F395554
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 213 | 299 | 360 |
Family's Representative Sequence
| Representative Sequence | 3300047322|Ga0495680_0091980|Ga0495680_0091980_419_1633 |
| Length | 404 |
| Sequence | MAALPAGTPERADPAADAAEVRTYYRCRPRLTGLACEFNPVQAKEQAMAETMKAAVFEGHERIVLEEKPMPRCGPTDAIVKISLTTICGTDVHIWREEYPVEQGRIVGHEPVGTIHQLGDAVSGYEVGERVLVGAITPCGSCFYCQSHNEAQCSGHEDDWQMIGAWRLGNAIDGVQAEYFRVPYAQANLAKIPDDLSDEQCVLLADIASTGISAAETANVRIGQTVAVFAQGPIGLCATAGARLMGASLVIGVDRIAGRLELSKKMGADETIDFSEEDPIAAIKRLTGGRGVDVAIEALGTQQTFEACIEATRPGGIVSSLGVYGGKLEIPLEPFVYGIGDKQILTTLCPGGKERMRKLMEMVRHGRLDLSPLITHRFSLDQIEEAYDLFGNQREGVVKVGLTP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 51 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 52 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 129 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 130 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 132 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 135 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 137 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 138 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 143 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 144 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 145 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 184 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 185 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 186 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 187 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 188 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 191 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 202 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 203 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 204 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 205 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 206 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 209 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 210 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 211 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 212 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 1.33 |
| Isolates | 0.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.67 |
| Nodule | 0 |
| Rhizoplane | 4.33 |
| Rhizosphere | 88.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10072575 | 3300005290 | Bacteria | 4697 |
| 2 | Ga0065715_10254987 | 3300005293 | Bacteria | 1155 |
| 3 | Ga0065707_10088740 | 3300005295 | Bacteria | 4566 |
| 4 | Ga0070658_10244068 | 3300005327 | Bacteria | 1523 |
| 5 | Ga0070683_100006874 | 3300005329 | Bacteria | 9558 |
| 6 | Ga0070683_100060964 | 3300005329 | Bacteria | 3507 |
| 7 | Ga0070683_100079674 | 3300005329 | Bacteria | 3065 |
| 8 | Ga0070683_100082982 | 3300005329 | Bacteria | 3002 |
| 9 | Ga0070666_10035193 | 3300005335 | Bacteria | 3321 |
| 10 | Ga0070680_100018183 | 3300005336 | Bacteria | 5552 |
| 11 | Ga0070680_100074800 | 3300005336 | Bacteria | 2788 |
| 12 | Ga0070680_100288434 | 3300005336 | Unclassified | 1391 |
| 13 | Ga0070682_100025360 | 3300005337 | Bacteria | 3537 |
| 14 | Ga0068868_100000261 | 3300005338 | Bacteria | 35848 |
| 15 | Ga0070660_100005747 | 3300005339 | Bacteria | 8595 |
| 16 | Ga0070689_100056352 | 3300005340 | Bacteria | 3047 |
| 17 | Ga0070661_100058205 | 3300005344 | Bacteria | 2832 |
| 18 | Ga0070692_10000217 | 3300005345 | Bacteria | 15706 |
| 19 | Ga0070668_100310526 | 3300005347 | Bacteria | 1325 |
| 20 | Ga0070675_100035114 | 3300005354 | Bacteria | 4073 |
| 21 | Ga0070674_100000022 | 3300005356 | Bacteria | 85839 |
| 22 | Ga0070674_100059029 | 3300005356 | Bacteria | 2669 |
| 23 | Ga0070659_100002827 | 3300005366 | Bacteria | 12358 |
| 24 | Ga0070667_100136647 | 3300005367 | Bacteria | 2144 |
| 25 | Ga0070709_10031278 | 3300005434 | Unclassified | 3201 |
| 26 | Ga0070714_100000718 | 3300005435 | Bacteria | 23489 |
| 27 | Ga0070711_100106010 | 3300005439 | Bacteria | 2054 |
| 28 | Ga0070700_100051051 | 3300005441 | Bacteria | 2573 |
| 29 | Ga0070708_100050109 | 3300005445 | Bacteria | 3696 |
| 30 | Ga0070663_100235584 | 3300005455 | Bacteria | 1443 |
| 31 | Ga0070678_100107622 | 3300005456 | Bacteria | 2175 |
| 32 | Ga0070662_100000007 | 3300005457 | Bacteria | 168761 |
| 33 | Ga0070681_10037978 | 3300005458 | Bacteria | 4829 |
| 34 | Ga0070681_10193178 | 3300005458 | Bacteria | 1955 |
| 35 | Ga0068867_100000294 | 3300005459 | Bacteria | 32742 |
| 36 | Ga0070685_10087904 | 3300005466 | Bacteria | 1876 |
| 37 | Ga0070706_100187602 | 3300005467 | Bacteria | 1932 |
| 38 | Ga0070707_100000279 | 3300005468 | Bacteria | 50375 |
| 39 | Ga0070707_100006621 | 3300005468 | Bacteria | 10741 |
| 40 | Ga0070698_100423933 | 3300005471 | Bacteria | 1265 |
| 41 | Ga0070679_100082041 | 3300005530 | Bacteria | 3214 |
| 42 | Ga0070684_100006068 | 3300005535 | Bacteria | 9311 |
| 43 | Ga0070684_100060478 | 3300005535 | Bacteria | 3314 |
| 44 | Ga0070697_100065081 | 3300005536 | Bacteria | 2978 |
| 45 | Ga0070672_100283659 | 3300005543 | Bacteria | 1401 |
| 46 | Ga0070686_100183118 | 3300005544 | Bacteria | 1490 |
| 47 | Ga0070665_100017074 | 3300005548 | Bacteria | 7280 |
| 48 | Ga0070664_100000212 | 3300005564 | Bacteria | 41477 |
| 49 | Ga0068857_100019714 | 3300005577 | Bacteria | 5924 |
| 50 | Ga0068857_100021641 | 3300005577 | Bacteria | 5658 |
| 51 | Ga0068857_100096799 | 3300005577 | Bacteria | 2645 |
| 52 | Ga0068854_100089554 | 3300005578 | Bacteria | 2287 |
| 53 | Ga0068852_100019083 | 3300005616 | Bacteria | 5418 |
| 54 | Ga0068852_100200864 | 3300005616 | Bacteria | 1887 |
| 55 | Ga0068859_100337179 | 3300005617 | Bacteria | 1602 |
| 56 | Ga0068864_100024222 | 3300005618 | Bacteria | 5104 |
| 57 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 58 | Ga0068866_10016114 | 3300005718 | Bacteria | 3335 |
| 59 | Ga0068861_100303578 | 3300005719 | Bacteria | 1384 |
| 60 | Ga0068860_100009109 | 3300005843 | Bacteria | 9878 |
| 61 | Ga0068860_100450162 | 3300005843 | Bacteria | 1280 |
| 62 | Ga0070717_10000001 | 3300006028 | Bacteria | 465573 |
| 63 | Ga0075365_10002019 | 3300006038 | Bacteria | 9633 |
| 64 | Ga0075368_10041303 | 3300006042 | Bacteria | 1812 |
| 65 | Ga0075363_100010141 | 3300006048 | Bacteria | 4456 |
| 66 | Ga0075363_100052826 | 3300006048 | Bacteria | 2170 |
| 67 | Ga0075363_100080993 | 3300006048 | Bacteria | 1776 |
| 68 | Ga0075364_10039225 | 3300006051 | Bacteria | 3070 |
| 69 | Ga0075364_10093675 | 3300006051 | Bacteria | 1995 |
| 70 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 71 | Ga0070712_100000004 | 3300006175 | Bacteria | 215464 |
| 72 | Ga0075366_10030848 | 3300006195 | Bacteria | 3153 |
| 73 | Ga0075366_10075472 | 3300006195 | Bacteria | 2011 |
| 74 | Ga0068871_100109186 | 3300006358 | Bacteria | 2326 |
| 75 | Ga0075430_100324783 | 3300006846 | Bacteria | 1272 |
| 76 | Ga0075431_100078376 | 3300006847 | Bacteria | 3410 |
| 77 | Ga0068865_100013974 | 3300006881 | Bacteria | 5094 |
| 78 | Ga0068865_100278486 | 3300006881 | Bacteria | 1331 |
| 79 | Ga0097620_100337156 | 3300006931 | Bacteria | 1602 |
| 80 | Ga0075435_100125565 | 3300007076 | Unclassified | 2144 |
| 81 | Ga0105240_10147641 | 3300009093 | Bacteria | 2804 |
| 82 | Ga0111539_10001108 | 3300009094 | Bacteria | 35534 |
| 83 | Ga0111539_10026563 | 3300009094 | Bacteria | 7078 |
| 84 | Ga0111539_10041347 | 3300009094 | Bacteria | 5542 |
| 85 | Ga0111539_10045356 | 3300009094 | Bacteria | 5263 |
| 86 | Ga0111539_10080696 | 3300009094 | Bacteria | 3827 |
| 87 | Ga0105245_10052262 | 3300009098 | Bacteria | 3665 |
| 88 | Ga0105245_10089487 | 3300009098 | Bacteria | 2830 |
| 89 | Ga0105245_10205272 | 3300009098 | Bacteria | 1894 |
| 90 | Ga0114129_10353368 | 3300009147 | Bacteria | 1946 |
| 91 | Ga0114129_10757513 | 3300009147 | Bacteria | 1242 |
| 92 | Ga0105243_10006962 | 3300009148 | Bacteria | 8708 |
| 93 | Ga0105243_10229569 | 3300009148 | Bacteria | 1646 |
| 94 | Ga0105248_10019118 | 3300009177 | Bacteria | 7577 |
| 95 | Ga0105238_10000023 | 3300009551 | Bacteria | 196844 |
| 96 | Ga0105249_10143979 | 3300009553 | Bacteria | 2288 |
| 97 | Ga0105249_10391184 | 3300009553 | Bacteria | 1418 |
| 98 | Ga0105246_10043147 | 3300011119 | Bacteria | 3059 |
| 99 | Ga0157370_10030658 | 3300013104 | Bacteria | 5267 |
| 100 | Ga0157369_10047965 | 3300013105 | Bacteria | 4635 |
| 101 | Ga0157374_10003390 | 3300013296 | Bacteria | 13395 |
| 102 | Ga0157378_10319166 | 3300013297 | Bacteria | 1509 |
| 103 | Ga0157372_10019761 | 3300013307 | Bacteria | 7259 |
| 104 | Ga0157372_10078530 | 3300013307 | Bacteria | 3729 |
| 105 | Ga0157375_10000109 | 3300013308 | Bacteria | 80349 |
| 106 | Ga0157375_10024471 | 3300013308 | Bacteria | 5589 |
| 107 | Ga0163163_10031779 | 3300014325 | Bacteria | 5097 |
| 108 | Ga0157380_10002532 | 3300014326 | Bacteria | 12336 |
| 109 | Ga0157380_10053738 | 3300014326 | Bacteria | 3194 |
| 110 | Ga0157379_10059498 | 3300014968 | Bacteria | 3416 |
| 111 | Ga0157376_10174321 | 3300014969 | Bacteria | 1961 |
| 112 | Ga0182007_10007147 | 3300015262 | Bacteria | 4714 |
| 113 | Ga0206356_10484574 | 3300020070 | Bacteria | 3080 |
| 114 | Ga0206354_10168787 | 3300020081 | Bacteria | 2029 |
| 115 | Ga0206353_11743768 | 3300020082 | Bacteria | 4090 |
| 116 | Ga0207656_10052821 | 3300025321 | Bacteria | 1761 |
| 117 | Ga0207642_10000006 | 3300025899 | Bacteria | 230268 |
| 118 | Ga0207642_10000007 | 3300025899 | Bacteria | 226017 |
| 119 | Ga0207688_10004963 | 3300025901 | Bacteria | 7242 |
| 120 | Ga0207688_10028335 | 3300025901 | Bacteria | 3081 |
| 121 | Ga0207688_10070162 | 3300025901 | Bacteria | 1987 |
| 122 | Ga0207685_10000011 | 3300025905 | Bacteria | 213430 |
| 123 | Ga0207699_10077814 | 3300025906 | Bacteria | 2048 |
| 124 | Ga0207705_10038175 | 3300025909 | Bacteria | 3438 |
| 125 | Ga0207705_10148505 | 3300025909 | Bacteria | 1755 |
| 126 | Ga0207707_10039267 | 3300025912 | Bacteria | 4138 |
| 127 | Ga0207671_10060710 | 3300025914 | Bacteria | 2805 |
| 128 | Ga0207693_10000105 | 3300025915 | Bacteria | 75790 |
| 129 | Ga0207663_10011729 | 3300025916 | Bacteria | 4716 |
| 130 | Ga0207660_10033578 | 3300025917 | Bacteria | 3550 |
| 131 | Ga0207662_10092715 | 3300025918 | Bacteria | 1860 |
| 132 | Ga0207657_10005323 | 3300025919 | Bacteria | 13486 |
| 133 | Ga0207657_10008992 | 3300025919 | Bacteria | 10088 |
| 134 | Ga0207649_10032191 | 3300025920 | Bacteria | 3124 |
| 135 | Ga0207649_10033825 | 3300025920 | Bacteria | 3057 |
| 136 | Ga0207652_10029714 | 3300025921 | Bacteria | 4572 |
| 137 | Ga0207652_10197045 | 3300025921 | Bacteria | 1812 |
| 138 | Ga0207646_10000514 | 3300025922 | Bacteria | 51603 |
| 139 | Ga0207646_10004542 | 3300025922 | Bacteria | 15022 |
| 140 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 141 | Ga0207659_10071938 | 3300025926 | Bacteria | 2527 |
| 142 | Ga0207659_10079501 | 3300025926 | Bacteria | 2419 |
| 143 | Ga0207664_10024189 | 3300025929 | Bacteria | 4563 |
| 144 | Ga0207690_10006046 | 3300025932 | Bacteria | 7170 |
| 145 | Ga0207690_10014162 | 3300025932 | Bacteria | 4811 |
| 146 | Ga0207690_10031577 | 3300025932 | Bacteria | 3391 |
| 147 | Ga0207706_10000018 | 3300025933 | Bacteria | 168729 |
| 148 | Ga0207706_10002258 | 3300025933 | Bacteria | 18812 |
| 149 | Ga0207706_10235230 | 3300025933 | Bacteria | 1602 |
| 150 | Ga0207706_10360603 | 3300025933 | Bacteria | 1263 |
| 151 | Ga0207709_10002964 | 3300025935 | Bacteria | 10343 |
| 152 | Ga0207669_10000009 | 3300025937 | Bacteria | 168012 |
| 153 | Ga0207669_10003812 | 3300025937 | Bacteria | 6567 |
| 154 | Ga0207704_10064930 | 3300025938 | Bacteria | 2283 |
| 155 | Ga0207691_10030536 | 3300025940 | Bacteria | 5035 |
| 156 | Ga0207689_10126979 | 3300025942 | Bacteria | 2098 |
| 157 | Ga0207689_10151922 | 3300025942 | Bacteria | 1909 |
| 158 | Ga0207661_10002951 | 3300025944 | Bacteria | 11761 |
| 159 | Ga0207661_10015772 | 3300025944 | Bacteria | 5564 |
| 160 | Ga0207661_10062953 | 3300025944 | Bacteria | 3003 |
| 161 | Ga0207661_10100212 | 3300025944 | Bacteria | 2431 |
| 162 | Ga0207712_10166484 | 3300025961 | Bacteria | 1719 |
| 163 | Ga0207658_10395995 | 3300025986 | Bacteria | 1213 |
| 164 | Ga0207677_10000046 | 3300026023 | Bacteria | 105382 |
| 165 | Ga0207677_10096474 | 3300026023 | Bacteria | 2163 |
| 166 | Ga0207703_10275957 | 3300026035 | Bacteria | 1525 |
| 167 | Ga0207678_10001735 | 3300026067 | Bacteria | 19947 |
| 168 | Ga0207678_10092090 | 3300026067 | Bacteria | 2591 |
| 169 | Ga0207708_10002009 | 3300026075 | Bacteria | 14978 |
| 170 | Ga0207708_10003988 | 3300026075 | Bacteria | 10863 |
| 171 | Ga0207702_10021879 | 3300026078 | Bacteria | 5296 |
| 172 | Ga0207648_10004975 | 3300026089 | Bacteria | 13515 |
| 173 | Ga0207648_10025966 | 3300026089 | Bacteria | 5209 |
| 174 | Ga0207648_10252098 | 3300026089 | Bacteria | 1573 |
| 175 | Ga0207674_10003081 | 3300026116 | Bacteria | 20623 |
| 176 | Ga0207674_10171684 | 3300026116 | Bacteria | 2121 |
| 177 | Ga0207675_100362077 | 3300026118 | Bacteria | 1423 |
| 178 | Ga0207683_10084981 | 3300026121 | Bacteria | 2813 |
| 179 | Ga0207683_10297879 | 3300026121 | Bacteria | 1475 |
| 180 | Ga0207698_10015995 | 3300026142 | Bacteria | 5045 |
| 181 | Ga0207698_10118496 | 3300026142 | Bacteria | 2236 |
| 182 | Ga0209813_10019256 | 3300027866 | Bacteria | 1895 |
| 183 | Ga0207428_10008520 | 3300027907 | Bacteria | 9256 |
| 184 | Ga0207428_10250592 | 3300027907 | Bacteria | 1320 |
| 185 | Ga0268264_10003178 | 3300028381 | Bacteria | 14229 |
| 186 | Ga0265326_10000042 | 3300028558 | Bacteria | 82957 |
| 187 | Ga0265334_10000002 | 3300028573 | Bacteria | 325014 |
| 188 | Ga0265336_10004010 | 3300028666 | Bacteria | 5629 |
| 189 | Ga0265338_10001157 | 3300028800 | Bacteria | 43619 |
| 190 | Ga0265324_10001178 | 3300029957 | Bacteria | 15584 |
| 191 | Ga0265760_10006822 | 3300031090 | Bacteria | 3271 |
| 192 | Ga0265329_10019032 | 3300031242 | Bacteria | 2338 |
| 193 | Ga0265316_10004221 | 3300031344 | Bacteria | 14350 |
| 194 | Ga0307410_10123885 | 3300031852 | Bacteria | 1889 |
| 195 | Ga0307406_10108491 | 3300031901 | Bacteria | 1906 |
| 196 | Ga0307407_10018798 | 3300031903 | Bacteria | 3505 |
| 197 | Ga0307409_100261165 | 3300031995 | Bacteria | 1589 |
| 198 | Ga0307416_100007499 | 3300032002 | Bacteria | 6945 |
| 199 | Ga0307416_100483573 | 3300032002 | Bacteria | 1299 |
| 200 | Ga0307416_100600685 | 3300032002 | Bacteria | 1180 |
| 201 | Ga0307415_100085089 | 3300032126 | Bacteria | 2271 |
| 202 | Ga0307415_100169727 | 3300032126 | Bacteria | 1700 |
| 203 | Ga0373937_0021613 | 3300036401 | Bacteria | 5775 |
| 204 | Ga0439448_0015862 | 3300042005 | Bacteria | 2287 |
| 205 | Ga0451576_0046588 | 3300045051 | Bacteria | 4565 |
| 206 | Ga0451576_0651223 | 3300045051 | Unclassified | 1107 |
| 207 | Ga0495603_0036147 | 3300046455 | Bacteria | 2965 |
| 208 | Ga0495603_0134668 | 3300046455 | Unclassified | 1438 |
| 209 | Ga0495629_0003874 | 3300046459 | Bacteria | 11277 |
| 210 | Ga0495651_0108466 | 3300046462 | Bacteria | 2056 |
| 211 | Ga0495653_0237927 | 3300046463 | Bacteria | 1215 |
| 212 | Ga0495580_0009067 | 3300046472 | Bacteria | 7848 |
| 213 | Ga0495582_0000023 | 3300046473 | Bacteria | 83274 |
| 214 | Ga0495582_0000135 | 3300046473 | Bacteria | 39697 |
| 215 | Ga0495582_0048687 | 3300046473 | Bacteria | 2334 |
| 216 | Ga0495594_0000835 | 3300046499 | Bacteria | 15912 |
| 217 | Ga0495608_0008237 | 3300046511 | Bacteria | 7319 |
| 218 | Ga0495618_0000053 | 3300046514 | Bacteria | 84115 |
| 219 | Ga0495628_0001375 | 3300046516 | Bacteria | 22311 |
| 220 | Ga0495640_0007964 | 3300046533 | Bacteria | 8333 |
| 221 | Ga0495587_0033218 | 3300046536 | Bacteria | 3116 |
| 222 | Ga0495622_0039753 | 3300046557 | Bacteria | 2190 |
| 223 | Ga0495622_0069753 | 3300046557 | Bacteria | 1623 |
| 224 | Ga0495667_0000015 | 3300046559 | Bacteria | 200377 |
| 225 | Ga0495668_0121502 | 3300046616 | Bacteria | 1429 |
| 226 | Ga0495634_0083604 | 3300046642 | Bacteria | 2083 |
| 227 | Ga0495625_0000033 | 3300046660 | Bacteria | 228108 |
| 228 | Ga0495635_0000042 | 3300046663 | Bacteria | 84550 |
| 229 | Ga0495635_0316188 | 3300046663 | Bacteria | 1046 |
| 230 | Ga0495657_0007415 | 3300046675 | Bacteria | 8475 |
| 231 | Ga0495647_0000019 | 3300046681 | Bacteria | 78887 |
| 232 | Ga0495647_0001600 | 3300046681 | Bacteria | 6994 |
| 233 | Ga0495658_0000021 | 3300046683 | Bacteria | 83269 |
| 234 | Ga0495613_0000042 | 3300046689 | Bacteria | 130403 |
| 235 | Ga0495613_0007016 | 3300046689 | Bacteria | 8391 |
| 236 | Ga0495600_0002447 | 3300046809 | Bacteria | 10649 |
| 237 | Ga0495600_0067535 | 3300046809 | Bacteria | 2337 |
| 238 | Ga0495600_0069934 | 3300046809 | Bacteria | 2294 |
| 239 | Ga0495581_0014679 | 3300047315 | Bacteria | 4543 |
| 240 | Ga0495604_0000038 | 3300047317 | Bacteria | 123703 |
| 241 | Ga0495604_0010953 | 3300047317 | Bacteria | 7199 |
| 242 | Ga0495636_0021861 | 3300047318 | Bacteria | 2584 |
| 243 | Ga0495676_0035181 | 3300047321 | Bacteria | 4192 |
| 244 | Ga0495680_0001731 | 3300047322 | Bacteria | 23178 |
| 245 | Ga0495680_0025922 | 3300047322 | Bacteria | 4844 |
| 246 | Ga0495680_0091980 | 3300047322 | Bacteria | 2273 |
| 247 | Ga0495685_024545 | 3300047447 | Bacteria | 2075 |
| 248 | Ga0495593_0056190 | 3300047673 | Bacteria | 2070 |
| 249 | Ga0495614_0006205 | 3300048089 | Bacteria | 5371 |
| 250 | Ga0496100_0203612 | 3300048903 | Bacteria | 1444 |
| 251 | Ga0496101_0131409 | 3300048904 | Bacteria | 1901 |
| 252 | Ga0496102_0459421 | 3300048905 | Bacteria | 1194 |
| 253 | Ga0496104_0419624 | 3300048907 | Bacteria | 1250 |
| 254 | Ga0496106_0049458 | 3300048909 | Bacteria | 3167 |
| 255 | Ga0496108_0023970 | 3300048911 | Bacteria | 5023 |
| 256 | Ga0496109_0000021 | 3300048912 | Bacteria | 189945 |
| 257 | Ga0496109_0005505 | 3300048912 | Bacteria | 10605 |
| 258 | Ga0496111_0123695 | 3300048914 | Bacteria | 1912 |
| 259 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 260 | Ga0496113_0038886 | 3300048916 | Bacteria | 3500 |
| 261 | Ga0496113_0113382 | 3300048916 | Bacteria | 2113 |
| 262 | Ga0496115_0332689 | 3300048918 | Bacteria | 1241 |
| 263 | Ga0496126_0000187 | 3300048929 | Bacteria | 139670 |
| 264 | Ga0501036_0015815 | 3300049572 | Bacteria | 6302 |
| 265 | Ga0501036_0045765 | 3300049572 | Bacteria | 3706 |
| 266 | Ga0501038_0164352 | 3300049574 | Bacteria | 1801 |
| 267 | Ga0501039_0079421 | 3300049575 | Bacteria | 2552 |
| 268 | Ga0501040_0013007 | 3300049576 | Bacteria | 5471 |
| 269 | Ga0501040_0055990 | 3300049576 | Bacteria | 2705 |
| 270 | Ga0501042_0210524 | 3300049578 | Bacteria | 1402 |
| 271 | Ga0501070_0219572 | 3300049586 | Bacteria | 1559 |
| 272 | Ga0501071_0028985 | 3300049587 | Bacteria | 3904 |
| 273 | Ga0501071_0084502 | 3300049587 | Bacteria | 2326 |
| 274 | Ga0501076_0021061 | 3300049592 | Bacteria | 4996 |
| 275 | Ga0501076_0080831 | 3300049592 | Bacteria | 2609 |
| 276 | Ga0501079_0043647 | 3300049741 | Bacteria | 3461 |
| 277 | Ga0501080_0121419 | 3300049742 | Bacteria | 2421 |
| 278 | Ga0501083_0119282 | 3300049744 | Bacteria | 1731 |
| 279 | Ga0501035_0000075 | 3300049822 | Bacteria | 121646 |
| 280 | Ga0501045_0036438 | 3300049824 | Bacteria | 3571 |
| 281 | nmdc:mga03n38_50012_c1 | 3300050490 | Bacteria | 1861 |
| 282 | nmdc:mga03n38_8465_c1 | 3300050490 | Bacteria | 3693 |
| 283 | nmdc:mga00v17_130824_c1 | 3300050491 | Bacteria | 1604 |
| 284 | nmdc:mga0yw44_6968_c1 | 3300050492 | Bacteria | 5519 |
| 285 | nmdc:mga0k408_62280_c1 | 3300050493 | Bacteria | 2169 |
| 286 | nmdc:mga07m45_92447_c1 | 3300050496 | Bacteria | 1734 |
| 287 | nmdc:mga08y16_1117_c1 | 3300050511 | Bacteria | 26469 |
| 288 | nmdc:mga08y16_212034_c1 | 3300050511 | Bacteria | 2006 |
| 289 | nmdc:mga08y16_83441_c1 | 3300050511 | Bacteria | 3330 |
| 290 | Ga0495619_0004908 | 3300053085 | Bacteria | 8492 |
| 291 | Ga0495619_0006540 | 3300053085 | Bacteria | 7374 |
| 292 | Ga0495619_0079636 | 3300053085 | Bacteria | 2204 |
| 293 | Ga0500555_000033 | 3300053103 | Bacteria | 85640 |
| 294 | Ga0500595_000007 | 3300053119 | Bacteria | 289461 |
| 295 | Ga0500616_0000395 | 3300053153 | Bacteria | 59933 |
| 296 | Ga0500645_000010 | 3300053730 | Bacteria | 186517 |
| 297 | Ga0501084_0033261 | 3300054114 | Bacteria | 4313 |
| 298 | Ga0501082_0090134 | 3300060353 | Bacteria | 2648 |
| 299 | Ga0501082_0157307 | 3300060353 | Bacteria | 1974 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031090 | Ga0265760_10006822 | Ga0265760_100068224 | 317 |
| 2 | 3300048904 | Ga0496101_0131409 | Ga0496101_0131409_873_1850 | 319 |
| 3 | 3300009094 | Ga0111539_10001108 | Ga0111539_1000110819 | 329 |
| 4 | 3300027907 | Ga0207428_10008520 | Ga0207428_100085203 | 329 |
| 5 | 3300050511 | nmdc:mga08y16_1117_c1 | nmdc:mga08y16_1117_c1_19096_20151 | 329 |
| 6 | 3300049822 | Ga0501035_0000075 | Ga0501035_0000075_57832_58887 | 332 |
| 7 | 3300046663 | Ga0495635_0316188 | Ga0495635_0316188_29_1033 | 334 |
| 8 | 3300005843 | Ga0068860_100450162 | Ga0068860_1004501621 | 336 |
| 9 | 3300049586 | Ga0501070_0219572 | Ga0501070_0219572_438_1511 | 336 |
| 10 | 3300014326 | Ga0157380_10002532 | Ga0157380_1000253211 | 337 |
| 11 | 3300049578 | Ga0501042_0210524 | Ga0501042_0210524_353_1375 | 337 |
| 12 | 3300005336 | Ga0070680_100288434 | Ga0070680_1002884341 | 339 |
| 13 | 3300009094 | Ga0111539_10041347 | Ga0111539_100413476 | 339 |
| 14 | 3300027907 | Ga0207428_10250592 | Ga0207428_102505922 | 339 |
| 15 | 3300050511 | nmdc:mga08y16_212034_c1 | nmdc:mga08y16_212034_c1_302_1357 | 339 |
| 16 | 3300005467 | Ga0070706_100187602 | Ga0070706_1001876021 | 341 |
| 17 | 3300005468 | Ga0070707_100006621 | Ga0070707_1000066216 | 341 |
| 18 | 3300005327 | Ga0070658_10244068 | Ga0070658_102440682 | 343 |
| 19 | 3300005329 | Ga0070683_100079674 | Ga0070683_1000796743 | 343 |
| 20 | 3300005577 | Ga0068857_100019714 | Ga0068857_1000197142 | 343 |
| 21 | 3300005616 | Ga0068852_100019083 | Ga0068852_1000190833 | 343 |
| 22 | 3300020070 | Ga0206356_10484574 | Ga0206356_104845742 | 343 |
| 23 | 3300020082 | Ga0206353_11743768 | Ga0206353_117437682 | 343 |
| 24 | 3300025909 | Ga0207705_10038175 | Ga0207705_100381753 | 343 |
| 25 | 3300025917 | Ga0207660_10033578 | Ga0207660_100335781 | 343 |
| 26 | 3300025919 | Ga0207657_10005323 | Ga0207657_100053234 | 343 |
| 27 | 3300025920 | Ga0207649_10032191 | Ga0207649_100321912 | 343 |
| 28 | 3300025921 | Ga0207652_10029714 | Ga0207652_100297143 | 343 |
| 29 | 3300025932 | Ga0207690_10014162 | Ga0207690_100141622 | 343 |
| 30 | 3300025944 | Ga0207661_10002951 | Ga0207661_100029517 | 343 |
| 31 | 3300026078 | Ga0207702_10021879 | Ga0207702_100218794 | 343 |
| 32 | 3300026142 | Ga0207698_10015995 | Ga0207698_100159953 | 343 |
| 33 | 3300005329 | Ga0070683_100082982 | Ga0070683_1000829822 | 346 |
| 34 | 3300005344 | Ga0070661_100058205 | Ga0070661_1000582052 | 346 |
| 35 | 3300005535 | Ga0070684_100060478 | Ga0070684_1000604783 | 346 |
| 36 | 3300005564 | Ga0070664_100000212 | Ga0070664_10000021233 | 346 |
| 37 | 3300005577 | Ga0068857_100096799 | Ga0068857_1000967992 | 346 |
| 38 | 3300006358 | Ga0068871_100109186 | Ga0068871_1001091862 | 346 |
| 39 | 3300007076 | Ga0075435_100125565 | Ga0075435_1001255651 | 346 |
| 40 | 3300009094 | Ga0111539_10080696 | Ga0111539_100806962 | 346 |
| 41 | 3300025920 | Ga0207649_10033825 | Ga0207649_100338252 | 346 |
| 42 | 3300025944 | Ga0207661_10062953 | Ga0207661_100629532 | 346 |
| 43 | 3300026116 | Ga0207674_10003081 | Ga0207674_100030812 | 346 |
| 44 | 3300045051 | Ga0451576_0651223 | Ga0451576_0651223_39_1094 | 346 |
| 45 | 3300047318 | Ga0495636_0021861 | Ga0495636_0021861_1336_2391 | 346 |
| 46 | 3300005336 | Ga0070680_100074800 | Ga0070680_1000748002 | 347 |
| 47 | 3300005536 | Ga0070697_100065081 | Ga0070697_1000650813 | 347 |
| 48 | 3300009094 | Ga0111539_10045356 | Ga0111539_100453564 | 347 |
| 49 | 3300009098 | Ga0105245_10052262 | Ga0105245_100522623 | 347 |
| 50 | 3300009147 | Ga0114129_10757513 | Ga0114129_107575131 | 347 |
| 51 | 3300009148 | Ga0105243_10006962 | Ga0105243_100069624 | 347 |
| 52 | 3300009553 | Ga0105249_10143979 | Ga0105249_101439792 | 347 |
| 53 | 3300011119 | Ga0105246_10043147 | Ga0105246_100431472 | 347 |
| 54 | 3300013297 | Ga0157378_10319166 | Ga0157378_103191661 | 347 |
| 55 | 3300013307 | Ga0157372_10078530 | Ga0157372_100785302 | 347 |
| 56 | 3300013308 | Ga0157375_10024471 | Ga0157375_100244713 | 347 |
| 57 | 3300014326 | Ga0157380_10053738 | Ga0157380_100537383 | 347 |
| 58 | 3300015262 | Ga0182007_10007147 | Ga0182007_100071475 | 347 |
| 59 | 3300031903 | Ga0307407_10018798 | Ga0307407_100187982 | 347 |
| 60 | 3300047317 | Ga0495604_0010953 | Ga0495604_0010953_24_1067 | 347 |
| 61 | 3300048907 | Ga0496104_0419624 | Ga0496104_0419624_176_1219 | 347 |
| 62 | 3300048909 | Ga0496106_0049458 | Ga0496106_0049458_658_1719 | 347 |
| 63 | 3300048911 | Ga0496108_0023970 | Ga0496108_0023970_1237_2298 | 347 |
| 64 | 3300048912 | Ga0496109_0005505 | Ga0496109_0005505_3489_4550 | 347 |
| 65 | 3300048914 | Ga0496111_0123695 | Ga0496111_0123695_756_1817 | 347 |
| 66 | 3300048916 | Ga0496113_0038886 | Ga0496113_0038886_1568_2629 | 347 |
| 67 | 3300048918 | Ga0496115_0332689 | Ga0496115_0332689_67_1110 | 347 |
| 68 | 3300049744 | Ga0501083_0119282 | Ga0501083_0119282_26_1087 | 347 |
| 69 | 3300050490 | nmdc:mga03n38_8465_c1 | nmdc:mga03n38_8465_c1_489_1550 | 347 |
| 70 | 3300050491 | nmdc:mga00v17_130824_c1 | nmdc:mga00v17_130824_c1_83_1144 | 347 |
| 71 | 3300050492 | nmdc:mga0yw44_6968_c1 | nmdc:mga0yw44_6968_c1_463_1524 | 347 |
| 72 | 3300025933 | Ga0207706_10360603 | Ga0207706_103606032 | 348 |
| 73 | 3300009177 | Ga0105248_10019118 | Ga0105248_100191181 | 349 |
| 74 | 3300013296 | Ga0157374_10003390 | Ga0157374_100033906 | 349 |
| 75 | 3300013308 | Ga0157375_10000109 | Ga0157375_1000010933 | 349 |
| 76 | 3300014325 | Ga0163163_10031779 | Ga0163163_100317792 | 349 |
| 77 | 3300026075 | Ga0207708_10002009 | Ga0207708_1000200912 | 349 |
| 78 | 3300026142 | Ga0207698_10118496 | Ga0207698_101184962 | 349 |
| 79 | 3300042005 | Ga0439448_0015862 | Ga0439448_0015862_443_1525 | 349 |
| 80 | 3300045051 | Ga0451576_0046588 | Ga0451576_0046588_1405_2529 | 349 |
| 81 | 3300046455 | Ga0495603_0036147 | Ga0495603_0036147_1120_2172 | 349 |
| 82 | 3300046459 | Ga0495629_0003874 | Ga0495629_0003874_3589_4641 | 349 |
| 83 | 3300046463 | Ga0495653_0237927 | Ga0495653_0237927_54_1124 | 349 |
| 84 | 3300046473 | Ga0495582_0048687 | Ga0495582_0048687_1120_2172 | 349 |
| 85 | 3300046499 | Ga0495594_0000835 | Ga0495594_0000835_10059_11111 | 349 |
| 86 | 3300046511 | Ga0495608_0008237 | Ga0495608_0008237_991_2061 | 349 |
| 87 | 3300046557 | Ga0495622_0039753 | Ga0495622_0039753_725_1777 | 349 |
| 88 | 3300046616 | Ga0495668_0121502 | Ga0495668_0121502_69_1121 | 349 |
| 89 | 3300046689 | Ga0495613_0007016 | Ga0495613_0007016_7204_8256 | 349 |
| 90 | 3300047315 | Ga0495581_0014679 | Ga0495581_0014679_744_1796 | 349 |
| 91 | 3300047321 | Ga0495676_0035181 | Ga0495676_0035181_646_1698 | 349 |
| 92 | 3300047673 | Ga0495593_0056190 | Ga0495593_0056190_819_1871 | 349 |
| 93 | 3300048089 | Ga0495614_0006205 | Ga0495614_0006205_432_1484 | 349 |
| 94 | 3300048912 | Ga0496109_0000021 | Ga0496109_0000021_77804_78874 | 349 |
| 95 | 3300050511 | nmdc:mga08y16_83441_c1 | nmdc:mga08y16_83441_c1_1265_2389 | 349 |
| 96 | 3300005329 | Ga0070683_100006874 | Ga0070683_1000068744 | 350 |
| 97 | 3300005329 | Ga0070683_100060964 | Ga0070683_1000609642 | 350 |
| 98 | 3300005338 | Ga0068868_100000261 | Ga0068868_10000026111 | 350 |
| 99 | 3300005340 | Ga0070689_100056352 | Ga0070689_1000563522 | 350 |
| 100 | 3300005345 | Ga0070692_10000217 | Ga0070692_1000021712 | 350 |
| 101 | 3300005347 | Ga0070668_100310526 | Ga0070668_1003105261 | 350 |
| 102 | 3300005354 | Ga0070675_100035114 | Ga0070675_1000351143 | 350 |
| 103 | 3300005356 | Ga0070674_100000022 | Ga0070674_10000002211 | 350 |
| 104 | 3300005356 | Ga0070674_100059029 | Ga0070674_1000590292 | 350 |
| 105 | 3300005366 | Ga0070659_100002827 | Ga0070659_1000028273 | 350 |
| 106 | 3300005367 | Ga0070667_100136647 | Ga0070667_1001366472 | 350 |
| 107 | 3300005434 | Ga0070709_10031278 | Ga0070709_100312782 | 350 |
| 108 | 3300005435 | Ga0070714_100000718 | Ga0070714_1000007184 | 350 |
| 109 | 3300005439 | Ga0070711_100106010 | Ga0070711_1001060101 | 350 |
| 110 | 3300005441 | Ga0070700_100051051 | Ga0070700_1000510512 | 350 |
| 111 | 3300005445 | Ga0070708_100050109 | Ga0070708_1000501092 | 350 |
| 112 | 3300005455 | Ga0070663_100235584 | Ga0070663_1002355841 | 350 |
| 113 | 3300005456 | Ga0070678_100107622 | Ga0070678_1001076222 | 350 |
| 114 | 3300005457 | Ga0070662_100000007 | Ga0070662_10000000799 | 350 |
| 115 | 3300005458 | Ga0070681_10193178 | Ga0070681_101931782 | 350 |
| 116 | 3300005459 | Ga0068867_100000294 | Ga0068867_1000002943 | 350 |
| 117 | 3300005468 | Ga0070707_100000279 | Ga0070707_10000027956 | 350 |
| 118 | 3300005471 | Ga0070698_100423933 | Ga0070698_1004239331 | 350 |
| 119 | 3300005543 | Ga0070672_100283659 | Ga0070672_1002836591 | 350 |
| 120 | 3300005548 | Ga0070665_100017074 | Ga0070665_1000170747 | 350 |
| 121 | 3300005577 | Ga0068857_100021641 | Ga0068857_1000216413 | 350 |
| 122 | 3300005578 | Ga0068854_100089554 | Ga0068854_1000895542 | 350 |
| 123 | 3300005718 | Ga0068866_10000001 | Ga0068866_1000000186 | 350 |
| 124 | 3300005719 | Ga0068861_100303578 | Ga0068861_1003035782 | 350 |
| 125 | 3300005843 | Ga0068860_100009109 | Ga0068860_1000091094 | 350 |
| 126 | 3300006028 | Ga0070717_10000001 | Ga0070717_10000001124 | 350 |
| 127 | 3300006038 | Ga0075365_10002019 | Ga0075365_100020193 | 350 |
| 128 | 3300006048 | Ga0075363_100010141 | Ga0075363_1000101412 | 350 |
| 129 | 3300006048 | Ga0075363_100080993 | Ga0075363_1000809931 | 350 |
| 130 | 3300006051 | Ga0075364_10093675 | Ga0075364_100936752 | 350 |
| 131 | 3300006163 | Ga0070715_10000001 | Ga0070715_1000000157 | 350 |
| 132 | 3300006175 | Ga0070712_100000004 | Ga0070712_10000000424 | 350 |
| 133 | 3300006195 | Ga0075366_10030848 | Ga0075366_100308481 | 350 |
| 134 | 3300006195 | Ga0075366_10075472 | Ga0075366_100754722 | 350 |
| 135 | 3300006846 | Ga0075430_100324783 | Ga0075430_1003247832 | 350 |
| 136 | 3300006881 | Ga0068865_100013974 | Ga0068865_1000139742 | 350 |
| 137 | 3300006881 | Ga0068865_100278486 | Ga0068865_1002784861 | 350 |
| 138 | 3300009098 | Ga0105245_10089487 | Ga0105245_100894871 | 350 |
| 139 | 3300009147 | Ga0114129_10353368 | Ga0114129_103533682 | 350 |
| 140 | 3300009148 | Ga0105243_10229569 | Ga0105243_102295692 | 350 |
| 141 | 3300009551 | Ga0105238_10000023 | Ga0105238_1000002366 | 350 |
| 142 | 3300009553 | Ga0105249_10391184 | Ga0105249_103911841 | 350 |
| 143 | 3300014968 | Ga0157379_10059498 | Ga0157379_100594983 | 350 |
| 144 | 3300025321 | Ga0207656_10052821 | Ga0207656_100528212 | 350 |
| 145 | 3300025899 | Ga0207642_10000006 | Ga0207642_1000000689 | 350 |
| 146 | 3300025899 | Ga0207642_10000007 | Ga0207642_10000007146 | 350 |
| 147 | 3300025901 | Ga0207688_10004963 | Ga0207688_100049632 | 350 |
| 148 | 3300025901 | Ga0207688_10028335 | Ga0207688_100283352 | 350 |
| 149 | 3300025905 | Ga0207685_10000011 | Ga0207685_1000001158 | 350 |
| 150 | 3300025906 | Ga0207699_10077814 | Ga0207699_100778141 | 350 |
| 151 | 3300025909 | Ga0207705_10148505 | Ga0207705_101485051 | 350 |
| 152 | 3300025912 | Ga0207707_10039267 | Ga0207707_100392673 | 350 |
| 153 | 3300025915 | Ga0207693_10000105 | Ga0207693_1000010547 | 350 |
| 154 | 3300025916 | Ga0207663_10011729 | Ga0207663_100117295 | 350 |
| 155 | 3300025918 | Ga0207662_10092715 | Ga0207662_100927152 | 350 |
| 156 | 3300025919 | Ga0207657_10008992 | Ga0207657_100089925 | 350 |
| 157 | 3300025921 | Ga0207652_10197045 | Ga0207652_101970452 | 350 |
| 158 | 3300025922 | Ga0207646_10000514 | Ga0207646_100005142 | 350 |
| 159 | 3300025922 | Ga0207646_10004542 | Ga0207646_100045428 | 350 |
| 160 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004754 | 350 |
| 161 | 3300025926 | Ga0207659_10071938 | Ga0207659_100719383 | 350 |
| 162 | 3300025926 | Ga0207659_10079501 | Ga0207659_100795012 | 350 |
| 163 | 3300025929 | Ga0207664_10024189 | Ga0207664_100241894 | 350 |
| 164 | 3300025932 | Ga0207690_10006046 | Ga0207690_100060464 | 350 |
| 165 | 3300025932 | Ga0207690_10031577 | Ga0207690_100315774 | 350 |
| 166 | 3300025933 | Ga0207706_10000018 | Ga0207706_1000001887 | 350 |
| 167 | 3300025933 | Ga0207706_10002258 | Ga0207706_100022589 | 350 |
| 168 | 3300025933 | Ga0207706_10235230 | Ga0207706_102352302 | 350 |
| 169 | 3300025935 | Ga0207709_10002964 | Ga0207709_100029644 | 350 |
| 170 | 3300025937 | Ga0207669_10000009 | Ga0207669_1000000985 | 350 |
| 171 | 3300025937 | Ga0207669_10003812 | Ga0207669_100038122 | 350 |
| 172 | 3300025938 | Ga0207704_10064930 | Ga0207704_100649302 | 350 |
| 173 | 3300025940 | Ga0207691_10030536 | Ga0207691_100305363 | 350 |
| 174 | 3300025942 | Ga0207689_10126979 | Ga0207689_101269792 | 350 |
| 175 | 3300025942 | Ga0207689_10151922 | Ga0207689_101519222 | 350 |
| 176 | 3300025944 | Ga0207661_10015772 | Ga0207661_100157723 | 350 |
| 177 | 3300025944 | Ga0207661_10100212 | Ga0207661_101002122 | 350 |
| 178 | 3300025961 | Ga0207712_10166484 | Ga0207712_101664842 | 350 |
| 179 | 3300025986 | Ga0207658_10395995 | Ga0207658_103959951 | 350 |
| 180 | 3300026023 | Ga0207677_10000046 | Ga0207677_1000004640 | 350 |
| 181 | 3300026023 | Ga0207677_10096474 | Ga0207677_100964742 | 350 |
| 182 | 3300026035 | Ga0207703_10275957 | Ga0207703_102759572 | 350 |
| 183 | 3300026067 | Ga0207678_10001735 | Ga0207678_1000173516 | 350 |
| 184 | 3300026067 | Ga0207678_10092090 | Ga0207678_100920902 | 350 |
| 185 | 3300026075 | Ga0207708_10003988 | Ga0207708_100039882 | 350 |
| 186 | 3300026089 | Ga0207648_10004975 | Ga0207648_1000497510 | 350 |
| 187 | 3300026089 | Ga0207648_10025966 | Ga0207648_100259663 | 350 |
| 188 | 3300026118 | Ga0207675_100362077 | Ga0207675_1003620771 | 350 |
| 189 | 3300026121 | Ga0207683_10084981 | Ga0207683_100849812 | 350 |
| 190 | 3300026121 | Ga0207683_10297879 | Ga0207683_102978792 | 350 |
| 191 | 3300027866 | Ga0209813_10019256 | Ga0209813_100192562 | 350 |
| 192 | 3300028381 | Ga0268264_10003178 | Ga0268264_100031784 | 350 |
| 193 | 3300028558 | Ga0265326_10000042 | Ga0265326_1000004215 | 350 |
| 194 | 3300028573 | Ga0265334_10000002 | Ga0265334_10000002309 | 350 |
| 195 | 3300028666 | Ga0265336_10004010 | Ga0265336_100040106 | 350 |
| 196 | 3300028800 | Ga0265338_10001157 | Ga0265338_1000115720 | 350 |
| 197 | 3300029957 | Ga0265324_10001178 | Ga0265324_100011782 | 350 |
| 198 | 3300031242 | Ga0265329_10019032 | Ga0265329_100190322 | 350 |
| 199 | 3300031344 | Ga0265316_10004221 | Ga0265316_100042212 | 350 |
| 200 | 3300031852 | Ga0307410_10123885 | Ga0307410_101238851 | 350 |
| 201 | 3300031901 | Ga0307406_10108491 | Ga0307406_101084912 | 350 |
| 202 | 3300031995 | Ga0307409_100261165 | Ga0307409_1002611652 | 350 |
| 203 | 3300032002 | Ga0307416_100007499 | Ga0307416_1000074993 | 350 |
| 204 | 3300032002 | Ga0307416_100483573 | Ga0307416_1004835731 | 350 |
| 205 | 3300032002 | Ga0307416_100600685 | Ga0307416_1006006851 | 350 |
| 206 | 3300032126 | Ga0307415_100085089 | Ga0307415_1000850891 | 350 |
| 207 | 3300032126 | Ga0307415_100169727 | Ga0307415_1001697273 | 350 |
| 208 | 3300036401 | Ga0373937_0021613 | Ga0373937_0021613_566_1639 | 350 |
| 209 | 3300046455 | Ga0495603_0134668 | Ga0495603_0134668_231_1355 | 350 |
| 210 | 3300046462 | Ga0495651_0108466 | Ga0495651_0108466_905_1978 | 350 |
| 211 | 3300046472 | Ga0495580_0009067 | Ga0495580_0009067_1909_3033 | 350 |
| 212 | 3300046473 | Ga0495582_0000023 | Ga0495582_0000023_67455_68528 | 350 |
| 213 | 3300046473 | Ga0495582_0000135 | Ga0495582_0000135_28007_29131 | 350 |
| 214 | 3300046514 | Ga0495618_0000053 | Ga0495618_0000053_25532_26605 | 350 |
| 215 | 3300046516 | Ga0495628_0001375 | Ga0495628_0001375_6855_7928 | 350 |
| 216 | 3300046533 | Ga0495640_0007964 | Ga0495640_0007964_5440_6513 | 350 |
| 217 | 3300046536 | Ga0495587_0033218 | Ga0495587_0033218_1874_2947 | 350 |
| 218 | 3300046557 | Ga0495622_0069753 | Ga0495622_0069753_439_1563 | 350 |
| 219 | 3300046559 | Ga0495667_0000015 | Ga0495667_0000015_61803_62876 | 350 |
| 220 | 3300046642 | Ga0495634_0083604 | Ga0495634_0083604_521_1594 | 350 |
| 221 | 3300046663 | Ga0495635_0000042 | Ga0495635_0000042_68120_69193 | 350 |
| 222 | 3300046675 | Ga0495657_0007415 | Ga0495657_0007415_1017_2090 | 350 |
| 223 | 3300046681 | Ga0495647_0000019 | Ga0495647_0000019_32830_33903 | 350 |
| 224 | 3300046681 | Ga0495647_0001600 | Ga0495647_0001600_2467_3540 | 350 |
| 225 | 3300046683 | Ga0495658_0000021 | Ga0495658_0000021_67455_68528 | 350 |
| 226 | 3300046689 | Ga0495613_0000042 | Ga0495613_0000042_57265_58338 | 350 |
| 227 | 3300046809 | Ga0495600_0002447 | Ga0495600_0002447_4405_5478 | 350 |
| 228 | 3300046809 | Ga0495600_0067535 | Ga0495600_0067535_768_1841 | 350 |
| 229 | 3300046809 | Ga0495600_0069934 | Ga0495600_0069934_977_2050 | 350 |
| 230 | 3300047317 | Ga0495604_0000038 | Ga0495604_0000038_43683_44756 | 350 |
| 231 | 3300047322 | Ga0495680_0001731 | Ga0495680_0001731_14441_15514 | 350 |
| 232 | 3300047322 | Ga0495680_0025922 | Ga0495680_0025922_3678_4751 | 350 |
| 233 | 3300047322 | Ga0495680_0091980 | Ga0495680_0091980_419_1633 | 350 |
| 234 | 3300047447 | Ga0495685_024545 | Ga0495685_024545_636_1709 | 350 |
| 235 | 3300048903 | Ga0496100_0203612 | Ga0496100_0203612_256_1329 | 350 |
| 236 | 3300048905 | Ga0496102_0459421 | Ga0496102_0459421_32_1147 | 350 |
| 237 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_281452_282525 | 350 |
| 238 | 3300049572 | Ga0501036_0015815 | Ga0501036_0015815_3059_4171 | 350 |
| 239 | 3300049572 | Ga0501036_0045765 | Ga0501036_0045765_1255_2367 | 350 |
| 240 | 3300049574 | Ga0501038_0164352 | Ga0501038_0164352_231_1343 | 350 |
| 241 | 3300049575 | Ga0501039_0079421 | Ga0501039_0079421_968_2080 | 350 |
| 242 | 3300049576 | Ga0501040_0013007 | Ga0501040_0013007_1460_2572 | 350 |
| 243 | 3300049576 | Ga0501040_0055990 | Ga0501040_0055990_1313_2425 | 350 |
| 244 | 3300049587 | Ga0501071_0084502 | Ga0501071_0084502_922_2034 | 350 |
| 245 | 3300049592 | Ga0501076_0021061 | Ga0501076_0021061_2645_3757 | 350 |
| 246 | 3300049592 | Ga0501076_0080831 | Ga0501076_0080831_1263_2375 | 350 |
| 247 | 3300049741 | Ga0501079_0043647 | Ga0501079_0043647_1362_2474 | 350 |
| 248 | 3300049824 | Ga0501045_0036438 | Ga0501045_0036438_1042_2154 | 350 |
| 249 | 3300050490 | nmdc:mga03n38_50012_c1 | nmdc:mga03n38_50012_c1_435_1547 | 350 |
| 250 | 3300050493 | nmdc:mga0k408_62280_c1 | nmdc:mga0k408_62280_c1_173_1285 | 350 |
| 251 | 3300050496 | nmdc:mga07m45_92447_c1 | nmdc:mga07m45_92447_c1_237_1349 | 350 |
| 252 | 3300053085 | Ga0495619_0004908 | Ga0495619_0004908_1015_2088 | 350 |
| 253 | 3300053085 | Ga0495619_0006540 | Ga0495619_0006540_6132_7205 | 350 |
| 254 | 3300053085 | Ga0495619_0079636 | Ga0495619_0079636_547_1620 | 350 |
| 255 | 3300054114 | Ga0501084_0033261 | Ga0501084_0033261_3168_4280 | 350 |
| 256 | 3300060353 | Ga0501082_0090134 | Ga0501082_0090134_25_1137 | 350 |
| 257 | 3300060353 | Ga0501082_0157307 | Ga0501082_0157307_841_1953 | 350 |
| 258 | 3300005335 | Ga0070666_10035193 | Ga0070666_100351933 | 352 |
| 259 | 3300005544 | Ga0070686_100183118 | Ga0070686_1001831181 | 352 |
| 260 | 3300005617 | Ga0068859_100337179 | Ga0068859_1003371792 | 352 |
| 261 | 3300005618 | Ga0068864_100024222 | Ga0068864_1000242221 | 352 |
| 262 | 3300006931 | Ga0097620_100337156 | Ga0097620_1003371562 | 352 |
| 263 | 3300046660 | Ga0495625_0000033 | Ga0495625_0000033_116953_118137 | 352 |
| 264 | 3300048929 | Ga0496126_0000187 | Ga0496126_0000187_134573_135679 | 352 |
| 265 | 3300053119 | Ga0500595_000007 | Ga0500595_000007_166887_167993 | 352 |
| 266 | iso_pu_bacteria | 2884215851 | 2884216645 | 352 |
| 267 | 3300006048 | Ga0075363_100052826 | Ga0075363_1000528262 | 353 |
| 268 | 3300006051 | Ga0075364_10039225 | Ga0075364_100392252 | 353 |
| 269 | 3300006847 | Ga0075431_100078376 | Ga0075431_1000783762 | 353 |
| 270 | 3300049742 | Ga0501080_0121419 | Ga0501080_0121419_393_1484 | 353 |
| 271 | 3300014969 | Ga0157376_10174321 | Ga0157376_101743212 | 356 |
| 272 | 3300009093 | Ga0105240_10147641 | Ga0105240_101476412 | 361 |
| 273 | 3300013104 | Ga0157370_10030658 | Ga0157370_100306583 | 361 |
| 274 | 3300013105 | Ga0157369_10047965 | Ga0157369_100479652 | 361 |
| 275 | 3300013307 | Ga0157372_10019761 | Ga0157372_100197613 | 361 |
| 276 | 3300005336 | Ga0070680_100018183 | Ga0070680_1000181834 | 364 |
| 277 | 3300005337 | Ga0070682_100025360 | Ga0070682_1000253602 | 364 |
| 278 | 3300005339 | Ga0070660_100005747 | Ga0070660_1000057476 | 364 |
| 279 | 3300005458 | Ga0070681_10037978 | Ga0070681_100379782 | 364 |
| 280 | 3300005466 | Ga0070685_10087904 | Ga0070685_100879042 | 364 |
| 281 | 3300005530 | Ga0070679_100082041 | Ga0070679_1000820412 | 364 |
| 282 | 3300005535 | Ga0070684_100006068 | Ga0070684_1000060681 | 364 |
| 283 | 3300020081 | Ga0206354_10168787 | Ga0206354_101687871 | 364 |
| 284 | 3300025901 | Ga0207688_10070162 | Ga0207688_100701622 | 364 |
| 285 | 3300025914 | Ga0207671_10060710 | Ga0207671_100607102 | 364 |
| 286 | 3300026089 | Ga0207648_10252098 | Ga0207648_102520982 | 364 |
| 287 | 3300026116 | Ga0207674_10171684 | Ga0207674_101716842 | 364 |
| 288 | 3300053103 | Ga0500555_000033 | Ga0500555_000033_75841_76947 | 364 |
| 289 | 3300053153 | Ga0500616_0000395 | Ga0500616_0000395_28717_29823 | 364 |
| 290 | 3300053730 | Ga0500645_000010 | Ga0500645_000010_102245_103351 | 364 |
| 291 | 3300009098 | Ga0105245_10205272 | Ga0105245_102052722 | 366 |
| 292 | 3300048916 | Ga0496113_0113382 | Ga0496113_0113382_70_1200 | 366 |
| 293 | 3300005290 | Ga0065712_10072575 | Ga0065712_100725754 | 367 |
| 294 | 3300005293 | Ga0065715_10254987 | Ga0065715_102549871 | 367 |
| 295 | 3300005295 | Ga0065707_10088740 | Ga0065707_100887404 | 367 |
| 296 | 3300005616 | Ga0068852_100200864 | Ga0068852_1002008642 | 367 |
| 297 | 3300005718 | Ga0068866_10016114 | Ga0068866_100161142 | 367 |
| 298 | 3300006042 | Ga0075368_10041303 | Ga0075368_100413032 | 367 |
| 299 | 3300009094 | Ga0111539_10026563 | Ga0111539_100265634 | 367 |
| 300 | 3300049587 | Ga0501071_0028985 | Ga0501071_0028985_228_1385 | 367 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xl5-assembly1.cif.gz_A-2 | crystal structure of the h42t/a85g/i86a mutant of a nadp-dependent alcohol dehydrogenase | 0.9188 | 4 | 350 |
| 6sdm-assembly1.cif.gz_B | nadh-dependent variant of tbadh | 0.9177 | 2 | 350 |
| 7uut-assembly1.cif.gz_A | ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism | 0.9141 | 4 | 350 |
| 1ped-assembly1.cif.gz_B | bacterial secondary alcohol dehydrogenase (apo-form) | 0.9141 | 4 | 350 |
| 2nvb-assembly1.cif.gz_A | contribution of pro275 to the thermostability of the alcohol dehydrogenases (adhs) | 0.9134 | 4 | 350 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B4G1G0_229_356_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9257 | 165 | 291 | 3.40.50.720 |
| af_O07737_155_282_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9146 | 161 | 290 | 3.40.50.720 |
| af_B4G1G0_229_356_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9119 | 165 | 291 | 3.40.50.720 |
| af_Q8BGC4_30_129_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9033 | 3 | 85 | 3.90.180.10 |
| 1ntoA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8999 | 159 | 293 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A101ITM8-F1-model_v4 | Alcohol dehydrogenase zinc-binding domain protein | 0.9526 | 153 | 271 |
GO:0016020
|
| AF-A0A6L8I1I5-F1-model_v4 | Zinc-binding dehydrogenase | 0.9441 | 139 | 351 |
GO:0016491
GO:0046872 |
| AF-A0A0U5BK63-F1-model_v4 | Glutathione-independent formaldehyde dehydrogenase | 0.9372 | 144 | 243 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A538EJP1-F1-model_v4 | Zinc-binding dehydrogenase | 0.9371 | 156 | 353 |
GO:0046872
|
| AF-A0A4R1PRJ9-F1-model_v4 | Zinc-binding dehydrogenase | 0.9356 | 214 | 351 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar