_10104036 3300026121 Bacteria 2537
168 Ga0207683_10985896 3300026121 Bacteria 782
169 Ga0207698_10168135 3300026142 Bacteria 1927
170 Ga0207698_10319476 3300026142 Bacteria 1453
171 Ga0207698_10789098 3300026142 Bacteria 951
172 Ga0207428_10493258 3300027907 Bacteria 890
173 Ga0268266_10333480 3300028379 Bacteria 1422
174 Ga0265334_10140415 3300028573 Bacteria 856
175 Ga0265318_10268167 3300028577 Bacteria 623
176 Ga0265322_10018435 3300028654 Bacteria 2007
177 Ga0265338_10030628 3300028800 Bacteria 5294
178 Ga0265338_10160711 3300028800 Bacteria 1735
179 Ga0265330_10011816 3300031235 Bacteria 4090
180 Ga0265330_10033509 3300031235 Bacteria 2297
181 Ga0265325_10030497 3300031241 Bacteria 2891
182 Ga0265329_10048660 3300031242 Bacteria 1352
183 Ga0265340_10042745 3300031247 Bacteria 2223
184 Ga0265339_10145154 3300031249 Bacteria 1204
185 Ga0265331_10186819 3300031250 Bacteria 935
186 Ga0265327_10021575 3300031251 Bacteria 3882
187 Ga0265316_10075108 3300031344 Bacteria 2599
188 Ga0265316_10194160 3300031344 Bacteria 1507
189 Ga0265316_10220610 3300031344 Bacteria 1399
190 Ga0265314_10012772 3300031711 Bacteria 6827
191 Ga0265314_10110357 3300031711 Bacteria 1749
192 Ga0265342_10039693 3300031712 Bacteria 2858
193 Ga0395899_0013347 3300037312 Bacteria 6283
194 Ga0395899_0057667 3300037312 Bacteria 2866
195 Ga0395899_0132336 3300037312 Bacteria 1780
196 Ga0395899_0253340 3300037312 Bacteria 1207
197 Ga0395900_0007921 3300037418 Bacteria 10937
198 Ga0395900_0024530 3300037418 Bacteria 6175
199 Ga0395900_0032264 3300037418 Bacteria 5385
200 Ga0395900_0078013 3300037418 Bacteria 3403
201 Ga0395900_0133521 3300037418 Bacteria 2543
202 Ga0395900_0141337 3300037418 Bacteria 2465
203 Ga0395900_0368698 3300037418 Bacteria 1406
204 Ga0395900_0598892 3300037418 Bacteria 1043
205 Ga0395898_0002551 3300037466 Bacteria 21372
206 Ga0395898_0002654 3300037466 Bacteria 20795
207 Ga0395898_0005087 3300037466 Bacteria 14250
208 Ga0395898_0086038 3300037466 Bacteria 3030
209 Ga0395898_0121398 3300037466 Bacteria 2504
210 Ga0395898_0429437 3300037466 Bacteria 1259
211 Ga0395898_0506039 3300037466 Bacteria 1149
212 Ga0395898_0604704 3300037466 Bacteria 1039
213 Ga0395898_1403052 3300037466 Bacteria 626
214 Ga0395905_0002417 3300037471 Bacteria 20726
215 Ga0395905_0041992 3300037471 Bacteria 4291
216 Ga0395905_0088892 3300037471 Bacteria 2895
217 Ga0395905_0150839 3300037471 Bacteria 2187
218 Ga0395905_0927928 3300037471 Bacteria 773
219 Ga0395905_1030610 3300037471 Bacteria 726
220 Ga0395905_1279020 3300037471 Bacteria 637
221 Ga0395901_0007364 3300038443 Bacteria 11106
222 Ga0395901_0027026 3300038443 Bacteria 5894
223 Ga0395901_0036588 3300038443 Bacteria 5074
224 Ga0395901_0091335 3300038443 Bacteria 3187
225 Ga0395901_0092425 3300038443 Bacteria 3167
226 Ga0395901_0303149 3300038443 Bacteria 1656
227 Ga0395901_0658841 3300038443 Bacteria 1049
228 Ga0395901_0871430 3300038443 Bacteria 884
229 Ga0395901_1117653 3300038443 Bacteria 758
230 Ga0436360_1128404 3300039438 Bacteria 755
231 Ga0439448_0367800 3300042005 Unclassified 513
232 Ga0466961_0024469 3300044693 Bacteria 3884
233 Ga0466961_0040459 3300044693 Bacteria 2989
234 Ga0466963_0026244 3300044694 Bacteria 3724
235 Ga0466964_0002151 3300044706 Bacteria 6954
236 Ga0466964_0194485 3300044706 Bacteria 970
237 Ga0466968_0056607 3300044735 Bacteria 1684
238 Ga0466970_0130181 3300044765 Bacteria 1382
239 Ga0466957_0053997 3300044842 Bacteria 2451
240 Ga0466959_0080264 3300045049 Bacteria 2352
241 Ga0466959_0116947 3300045049 Bacteria 1898
242 Ga0466967_0003064 3300045976 Bacteria 10730
243 Ga0466967_0106763 3300045976 Bacteria 2567
244 Ga0466967_0159264 3300045976 Bacteria 2117
245 Ga0466967_0256828 3300045976 Bacteria 1671
246 Ga0466967_0796913 3300045976 Bacteria 938
247 Ga0466967_1072703 3300045976 Bacteria 802
248 Ga0466967_2204307 3300045976 Bacteria 547
249 Ga0495603_0516337 3300046455 Bacteria 684
250 Ga0495594_0263895 3300046499 Bacteria 981
251 Ga0496100_0244273 3300048903 Bacteria 1326
252 Ga0496100_0364259 3300048903 Bacteria 1094
253 Ga0496101_0018529 3300048904 Bacteria 4736
254 Ga0496101_1088871 3300048904 Bacteria 627
255 Ga0496102_0292230 3300048905 Bacteria 1536
256 Ga0496103_0111136 3300048906 Bacteria 1741
257 Ga0496104_0007265 3300048907 Bacteria 9776
258 Ga0496105_0233970 3300048908 Bacteria 1492
259 Ga0496106_0037002 3300048909 Bacteria 3650
260 Ga0496107_0024030 3300048910 Bacteria 4308
261 Ga0496108_0040100 3300048911 Bacteria 3902
262 Ga0496109_0002305 3300048912 Bacteria 15886
263 Ga0496110_0101267 3300048913 Bacteria 2582
264 Ga0496111_0019285 3300048914 Bacteria 4735
265 Ga0496112_0008237 3300048915 Bacteria 9326
266 Ga0496113_0004352 3300048916 Bacteria 8681
267 Ga0496114_0032308 3300048917 Bacteria 4306
268 Ga0496114_0505255 3300048917 Bacteria 1069
269 Ga0501036_0415430 3300049572 Bacteria 1122
270 Ga0501042_0180510 3300049578 Bacteria 1523
271 Ga0501043_0289223 3300049579 Bacteria 1255
272 Ga0501046_0590428 3300049580 Bacteria 789
273 Ga0501047_0118507 3300049581 Bacteria 2529
274 Ga0501048_0894606 3300049582 Unclassified 638
275 Ga0501067_0001419 3300049583 Bacteria 12995
276 Ga0501067_0024953 3300049583 Bacteria 3315
277 Ga0501068_0144615 3300049584 Bacteria 1492
278 Ga0501069_0002078 3300049585 Bacteria 10076
279 Ga0501069_0387697 3300049585 Bacteria 826
280 Ga0501071_1116478 3300049587 Unclassified 609
281 Ga0501072_0249409 3300049588 Bacteria 1414
282 Ga0501073_0173474 3300049589 Bacteria 1493
283 Ga0501074_0105279 3300049590 Bacteria 2019
284 Ga0501074_0151008 3300049590 Bacteria 1661
285 Ga0501077_0406411 3300049593 Bacteria 871
286 Ga0501079_0138444 3300049741 Bacteria 1896
287 Ga0501080_0124942 3300049742 Bacteria 2383
288 Ga0501080_0136498 3300049742 Bacteria 2270
289 Ga0501080_0685747 3300049742 Bacteria 904
290 Ga0501035_0709464 3300049822 Bacteria 811
291 Ga0501044_0589998 3300049823 Bacteria 1005
292 nmdc:mga0yw44_18564_c1 3300050492 Bacteria 3813
293 nmdc:mga05p37_365487_c1 3300050507 Bacteria 1695
294 nmdc:mga08y16_277717_c1 3300050511 Bacteria 1728
295 nmdc:mga0n895_183880_c1 3300050512 Bacteria 2122
296 Ga0501084_0226154 3300054114 Bacteria 1579
297 Ga0501084_0303491 3300054114 Bacteria 1349
298 Ga0501084_1289379 3300054114 Bacteria 612
299 Ga0501082_0452824 3300060353 Bacteria 1121
300 Ga0466962_0094211 3300061719 Bacteria 1436
301 Ga0530510_0083901 3300061734 Bacteria 2320
302 Ga0070680_101776005
303 Ga0070658_10800361
304 Ga0070683_100056020
305 Ga0070683_100653296
306 Ga0070680_100010146
307 Ga0070680_100050066
308 Ga0070680_100602549
309 Ga0070680_100686797
310 Ga0070682_100160291
311 Ga0070682_100338482
312 Ga0070682_100479716
313 Ga0070682_100705276
314 Ga0070682_100794030
315 Ga0070660_100140173
316 Ga0070660_101188092
317 Ga0070661_100016727
318 Ga0070661_100023202
319 Ga0070661_100089934
320 Ga0070661_100353291
321 Ga0070661_100929790
322 Ga0070659_100011375
323 Ga0070659_100333036
324 Ga0070714_100074808
325 Ga0070714_100273863
326 Ga0070714_100904482
327 Ga0070710_10653806
328 Ga0070663_100271799
329 Ga0070678_100012715
330 Ga0070678_101025565
331 Ga0070662_100341677
332 Ga0070681_10024040
333 Ga0070681_10080902
334 Ga0070681_10121728
335 Ga0070681_10210667
336 Ga0070681_10293460
337 Ga0070707_100011670
338 Ga0070679_100013554
339 Ga0070679_100050841
340 Ga0070679_100113810
341 Ga0070679_100223375
342 Ga0070679_100402329
343 Ga0070679_100586966
344 Ga0070684_100147947
345 Ga0070684_100246758
346 Ga0070684_100278715
347 Ga0068853_100109153
348 Ga0068853_100225745
349 Ga0068853_100367896
350 Ga0068853_101005097
351 Ga0068855_100079815
352 Ga0068855_100219641
353 Ga0068855_100242889
354 Ga0068855_100565525
355 Ga0068857_100025657
356 Ga0068857_100191375
357 Ga0068857_100196350
358 Ga0068856_100224566
359 Ga0068856_100504035
360 Ga0068852_100013329
361 Ga0068852_100194059
362 Ga0068852_100248688
363 Ga0068852_100796343
364 Ga0075365_10025251
365 Ga0070716_101622226
366 Ga0075367_10451123
367 Ga0075434_101846147
368 Ga0105240_10028335
369 Ga0105240_10472707
370 Ga0105240_10802223
371 Ga0105240_11453350
372 Ga0111539_10324939
373 Ga0111539_11021324
374 Ga0105241_10499129
375 Ga0105242_10379608
376 Ga0105242_11606777
377 Ga0105237_10023365
378 Ga0105237_10048550
379 Ga0105237_10158528
380 Ga0105238_10028595
381 Ga0105238_10033167
382 Ga0105238_10691497
383 Ga0105239_10361810
384 Ga0157370_10053383
385 Ga0157370_10063750
386 Ga0157370_10174297
387 Ga0157370_10192939
388 Ga0157370_10217985
389 Ga0157369_10115279
390 Ga0157369_10151897
391 Ga0157369_10369226
392 Ga0157369_10588254
393 Ga0157369_10608841
394 Ga0157374_10210782
395 Ga0157374_10772280
396 Ga0157374_11342021
397 Ga0157378_10699874
398 Ga0157372_10061563
399 Ga0157372_10099652
400 Ga0157372_10105171
401 Ga0157372_10149727
402 Ga0157372_10452022
403 Ga0182008_10085444
404 Ga0182007_10197546
405 Ga0206356_10029089
406 Ga0206356_11100878
407 Ga0206354_10161312
408 Ga0206354_10735522
409 Ga0206354_11261316
410 Ga0206353_10091504
411 Ga0206353_10690890
412 Ga0206353_11628855
413 Ga0224712_10118492
414 Ga0207705_10429279
415 Ga0207707_10008162
416 Ga0207707_10011086
417 Ga0207707_10142045
418 Ga0207707_10173748
419 Ga0207707_10429771
420 Ga0207707_10465994
421 Ga0207707_10706612
422 Ga0207695_10152514
423 Ga0207695_10756648
424 Ga0207671_10931152
425 Ga0207660_10008664
426 Ga0207660_10030805
427 Ga0207660_10098570
428 Ga0207660_10871451
429 Ga0207657_10000184
430 Ga0207657_10008652
431 Ga0207657_10083693
432 Ga0207649_10032749
433 Ga0207649_10303908
434 Ga0207649_10352504
435 Ga0207649_10705604
436 Ga0207652_10054027
437 Ga0207652_10098640
438 Ga0207652_10104814
439 Ga0207652_10138330
440 Ga0207652_10191374
441 Ga0207652_10192901
442 Ga0207652_10530635
443 Ga0207646_10002829
444 Ga0207694_10080063
445 Ga0207694_10226988
446 Ga0207694_10284384
447 Ga0207664_10260527
448 Ga0207664_11072061
449 Ga0207690_10056755
450 Ga0207690_10170256
451 Ga0207686_10253626
452 Ga0207665_10578546
453 Ga0207661_10079486
454 Ga0207661_10495493
455 Ga0207661_10965147
456 Ga0207679_10551577
457 Ga0207667_10049673
458 Ga0207667_10172454
459 Ga0207639_10080236
460 Ga0207639_10178652
461 Ga0207639_10200070
462 Ga0207678_10193467
463 Ga0207678_10266646
464 Ga0207678_11316427
465 Ga0207648_10544867
466 Ga0207674_10004486
467 Ga0207674_10067521
468 Ga0207683_10104036
469 Ga0207683_10985896
470 Ga0207698_10168135
471 Ga0207698_10319476
472 Ga0207698_10789098
473 Ga0207428_10493258
474 Ga0268266_10333480
475 Ga0265334_10140415
476 Ga0265318_10268167
477 Ga0265322_10018435
478 Ga0265338_10030628
479 Ga0265338_10160711
480 Ga0265330_10011816
481 Ga0265330_10033509
482 Ga0265325_10030497
483 Ga0265329_10048660
484 Ga0265340_10042745
485 Ga0265339_10145154
486 Ga0265331_10186819
487 Ga0265327_10021575
488 Ga0265316_10075108
489 Ga0265316_10194160
490 Ga0265316_10220610
491 Ga0265314_10012772
492 Ga0265314_10110357
493 Ga0265342_10039693
494 Ga0395899_0013347
495 Ga0395899_0057667
496 Ga0395899_0132336
497 Ga0395899_0253340
498 Ga0395900_0007921
499 Ga0395900_0024530
500 Ga0395900_0032264
501 Ga0395900_0078013
502 Ga0395900_0133521
503 Ga0395900_0141337
504 Ga0395900_0368698
505 Ga0395900_0598892
506 Ga0395898_0002551
507 Ga0395898_0002654
508 Ga0395898_0005087
509 Ga0395898_0086038
510 Ga0395898_0121398
511 Ga0395898_0429437
512 Ga0395898_0506039
513 Ga0395898_0604704
514 Ga0395898_1403052
515 Ga0395905_0002417
516 Ga0395905_0041992
517 Ga0395905_0088892
518 Ga0395905_0150839
519 Ga0395905_0927928
520 Ga0395905_1030610
521 Ga0395905_1279020
522 Ga0395901_0007364
523 Ga0395901_0027026
524 Ga0395901_0036588
525 Ga0395901_0091335
526 Ga0395901_0092425
527 Ga0395901_0303149
528 Ga0395901_0658841
529 Ga0395901_0871430
530 Ga0395901_1117653
531 Ga0436360_1128404
532 Ga0439448_0367800
533 Ga0466961_0024469
534 Ga0466961_0040459
535 Ga0466963_0026244
536 Ga0466964_0002151
537 Ga0466964_0194485
538 Ga0466968_0056607
539 Ga0466970_0130181
540 Ga0466957_0053997
541 Ga0466959_0080264
542 Ga0466959_0116947
543 Ga0466967_0003064
544 Ga0466967_0106763
545 Ga0466967_0159264
546 Ga0466967_0256828
547 Ga0466967_0796913
548 Ga0466967_1072703
549 Ga0466967_2204307
550 Ga0495603_0516337
551 Ga0495594_0263895
552 Ga0496100_0244273
553 Ga0496100_0364259
554 Ga0496101_0018529
555 Ga0496101_1088871
556 Ga0496102_0292230
557 Ga0496103_0111136
558 Ga0496104_0007265
559 Ga0496105_0233970
560 Ga0496106_0037002
561 Ga0496107_0024030
562 Ga0496108_0040100
563 Ga0496109_0002305
564 Ga0496110_0101267
565 Ga0496111_0019285
566 Ga0496112_0008237
567 Ga0496113_0004352
568 Ga0496114_0032308
569 Ga0496114_0505255
570 Ga0501036_0415430
571 Ga0501042_0180510
572 Ga0501043_0289223
573 Ga0501046_0590428
574 Ga0501047_0118507
575 Ga0501048_0894606
576 Ga0501067_0001419
577 Ga0501067_0024953
578 Ga0501068_0144615
579 Ga0501069_0002078
580 Ga0501069_0387697
581 Ga0501071_1116478
582 Ga0501072_0249409
583 Ga0501073_0173474
584 Ga0501074_0105279
585 Ga0501074_0151008
586 Ga0501077_0406411
587 Ga0501079_0138444
588 Ga0501080_0124942
589 Ga0501080_0136498
590 Ga0501080_0685747
591 Ga0501035_0709464
592 Ga0501044_0589998
593 nmdc:mga0yw44_18564_c1
594 nmdc:mga05p37_365487_c1
595 nmdc:mga08y16_277717_c1
596 nmdc:mga0n895_183880_c1
597 Ga0501084_0226154
598 Ga0501084_0303491
599 Ga0501084_1289379
600 Ga0501082_0452824
601 Ga0466962_0094211
602 Ga0530510_0083901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

13

86

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.879 1 127
1ujc-assembly1.cif.gz_A structure of the protein histidine phosphatase sixa complexed with tungstate 0.8727 1 127
2rfl-assembly1.cif.gz_A crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.848 2 127
2rfl-assembly2.cif.gz_B crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8457 2 126
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8429 2 126
ID Description Score Start End Superfamily
af_A4I982_190_490_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8946 3 63 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8737 1 127 3.40.50.1240
1ujbA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8675 1 127 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.867 2 124 3.40.50.1240
af_O44899_1_131_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8625 6 74 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A7W0WBF6-F1-model_v4 Histidine phosphatase family protein 0.9895 6 86
AF-A0A538G9M5-F1-model_v4 Phosphohistidine phosphatase SixA 0.9819 1 125 GO:0005737
GO:0036211
GO:0101006
AF-A0A7V9UXZ1-F1-model_v4 Histidine phosphatase family protein 0.9618 1 127
AF-A0A538G9M5-F1-model_v4 Phosphohistidine phosphatase SixA 0.9592 1 125 GO:0005737
GO:0036211
GO:0101006
AF-A0A7V9UXZ1-F1-model_v4 Histidine phosphatase family protein 0.9545 1 127

Map