F395554

General Info

Members Datasets Scaffolds Average Seq Length
300 213 299 360

Family's Representative Sequence

Representative Sequence 3300047322|Ga0495680_0091980|Ga0495680_0091980_419_1633
Length 404
Sequence MAALPAGTPERADPAADAAEVRTYYRCRPRLTGLACEFNPVQAKEQAMAETMKAAVFEGHERIVLEEKPMPRCGPTDAIVKISLTTICGTDVHIWREEYPVEQGRIVGHEPVGTIHQLGDAVSGYEVGERVLVGAITPCGSCFYCQSHNEAQCSGHEDDWQMIGAWRLGNAIDGVQAEYFRVPYAQANLAKIPDDLSDEQCVLLADIASTGISAAETANVRIGQTVAVFAQGPIGLCATAGARLMGASLVIGVDRIAGRLELSKKMGADETIDFSEEDPIAAIKRLTGGRGVDVAIEALGTQQTFEACIEATRPGGIVSSLGVYGGKLEIPLEPFVYGIGDKQILTTLCPGGKERMRKLMEMVRHGRLDLSPLITHRFSLDQIEEAYDLFGNQREGVVKVGLTP

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
133 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
209 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
210 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 1.33
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0
Rhizoplane 4.33
Rhizosphere 88.67
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10072575 3300005290 Bacteria 4697
2 Ga0065715_10254987 3300005293 Bacteria 1155
3 Ga0065707_10088740 3300005295 Bacteria 4566
4 Ga0070658_10244068 3300005327 Bacteria 1523
5 Ga0070683_100006874 3300005329 Bacteria 9558
6 Ga0070683_100060964 3300005329 Bacteria 3507
7 Ga0070683_100079674 3300005329 Bacteria 3065
8 Ga0070683_100082982 3300005329 Bacteria 3002
9 Ga0070666_10035193 3300005335 Bacteria 3321
10 Ga0070680_100018183 3300005336 Bacteria 5552
11 Ga0070680_100074800 3300005336 Bacteria 2788
12 Ga0070680_100288434 3300005336 Unclassified 1391
13 Ga0070682_100025360 3300005337 Bacteria 3537
14 Ga0068868_100000261 3300005338 Bacteria 35848
15 Ga0070660_100005747 3300005339 Bacteria 8595
16 Ga0070689_100056352 3300005340 Bacteria 3047
17 Ga0070661_100058205 3300005344 Bacteria 2832
18 Ga0070692_10000217 3300005345 Bacteria 15706
19 Ga0070668_100310526 3300005347 Bacteria 1325
20 Ga0070675_100035114 3300005354 Bacteria 4073
21 Ga0070674_100000022 3300005356 Bacteria 85839
22 Ga0070674_100059029 3300005356 Bacteria 2669
23 Ga0070659_100002827 3300005366 Bacteria 12358
24 Ga0070667_100136647 3300005367 Bacteria 2144
25 Ga0070709_10031278 3300005434 Unclassified 3201
26 Ga0070714_100000718 3300005435 Bacteria 23489
27 Ga0070711_100106010 3300005439 Bacteria 2054
28 Ga0070700_100051051 3300005441 Bacteria 2573
29 Ga0070708_100050109 3300005445 Bacteria 3696
30 Ga0070663_100235584 3300005455 Bacteria 1443
31 Ga0070678_100107622 3300005456 Bacteria 2175
32 Ga0070662_100000007 3300005457 Bacteria 168761
33 Ga0070681_10037978 3300005458 Bacteria 4829
34 Ga0070681_10193178 3300005458 Bacteria 1955
35 Ga0068867_100000294 3300005459 Bacteria 32742
36 Ga0070685_10087904 3300005466 Bacteria 1876
37 Ga0070706_100187602 3300005467 Bacteria 1932
38 Ga0070707_100000279 3300005468 Bacteria 50375
39 Ga0070707_100006621 3300005468 Bacteria 10741
40 Ga0070698_100423933 3300005471 Bacteria 1265
41 Ga0070679_100082041 3300005530 Bacteria 3214
42 Ga0070684_100006068 3300005535 Bacteria 9311
43 Ga0070684_100060478 3300005535 Bacteria 3314
44 Ga0070697_100065081 3300005536 Bacteria 2978
45 Ga0070672_100283659 3300005543 Bacteria 1401
46 Ga0070686_100183118 3300005544 Bacteria 1490
47 Ga0070665_100017074 3300005548 Bacteria 7280
48 Ga0070664_100000212 3300005564 Bacteria 41477
49 Ga0068857_100019714 3300005577 Bacteria 5924
50 Ga0068857_100021641 3300005577 Bacteria 5658
51 Ga0068857_100096799 3300005577 Bacteria 2645
52 Ga0068854_100089554 3300005578 Bacteria 2287
53 Ga0068852_100019083 3300005616 Bacteria 5418
54 Ga0068852_100200864 3300005616 Bacteria 1887
55 Ga0068859_100337179 3300005617 Bacteria 1602
56 Ga0068864_100024222 3300005618 Bacteria 5104
57 Ga0068866_10000001 3300005718 Bacteria 519680
58 Ga0068866_10016114 3300005718 Bacteria 3335
59 Ga0068861_100303578 3300005719 Bacteria 1384
60 Ga0068860_100009109 3300005843 Bacteria 9878
61 Ga0068860_100450162 3300005843 Bacteria 1280
62 Ga0070717_10000001 3300006028 Bacteria 465573
63 Ga0075365_10002019 3300006038 Bacteria 9633
64 Ga0075368_10041303 3300006042 Bacteria 1812
65 Ga0075363_100010141 3300006048 Bacteria 4456
66 Ga0075363_100052826 3300006048 Bacteria 2170
67 Ga0075363_100080993 3300006048 Bacteria 1776
68 Ga0075364_10039225 3300006051 Bacteria 3070
69 Ga0075364_10093675 3300006051 Bacteria 1995
70 Ga0070715_10000001 3300006163 Bacteria 693690
71 Ga0070712_100000004 3300006175 Bacteria 215464
72 Ga0075366_10030848 3300006195 Bacteria 3153
73 Ga0075366_10075472 3300006195 Bacteria 2011
74 Ga0068871_100109186 3300006358 Bacteria 2326
75 Ga0075430_100324783 3300006846 Bacteria 1272
76 Ga0075431_100078376 3300006847 Bacteria 3410
77 Ga0068865_100013974 3300006881 Bacteria 5094
78 Ga0068865_100278486 3300006881 Bacteria 1331
79 Ga0097620_100337156 3300006931 Bacteria 1602
80 Ga0075435_100125565 3300007076 Unclassified 2144
81 Ga0105240_10147641 3300009093 Bacteria 2804
82 Ga0111539_10001108 3300009094 Bacteria 35534
83 Ga0111539_10026563 3300009094 Bacteria 7078
84 Ga0111539_10041347 3300009094 Bacteria 5542
85 Ga0111539_10045356 3300009094 Bacteria 5263
86 Ga0111539_10080696 3300009094 Bacteria 3827
87 Ga0105245_10052262 3300009098 Bacteria 3665
88 Ga0105245_10089487 3300009098 Bacteria 2830
89 Ga0105245_10205272 3300009098 Bacteria 1894
90 Ga0114129_10353368 3300009147 Bacteria 1946
91 Ga0114129_10757513 3300009147 Bacteria 1242
92 Ga0105243_10006962 3300009148 Bacteria 8708
93 Ga0105243_10229569 3300009148 Bacteria 1646
94 Ga0105248_10019118 3300009177 Bacteria 7577
95 Ga0105238_10000023 3300009551 Bacteria 196844
96 Ga0105249_10143979 3300009553 Bacteria 2288
97 Ga0105249_10391184 3300009553 Bacteria 1418
98 Ga0105246_10043147 3300011119 Bacteria 3059
99 Ga0157370_10030658 3300013104 Bacteria 5267
100 Ga0157369_10047965 3300013105 Bacteria 4635
101 Ga0157374_10003390 3300013296 Bacteria 13395
102 Ga0157378_10319166 3300013297 Bacteria 1509
103 Ga0157372_10019761 3300013307 Bacteria 7259
104 Ga0157372_10078530 3300013307 Bacteria 3729
105 Ga0157375_10000109 3300013308 Bacteria 80349
106 Ga0157375_10024471 3300013308 Bacteria 5589
107 Ga0163163_10031779 3300014325 Bacteria 5097
108 Ga0157380_10002532 3300014326 Bacteria 12336
109 Ga0157380_10053738 3300014326 Bacteria 3194
110 Ga0157379_10059498 3300014968 Bacteria 3416
111 Ga0157376_10174321 3300014969 Bacteria 1961
112 Ga0182007_10007147 3300015262 Bacteria 4714
113 Ga0206356_10484574 3300020070 Bacteria 3080
114 Ga0206354_10168787 3300020081 Bacteria 2029
115 Ga0206353_11743768 3300020082 Bacteria 4090
116 Ga0207656_10052821 3300025321 Bacteria 1761
117 Ga0207642_10000006 3300025899 Bacteria 230268
118 Ga0207642_10000007 3300025899 Bacteria 226017
119 Ga0207688_10004963 3300025901 Bacteria 7242
120 Ga0207688_10028335 3300025901 Bacteria 3081
121 Ga0207688_10070162 3300025901 Bacteria 1987
122 Ga0207685_10000011 3300025905 Bacteria 213430
123 Ga0207699_10077814 3300025906 Bacteria 2048
124 Ga0207705_10038175 3300025909 Bacteria 3438
125 Ga0207705_10148505 3300025909 Bacteria 1755
126 Ga0207707_10039267 3300025912 Bacteria 4138
127 Ga0207671_10060710 3300025914 Bacteria 2805
128 Ga0207693_10000105 3300025915 Bacteria 75790
129 Ga0207663_10011729 3300025916 Bacteria 4716
130 Ga0207660_10033578 3300025917 Bacteria 3550
131 Ga0207662_10092715 3300025918 Bacteria 1860
132 Ga0207657_10005323 3300025919 Bacteria 13486
133 Ga0207657_10008992 3300025919 Bacteria 10088
134 Ga0207649_10032191 3300025920 Bacteria 3124
135 Ga0207649_10033825 3300025920 Bacteria 3057
136 Ga0207652_10029714 3300025921 Bacteria 4572
137 Ga0207652_10197045 3300025921 Bacteria 1812
138 Ga0207646_10000514 3300025922 Bacteria 51603
139 Ga0207646_10004542 3300025922 Bacteria 15022
140 Ga0207694_10000004 3300025924 Bacteria 967075
141 Ga0207659_10071938 3300025926 Bacteria 2527
142 Ga0207659_10079501 3300025926 Bacteria 2419
143 Ga0207664_10024189 3300025929 Bacteria 4563
144 Ga0207690_10006046 3300025932 Bacteria 7170
145 Ga0207690_10014162 3300025932 Bacteria 4811
146 Ga0207690_10031577 3300025932 Bacteria 3391
147 Ga0207706_10000018 3300025933 Bacteria 168729
148 Ga0207706_10002258 3300025933 Bacteria 18812
149 Ga0207706_10235230 3300025933 Bacteria 1602
150 Ga0207706_10360603 3300025933 Bacteria 1263
151 Ga0207709_10002964 3300025935 Bacteria 10343
152 Ga0207669_10000009 3300025937 Bacteria 168012
153 Ga0207669_10003812 3300025937 Bacteria 6567
154 Ga0207704_10064930 3300025938 Bacteria 2283
155 Ga0207691_10030536 3300025940 Bacteria 5035
156 Ga0207689_10126979 3300025942 Bacteria 2098
157 Ga0207689_10151922 3300025942 Bacteria 1909
158 Ga0207661_10002951 3300025944 Bacteria 11761
159 Ga0207661_10015772 3300025944 Bacteria 5564
160 Ga0207661_10062953 3300025944 Bacteria 3003
161 Ga0207661_10100212 3300025944 Bacteria 2431
162 Ga0207712_10166484 3300025961 Bacteria 1719
163 Ga0207658_10395995 3300025986 Bacteria 1213
164 Ga0207677_10000046 3300026023 Bacteria 105382
165 Ga0207677_10096474 3300026023 Bacteria 2163
166 Ga0207703_10275957 3300026035 Bacteria 1525
167 Ga0207678_10001735 3300026067 Bacteria 19947
168 Ga0207678_10092090 3300026067 Bacteria 2591
169 Ga0207708_10002009 3300026075 Bacteria 14978
170 Ga0207708_10003988 3300026075 Bacteria 10863
171 Ga0207702_10021879 3300026078 Bacteria 5296
172 Ga0207648_10004975 3300026089 Bacteria 13515
173 Ga0207648_10025966 3300026089 Bacteria 5209
174 Ga0207648_10252098 3300026089 Bacteria 1573
175 Ga0207674_10003081 3300026116 Bacteria 20623
176 Ga0207674_10171684 3300026116 Bacteria 2121
177 Ga0207675_100362077 3300026118 Bacteria 1423
178 Ga0207683_10084981 3300026121 Bacteria 2813
179 Ga0207683_10297879 3300026121 Bacteria 1475
180 Ga0207698_10015995 3300026142 Bacteria 5045
181 Ga0207698_10118496 3300026142 Bacteria 2236
182 Ga0209813_10019256 3300027866 Bacteria 1895
183 Ga0207428_10008520 3300027907 Bacteria 9256
184 Ga0207428_10250592 3300027907 Bacteria 1320
185 Ga0268264_10003178 3300028381 Bacteria 14229
186 Ga0265326_10000042 3300028558 Bacteria 82957
187 Ga0265334_10000002 3300028573 Bacteria 325014
188 Ga0265336_10004010 3300028666 Bacteria 5629
189 Ga0265338_10001157 3300028800 Bacteria 43619
190 Ga0265324_10001178 3300029957 Bacteria 15584
191 Ga0265760_10006822 3300031090 Bacteria 3271
192 Ga0265329_10019032 3300031242 Bacteria 2338
193 Ga0265316_10004221 3300031344 Bacteria 14350
194 Ga0307410_10123885 3300031852 Bacteria 1889
195 Ga0307406_10108491 3300031901 Bacteria 1906
196 Ga0307407_10018798 3300031903 Bacteria 3505
197 Ga0307409_100261165 3300031995 Bacteria 1589
198 Ga0307416_100007499 3300032002 Bacteria 6945
199 Ga0307416_100483573 3300032002 Bacteria 1299
200 Ga0307416_100600685 3300032002 Bacteria 1180
201 Ga0307415_100085089 3300032126 Bacteria 2271
202 Ga0307415_100169727 3300032126 Bacteria 1700
203 Ga0373937_0021613 3300036401 Bacteria 5775
204 Ga0439448_0015862 3300042005 Bacteria 2287
205 Ga0451576_0046588 3300045051 Bacteria 4565
206 Ga0451576_0651223 3300045051 Unclassified 1107
207 Ga0495603_0036147 3300046455 Bacteria 2965
208 Ga0495603_0134668 3300046455 Unclassified 1438
209 Ga0495629_0003874 3300046459 Bacteria 11277
210 Ga0495651_0108466 3300046462 Bacteria 2056
211 Ga0495653_0237927 3300046463 Bacteria 1215
212 Ga0495580_0009067 3300046472 Bacteria 7848
213 Ga0495582_0000023 3300046473 Bacteria 83274
214 Ga0495582_0000135 3300046473 Bacteria 39697
215 Ga0495582_0048687 3300046473 Bacteria 2334
216 Ga0495594_0000835 3300046499 Bacteria 15912
217 Ga0495608_0008237 3300046511 Bacteria 7319
218 Ga0495618_0000053 3300046514 Bacteria 84115
219 Ga0495628_0001375 3300046516 Bacteria 22311
220 Ga0495640_0007964 3300046533 Bacteria 8333
221 Ga0495587_0033218 3300046536 Bacteria 3116
222 Ga0495622_0039753 3300046557 Bacteria 2190
223 Ga0495622_0069753 3300046557 Bacteria 1623
224 Ga0495667_0000015 3300046559 Bacteria 200377
225 Ga0495668_0121502 3300046616 Bacteria 1429
226 Ga0495634_0083604 3300046642 Bacteria 2083
227 Ga0495625_0000033 3300046660 Bacteria 228108
228 Ga0495635_0000042 3300046663 Bacteria 84550
229 Ga0495635_0316188 3300046663 Bacteria 1046
230 Ga0495657_0007415 3300046675 Bacteria 8475
231 Ga0495647_0000019 3300046681 Bacteria 78887
232 Ga0495647_0001600 3300046681 Bacteria 6994
233 Ga0495658_0000021 3300046683 Bacteria 83269
234 Ga0495613_0000042 3300046689 Bacteria 130403
235 Ga0495613_0007016 3300046689 Bacteria 8391
236 Ga0495600_0002447 3300046809 Bacteria 10649
237 Ga0495600_0067535 3300046809 Bacteria 2337
238 Ga0495600_0069934 3300046809 Bacteria 2294
239 Ga0495581_0014679 3300047315 Bacteria 4543
240 Ga0495604_0000038 3300047317 Bacteria 123703
241 Ga0495604_0010953 3300047317 Bacteria 7199
242 Ga0495636_0021861 3300047318 Bacteria 2584
243 Ga0495676_0035181 3300047321 Bacteria 4192
244 Ga0495680_0001731 3300047322 Bacteria 23178
245 Ga0495680_0025922 3300047322 Bacteria 4844
246 Ga0495680_0091980 3300047322 Bacteria 2273
247 Ga0495685_024545 3300047447 Bacteria 2075
248 Ga0495593_0056190 3300047673 Bacteria 2070
249 Ga0495614_0006205 3300048089 Bacteria 5371
250 Ga0496100_0203612 3300048903 Bacteria 1444
251 Ga0496101_0131409 3300048904 Bacteria 1901
252 Ga0496102_0459421 3300048905 Bacteria 1194
253 Ga0496104_0419624 3300048907 Bacteria 1250
254 Ga0496106_0049458 3300048909 Bacteria 3167
255 Ga0496108_0023970 3300048911 Bacteria 5023
256 Ga0496109_0000021 3300048912 Bacteria 189945
257 Ga0496109_0005505 3300048912 Bacteria 10605
258 Ga0496111_0123695 3300048914 Bacteria 1912
259 Ga0496112_0000003 3300048915 Bacteria 660147
260 Ga0496113_0038886 3300048916 Bacteria 3500
261 Ga0496113_0113382 3300048916 Bacteria 2113
262 Ga0496115_0332689 3300048918 Bacteria 1241
263 Ga0496126_0000187 3300048929 Bacteria 139670
264 Ga0501036_0015815 3300049572 Bacteria 6302
265 Ga0501036_0045765 3300049572 Bacteria 3706
266 Ga0501038_0164352 3300049574 Bacteria 1801
267 Ga0501039_0079421 3300049575 Bacteria 2552
268 Ga0501040_0013007 3300049576 Bacteria 5471
269 Ga0501040_0055990 3300049576 Bacteria 2705
270 Ga0501042_0210524 3300049578 Bacteria 1402
271 Ga0501070_0219572 3300049586 Bacteria 1559
272 Ga0501071_0028985 3300049587 Bacteria 3904
273 Ga0501071_0084502 3300049587 Bacteria 2326
274 Ga0501076_0021061 3300049592 Bacteria 4996
275 Ga0501076_0080831 3300049592 Bacteria 2609
276 Ga0501079_0043647 3300049741 Bacteria 3461
277 Ga0501080_0121419 3300049742 Bacteria 2421
278 Ga0501083_0119282 3300049744 Bacteria 1731
279 Ga0501035_0000075 3300049822 Bacteria 121646
280 Ga0501045_0036438 3300049824 Bacteria 3571
281 nmdc:mga03n38_50012_c1 3300050490 Bacteria 1861
282 nmdc:mga03n38_8465_c1 3300050490 Bacteria 3693
283 nmdc:mga00v17_130824_c1 3300050491 Bacteria 1604
284 nmdc:mga0yw44_6968_c1 3300050492 Bacteria 5519
285 nmdc:mga0k408_62280_c1 3300050493 Bacteria 2169
286 nmdc:mga07m45_92447_c1 3300050496 Bacteria 1734
287 nmdc:mga08y16_1117_c1 3300050511 Bacteria 26469
288 nmdc:mga08y16_212034_c1 3300050511 Bacteria 2006
289 nmdc:mga08y16_83441_c1 3300050511 Bacteria 3330
290 Ga0495619_0004908 3300053085 Bacteria 8492
291 Ga0495619_0006540 3300053085 Bacteria 7374
292 Ga0495619_0079636 3300053085 Bacteria 2204
293 Ga0500555_000033 3300053103 Bacteria 85640
294 Ga0500595_000007 3300053119 Bacteria 289461
295 Ga0500616_0000395 3300053153 Bacteria 59933
296 Ga0500645_000010 3300053730 Bacteria 186517
297 Ga0501084_0033261 3300054114 Bacteria 4313
298 Ga0501082_0090134 3300060353 Bacteria 2648
299 Ga0501082_0157307 3300060353 Bacteria 1974

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031090 Ga0265760_10006822 Ga0265760_100068224 317
2 3300048904 Ga0496101_0131409 Ga0496101_0131409_873_1850 319
3 3300009094 Ga0111539_10001108 Ga0111539_1000110819 329
4 3300027907 Ga0207428_10008520 Ga0207428_100085203 329
5 3300050511 nmdc:mga08y16_1117_c1 nmdc:mga08y16_1117_c1_19096_20151 329
6 3300049822 Ga0501035_0000075 Ga0501035_0000075_57832_58887 332
7 3300046663 Ga0495635_0316188 Ga0495635_0316188_29_1033 334
8 3300005843 Ga0068860_100450162 Ga0068860_1004501621 336
9 3300049586 Ga0501070_0219572 Ga0501070_0219572_438_1511 336
10 3300014326 Ga0157380_10002532 Ga0157380_1000253211 337
11 3300049578 Ga0501042_0210524 Ga0501042_0210524_353_1375 337
12 3300005336 Ga0070680_100288434 Ga0070680_1002884341 339
13 3300009094 Ga0111539_10041347 Ga0111539_100413476 339
14 3300027907 Ga0207428_10250592 Ga0207428_102505922 339
15 3300050511 nmdc:mga08y16_212034_c1 nmdc:mga08y16_212034_c1_302_1357 339
16 3300005467 Ga0070706_100187602 Ga0070706_1001876021 341
17 3300005468 Ga0070707_100006621 Ga0070707_1000066216 341
18 3300005327 Ga0070658_10244068 Ga0070658_102440682 343
19 3300005329 Ga0070683_100079674 Ga0070683_1000796743 343
20 3300005577 Ga0068857_100019714 Ga0068857_1000197142 343
21 3300005616 Ga0068852_100019083 Ga0068852_1000190833 343
22 3300020070 Ga0206356_10484574 Ga0206356_104845742 343
23 3300020082 Ga0206353_11743768 Ga0206353_117437682 343
24 3300025909 Ga0207705_10038175 Ga0207705_100381753 343
25 3300025917 Ga0207660_10033578 Ga0207660_100335781 343
26 3300025919 Ga0207657_10005323 Ga0207657_100053234 343
27 3300025920 Ga0207649_10032191 Ga0207649_100321912 343
28 3300025921 Ga0207652_10029714 Ga0207652_100297143 343
29 3300025932 Ga0207690_10014162 Ga0207690_100141622 343
30 3300025944 Ga0207661_10002951 Ga0207661_100029517 343
31 3300026078 Ga0207702_10021879 Ga0207702_100218794 343
32 3300026142 Ga0207698_10015995 Ga0207698_100159953 343
33 3300005329 Ga0070683_100082982 Ga0070683_1000829822 346
34 3300005344 Ga0070661_100058205 Ga0070661_1000582052 346
35 3300005535 Ga0070684_100060478 Ga0070684_1000604783 346
36 3300005564 Ga0070664_100000212 Ga0070664_10000021233 346
37 3300005577 Ga0068857_100096799 Ga0068857_1000967992 346
38 3300006358 Ga0068871_100109186 Ga0068871_1001091862 346
39 3300007076 Ga0075435_100125565 Ga0075435_1001255651 346
40 3300009094 Ga0111539_10080696 Ga0111539_100806962 346
41 3300025920 Ga0207649_10033825 Ga0207649_100338252 346
42 3300025944 Ga0207661_10062953 Ga0207661_100629532 346
43 3300026116 Ga0207674_10003081 Ga0207674_100030812 346
44 3300045051 Ga0451576_0651223 Ga0451576_0651223_39_1094 346
45 3300047318 Ga0495636_0021861 Ga0495636_0021861_1336_2391 346
46 3300005336 Ga0070680_100074800 Ga0070680_1000748002 347
47 3300005536 Ga0070697_100065081 Ga0070697_1000650813 347
48 3300009094 Ga0111539_10045356 Ga0111539_100453564 347
49 3300009098 Ga0105245_10052262 Ga0105245_100522623 347
50 3300009147 Ga0114129_10757513 Ga0114129_107575131 347
51 3300009148 Ga0105243_10006962 Ga0105243_100069624 347
52 3300009553 Ga0105249_10143979 Ga0105249_101439792 347
53 3300011119 Ga0105246_10043147 Ga0105246_100431472 347
54 3300013297 Ga0157378_10319166 Ga0157378_103191661 347
55 3300013307 Ga0157372_10078530 Ga0157372_100785302 347
56 3300013308 Ga0157375_10024471 Ga0157375_100244713 347
57 3300014326 Ga0157380_10053738 Ga0157380_100537383 347
58 3300015262 Ga0182007_10007147 Ga0182007_100071475 347
59 3300031903 Ga0307407_10018798 Ga0307407_100187982 347
60 3300047317 Ga0495604_0010953 Ga0495604_0010953_24_1067 347
61 3300048907 Ga0496104_0419624 Ga0496104_0419624_176_1219 347
62 3300048909 Ga0496106_0049458 Ga0496106_0049458_658_1719 347
63 3300048911 Ga0496108_0023970 Ga0496108_0023970_1237_2298 347
64 3300048912 Ga0496109_0005505 Ga0496109_0005505_3489_4550 347
65 3300048914 Ga0496111_0123695 Ga0496111_0123695_756_1817 347
66 3300048916 Ga0496113_0038886 Ga0496113_0038886_1568_2629 347
67 3300048918 Ga0496115_0332689 Ga0496115_0332689_67_1110 347
68 3300049744 Ga0501083_0119282 Ga0501083_0119282_26_1087 347
69 3300050490 nmdc:mga03n38_8465_c1 nmdc:mga03n38_8465_c1_489_1550 347
70 3300050491 nmdc:mga00v17_130824_c1 nmdc:mga00v17_130824_c1_83_1144 347
71 3300050492 nmdc:mga0yw44_6968_c1 nmdc:mga0yw44_6968_c1_463_1524 347
72 3300025933 Ga0207706_10360603 Ga0207706_103606032 348
73 3300009177 Ga0105248_10019118 Ga0105248_100191181 349
74 3300013296 Ga0157374_10003390 Ga0157374_100033906 349
75 3300013308 Ga0157375_10000109 Ga0157375_1000010933 349
76 3300014325 Ga0163163_10031779 Ga0163163_100317792 349
77 3300026075 Ga0207708_10002009 Ga0207708_1000200912 349
78 3300026142 Ga0207698_10118496 Ga0207698_101184962 349
79 3300042005 Ga0439448_0015862 Ga0439448_0015862_443_1525 349
80 3300045051 Ga0451576_0046588 Ga0451576_0046588_1405_2529 349
81 3300046455 Ga0495603_0036147 Ga0495603_0036147_1120_2172 349
82 3300046459 Ga0495629_0003874 Ga0495629_0003874_3589_4641 349
83 3300046463 Ga0495653_0237927 Ga0495653_0237927_54_1124 349
84 3300046473 Ga0495582_0048687 Ga0495582_0048687_1120_2172 349
85 3300046499 Ga0495594_0000835 Ga0495594_0000835_10059_11111 349
86 3300046511 Ga0495608_0008237 Ga0495608_0008237_991_2061 349
87 3300046557 Ga0495622_0039753 Ga0495622_0039753_725_1777 349
88 3300046616 Ga0495668_0121502 Ga0495668_0121502_69_1121 349
89 3300046689 Ga0495613_0007016 Ga0495613_0007016_7204_8256 349
90 3300047315 Ga0495581_0014679 Ga0495581_0014679_744_1796 349
91 3300047321 Ga0495676_0035181 Ga0495676_0035181_646_1698 349
92 3300047673 Ga0495593_0056190 Ga0495593_0056190_819_1871 349
93 3300048089 Ga0495614_0006205 Ga0495614_0006205_432_1484 349
94 3300048912 Ga0496109_0000021 Ga0496109_0000021_77804_78874 349
95 3300050511 nmdc:mga08y16_83441_c1 nmdc:mga08y16_83441_c1_1265_2389 349
96 3300005329 Ga0070683_100006874 Ga0070683_1000068744 350
97 3300005329 Ga0070683_100060964 Ga0070683_1000609642 350
98 3300005338 Ga0068868_100000261 Ga0068868_10000026111 350
99 3300005340 Ga0070689_100056352 Ga0070689_1000563522 350
100 3300005345 Ga0070692_10000217 Ga0070692_1000021712 350
101 3300005347 Ga0070668_100310526 Ga0070668_1003105261 350
102 3300005354 Ga0070675_100035114 Ga0070675_1000351143 350
103 3300005356 Ga0070674_100000022 Ga0070674_10000002211 350
104 3300005356 Ga0070674_100059029 Ga0070674_1000590292 350
105 3300005366 Ga0070659_100002827 Ga0070659_1000028273 350
106 3300005367 Ga0070667_100136647 Ga0070667_1001366472 350
107 3300005434 Ga0070709_10031278 Ga0070709_100312782 350
108 3300005435 Ga0070714_100000718 Ga0070714_1000007184 350
109 3300005439 Ga0070711_100106010 Ga0070711_1001060101 350
110 3300005441 Ga0070700_100051051 Ga0070700_1000510512 350
111 3300005445 Ga0070708_100050109 Ga0070708_1000501092 350
112 3300005455 Ga0070663_100235584 Ga0070663_1002355841 350
113 3300005456 Ga0070678_100107622 Ga0070678_1001076222 350
114 3300005457 Ga0070662_100000007 Ga0070662_10000000799 350
115 3300005458 Ga0070681_10193178 Ga0070681_101931782 350
116 3300005459 Ga0068867_100000294 Ga0068867_1000002943 350
117 3300005468 Ga0070707_100000279 Ga0070707_10000027956 350
118 3300005471 Ga0070698_100423933 Ga0070698_1004239331 350
119 3300005543 Ga0070672_100283659 Ga0070672_1002836591 350
120 3300005548 Ga0070665_100017074 Ga0070665_1000170747 350
121 3300005577 Ga0068857_100021641 Ga0068857_1000216413 350
122 3300005578 Ga0068854_100089554 Ga0068854_1000895542 350
123 3300005718 Ga0068866_10000001 Ga0068866_1000000186 350
124 3300005719 Ga0068861_100303578 Ga0068861_1003035782 350
125 3300005843 Ga0068860_100009109 Ga0068860_1000091094 350
126 3300006028 Ga0070717_10000001 Ga0070717_10000001124 350
127 3300006038 Ga0075365_10002019 Ga0075365_100020193 350
128 3300006048 Ga0075363_100010141 Ga0075363_1000101412 350
129 3300006048 Ga0075363_100080993 Ga0075363_1000809931 350
130 3300006051 Ga0075364_10093675 Ga0075364_100936752 350
131 3300006163 Ga0070715_10000001 Ga0070715_1000000157 350
132 3300006175 Ga0070712_100000004 Ga0070712_10000000424 350
133 3300006195 Ga0075366_10030848 Ga0075366_100308481 350
134 3300006195 Ga0075366_10075472 Ga0075366_100754722 350
135 3300006846 Ga0075430_100324783 Ga0075430_1003247832 350
136 3300006881 Ga0068865_100013974 Ga0068865_1000139742 350
137 3300006881 Ga0068865_100278486 Ga0068865_1002784861 350
138 3300009098 Ga0105245_10089487 Ga0105245_100894871 350
139 3300009147 Ga0114129_10353368 Ga0114129_103533682 350
140 3300009148 Ga0105243_10229569 Ga0105243_102295692 350
141 3300009551 Ga0105238_10000023 Ga0105238_1000002366 350
142 3300009553 Ga0105249_10391184 Ga0105249_103911841 350
143 3300014968 Ga0157379_10059498 Ga0157379_100594983 350
144 3300025321 Ga0207656_10052821 Ga0207656_100528212 350
145 3300025899 Ga0207642_10000006 Ga0207642_1000000689 350
146 3300025899 Ga0207642_10000007 Ga0207642_10000007146 350
147 3300025901 Ga0207688_10004963 Ga0207688_100049632 350
148 3300025901 Ga0207688_10028335 Ga0207688_100283352 350
149 3300025905 Ga0207685_10000011 Ga0207685_1000001158 350
150 3300025906 Ga0207699_10077814 Ga0207699_100778141 350
151 3300025909 Ga0207705_10148505 Ga0207705_101485051 350
152 3300025912 Ga0207707_10039267 Ga0207707_100392673 350
153 3300025915 Ga0207693_10000105 Ga0207693_1000010547 350
154 3300025916 Ga0207663_10011729 Ga0207663_100117295 350
155 3300025918 Ga0207662_10092715 Ga0207662_100927152 350
156 3300025919 Ga0207657_10008992 Ga0207657_100089925 350
157 3300025921 Ga0207652_10197045 Ga0207652_101970452 350
158 3300025922 Ga0207646_10000514 Ga0207646_100005142 350
159 3300025922 Ga0207646_10004542 Ga0207646_100045428 350
160 3300025924 Ga0207694_10000004 Ga0207694_10000004754 350
161 3300025926 Ga0207659_10071938 Ga0207659_100719383 350
162 3300025926 Ga0207659_10079501 Ga0207659_100795012 350
163 3300025929 Ga0207664_10024189 Ga0207664_100241894 350
164 3300025932 Ga0207690_10006046 Ga0207690_100060464 350
165 3300025932 Ga0207690_10031577 Ga0207690_100315774 350
166 3300025933 Ga0207706_10000018 Ga0207706_1000001887 350
167 3300025933 Ga0207706_10002258 Ga0207706_100022589 350
168 3300025933 Ga0207706_10235230 Ga0207706_102352302 350
169 3300025935 Ga0207709_10002964 Ga0207709_100029644 350
170 3300025937 Ga0207669_10000009 Ga0207669_1000000985 350
171 3300025937 Ga0207669_10003812 Ga0207669_100038122 350
172 3300025938 Ga0207704_10064930 Ga0207704_100649302 350
173 3300025940 Ga0207691_10030536 Ga0207691_100305363 350
174 3300025942 Ga0207689_10126979 Ga0207689_101269792 350
175 3300025942 Ga0207689_10151922 Ga0207689_101519222 350
176 3300025944 Ga0207661_10015772 Ga0207661_100157723 350
177 3300025944 Ga0207661_10100212 Ga0207661_101002122 350
178 3300025961 Ga0207712_10166484 Ga0207712_101664842 350
179 3300025986 Ga0207658_10395995 Ga0207658_103959951 350
180 3300026023 Ga0207677_10000046 Ga0207677_1000004640 350
181 3300026023 Ga0207677_10096474 Ga0207677_100964742 350
182 3300026035 Ga0207703_10275957 Ga0207703_102759572 350
183 3300026067 Ga0207678_10001735 Ga0207678_1000173516 350
184 3300026067 Ga0207678_10092090 Ga0207678_100920902 350
185 3300026075 Ga0207708_10003988 Ga0207708_100039882 350
186 3300026089 Ga0207648_10004975 Ga0207648_1000497510 350
187 3300026089 Ga0207648_10025966 Ga0207648_100259663 350
188 3300026118 Ga0207675_100362077 Ga0207675_1003620771 350
189 3300026121 Ga0207683_10084981 Ga0207683_100849812 350
190 3300026121 Ga0207683_10297879 Ga0207683_102978792 350
191 3300027866 Ga0209813_10019256 Ga0209813_100192562 350
192 3300028381 Ga0268264_10003178 Ga0268264_100031784 350
193 3300028558 Ga0265326_10000042 Ga0265326_1000004215 350
194 3300028573 Ga0265334_10000002 Ga0265334_10000002309 350
195 3300028666 Ga0265336_10004010 Ga0265336_100040106 350
196 3300028800 Ga0265338_10001157 Ga0265338_1000115720 350
197 3300029957 Ga0265324_10001178 Ga0265324_100011782 350
198 3300031242 Ga0265329_10019032 Ga0265329_100190322 350
199 3300031344 Ga0265316_10004221 Ga0265316_100042212 350
200 3300031852 Ga0307410_10123885 Ga0307410_101238851 350
201 3300031901 Ga0307406_10108491 Ga0307406_101084912 350
202 3300031995 Ga0307409_100261165 Ga0307409_1002611652 350
203 3300032002 Ga0307416_100007499 Ga0307416_1000074993 350
204 3300032002 Ga0307416_100483573 Ga0307416_1004835731 350
205 3300032002 Ga0307416_100600685 Ga0307416_1006006851 350
206 3300032126 Ga0307415_100085089 Ga0307415_1000850891 350
207 3300032126 Ga0307415_100169727 Ga0307415_1001697273 350
208 3300036401 Ga0373937_0021613 Ga0373937_0021613_566_1639 350
209 3300046455 Ga0495603_0134668 Ga0495603_0134668_231_1355 350
210 3300046462 Ga0495651_0108466 Ga0495651_0108466_905_1978 350
211 3300046472 Ga0495580_0009067 Ga0495580_0009067_1909_3033 350
212 3300046473 Ga0495582_0000023 Ga0495582_0000023_67455_68528 350
213 3300046473 Ga0495582_0000135 Ga0495582_0000135_28007_29131 350
214 3300046514 Ga0495618_0000053 Ga0495618_0000053_25532_26605 350
215 3300046516 Ga0495628_0001375 Ga0495628_0001375_6855_7928 350
216 3300046533 Ga0495640_0007964 Ga0495640_0007964_5440_6513 350
217 3300046536 Ga0495587_0033218 Ga0495587_0033218_1874_2947 350
218 3300046557 Ga0495622_0069753 Ga0495622_0069753_439_1563 350
219 3300046559 Ga0495667_0000015 Ga0495667_0000015_61803_62876 350
220 3300046642 Ga0495634_0083604 Ga0495634_0083604_521_1594 350
221 3300046663 Ga0495635_0000042 Ga0495635_0000042_68120_69193 350
222 3300046675 Ga0495657_0007415 Ga0495657_0007415_1017_2090 350
223 3300046681 Ga0495647_0000019 Ga0495647_0000019_32830_33903 350
224 3300046681 Ga0495647_0001600 Ga0495647_0001600_2467_3540 350
225 3300046683 Ga0495658_0000021 Ga0495658_0000021_67455_68528 350
226 3300046689 Ga0495613_0000042 Ga0495613_0000042_57265_58338 350
227 3300046809 Ga0495600_0002447 Ga0495600_0002447_4405_5478 350
228 3300046809 Ga0495600_0067535 Ga0495600_0067535_768_1841 350
229 3300046809 Ga0495600_0069934 Ga0495600_0069934_977_2050 350
230 3300047317 Ga0495604_0000038 Ga0495604_0000038_43683_44756 350
231 3300047322 Ga0495680_0001731 Ga0495680_0001731_14441_15514 350
232 3300047322 Ga0495680_0025922 Ga0495680_0025922_3678_4751 350
233 3300047322 Ga0495680_0091980 Ga0495680_0091980_419_1633 350
234 3300047447 Ga0495685_024545 Ga0495685_024545_636_1709 350
235 3300048903 Ga0496100_0203612 Ga0496100_0203612_256_1329 350
236 3300048905 Ga0496102_0459421 Ga0496102_0459421_32_1147 350
237 3300048915 Ga0496112_0000003 Ga0496112_0000003_281452_282525 350
238 3300049572 Ga0501036_0015815 Ga0501036_0015815_3059_4171 350
239 3300049572 Ga0501036_0045765 Ga0501036_0045765_1255_2367 350
240 3300049574 Ga0501038_0164352 Ga0501038_0164352_231_1343 350
241 3300049575 Ga0501039_0079421 Ga0501039_0079421_968_2080 350
242 3300049576 Ga0501040_0013007 Ga0501040_0013007_1460_2572 350
243 3300049576 Ga0501040_0055990 Ga0501040_0055990_1313_2425 350
244 3300049587 Ga0501071_0084502 Ga0501071_0084502_922_2034 350
245 3300049592 Ga0501076_0021061 Ga0501076_0021061_2645_3757 350
246 3300049592 Ga0501076_0080831 Ga0501076_0080831_1263_2375 350
247 3300049741 Ga0501079_0043647 Ga0501079_0043647_1362_2474 350
248 3300049824 Ga0501045_0036438 Ga0501045_0036438_1042_2154 350
249 3300050490 nmdc:mga03n38_50012_c1 nmdc:mga03n38_50012_c1_435_1547 350
250 3300050493 nmdc:mga0k408_62280_c1 nmdc:mga0k408_62280_c1_173_1285 350
251 3300050496 nmdc:mga07m45_92447_c1 nmdc:mga07m45_92447_c1_237_1349 350
252 3300053085 Ga0495619_0004908 Ga0495619_0004908_1015_2088 350
253 3300053085 Ga0495619_0006540 Ga0495619_0006540_6132_7205 350
254 3300053085 Ga0495619_0079636 Ga0495619_0079636_547_1620 350
255 3300054114 Ga0501084_0033261 Ga0501084_0033261_3168_4280 350
256 3300060353 Ga0501082_0090134 Ga0501082_0090134_25_1137 350
257 3300060353 Ga0501082_0157307 Ga0501082_0157307_841_1953 350
258 3300005335 Ga0070666_10035193 Ga0070666_100351933 352
259 3300005544 Ga0070686_100183118 Ga0070686_1001831181 352
260 3300005617 Ga0068859_100337179 Ga0068859_1003371792 352
261 3300005618 Ga0068864_100024222 Ga0068864_1000242221 352
262 3300006931 Ga0097620_100337156 Ga0097620_1003371562 352
263 3300046660 Ga0495625_0000033 Ga0495625_0000033_116953_118137 352
264 3300048929 Ga0496126_0000187 Ga0496126_0000187_134573_135679 352
265 3300053119 Ga0500595_000007 Ga0500595_000007_166887_167993 352
266 iso_pu_bacteria 2884215851 2884216645 352
267 3300006048 Ga0075363_100052826 Ga0075363_1000528262 353
268 3300006051 Ga0075364_10039225 Ga0075364_100392252 353
269 3300006847 Ga0075431_100078376 Ga0075431_1000783762 353
270 3300049742 Ga0501080_0121419 Ga0501080_0121419_393_1484 353
271 3300014969 Ga0157376_10174321 Ga0157376_101743212 356
272 3300009093 Ga0105240_10147641 Ga0105240_101476412 361
273 3300013104 Ga0157370_10030658 Ga0157370_100306583 361
274 3300013105 Ga0157369_10047965 Ga0157369_100479652 361
275 3300013307 Ga0157372_10019761 Ga0157372_100197613 361
276 3300005336 Ga0070680_100018183 Ga0070680_1000181834 364
277 3300005337 Ga0070682_100025360 Ga0070682_1000253602 364
278 3300005339 Ga0070660_100005747 Ga0070660_1000057476 364
279 3300005458 Ga0070681_10037978 Ga0070681_100379782 364
280 3300005466 Ga0070685_10087904 Ga0070685_100879042 364
281 3300005530 Ga0070679_100082041 Ga0070679_1000820412 364
282 3300005535 Ga0070684_100006068 Ga0070684_1000060681 364
283 3300020081 Ga0206354_10168787 Ga0206354_101687871 364
284 3300025901 Ga0207688_10070162 Ga0207688_100701622 364
285 3300025914 Ga0207671_10060710 Ga0207671_100607102 364
286 3300026089 Ga0207648_10252098 Ga0207648_102520982 364
287 3300026116 Ga0207674_10171684 Ga0207674_101716842 364
288 3300053103 Ga0500555_000033 Ga0500555_000033_75841_76947 364
289 3300053153 Ga0500616_0000395 Ga0500616_0000395_28717_29823 364
290 3300053730 Ga0500645_000010 Ga0500645_000010_102245_103351 364
291 3300009098 Ga0105245_10205272 Ga0105245_102052722 366
292 3300048916 Ga0496113_0113382 Ga0496113_0113382_70_1200 366
293 3300005290 Ga0065712_10072575 Ga0065712_100725754 367
294 3300005293 Ga0065715_10254987 Ga0065715_102549871 367
295 3300005295 Ga0065707_10088740 Ga0065707_100887404 367
296 3300005616 Ga0068852_100200864 Ga0068852_1002008642 367
297 3300005718 Ga0068866_10016114 Ga0068866_100161142 367
298 3300006042 Ga0075368_10041303 Ga0075368_100413032 367
299 3300009094 Ga0111539_10026563 Ga0111539_100265634 367
300 3300049587 Ga0501071_0028985 Ga0501071_0028985_228_1385 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

233

365

0.94

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

74

194

0.92

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

266

395

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xl5-assembly1.cif.gz_A-2 crystal structure of the h42t/a85g/i86a mutant of a nadp-dependent alcohol dehydrogenase 0.9188 4 350
6sdm-assembly1.cif.gz_B nadh-dependent variant of tbadh 0.9177 2 350
7uut-assembly1.cif.gz_A ternary complex crystal structure of secondary alcohol dehydrogenases from the thermoanaerobacter ethanolicus mutants c295a and i86a provides better understanding of catalytic mechanism 0.9141 4 350
1ped-assembly1.cif.gz_B bacterial secondary alcohol dehydrogenase (apo-form) 0.9141 4 350
2nvb-assembly1.cif.gz_A contribution of pro275 to the thermostability of the alcohol dehydrogenases (adhs) 0.9134 4 350
ID Description Score Start End Superfamily
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9257 165 291 3.40.50.720
af_O07737_155_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9146 161 290 3.40.50.720
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9119 165 291 3.40.50.720
af_Q8BGC4_30_129_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9033 3 85 3.90.180.10
1ntoA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8999 159 293 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A101ITM8-F1-model_v4 Alcohol dehydrogenase zinc-binding domain protein 0.9526 153 271 GO:0016020
AF-A0A6L8I1I5-F1-model_v4 Zinc-binding dehydrogenase 0.9441 139 351 GO:0016491
GO:0046872
AF-A0A0U5BK63-F1-model_v4 Glutathione-independent formaldehyde dehydrogenase 0.9372 144 243 GO:0003677
GO:0004803
GO:0006313
AF-A0A538EJP1-F1-model_v4 Zinc-binding dehydrogenase 0.9371 156 353 GO:0046872
AF-A0A4R1PRJ9-F1-model_v4 Zinc-binding dehydrogenase 0.9356 214 351

Feature Viewer

pLDDT pTM Quality
87.68 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map