F395503

General Info

Members Datasets Scaffolds Average Seq Length
300 213 600 241

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0000848|Ga0466963_0000848_6754_7551
Length 265
Sequence VGTTTGRDEGTDVPSTGTGPAPDTDSGTSAGKNGRRRGGGPVATAVGVFGELLITGGLVLGLFVVYSLWWTNVIADRQADRRADKVRHNWEASAPGGKGPGALDTGDGIGFLHVPSMRNGEVLVRRGTSTDVLNGGVAGYYTDPVKATLPTTGKDGNFALAAHRDGHGAKFHNIDKVEKGDPVVFETKDDWYVYKVFAILPETSKYNVKVLGSVPEQAGVKKPGHYITLTTCTPVYTSRYRYVVWGRLVRVDKVDADRTPPKELG

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
5 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
6 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
7 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
9 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
10 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
11 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
12 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
13 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
14 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
17 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
18 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
19 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
20 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
21 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
37 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
38 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
41 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
42 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
43 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
44 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
45 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
46 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
47 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
48 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
49 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
50 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
51 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
52 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
53 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
64 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
65 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
69 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
70 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
71 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
72 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
73 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
74 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
75 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
81 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
82 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
83 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
98 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
133 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
134 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
149 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
151 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
152 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
153 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
154 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
155 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
156 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
157 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
158 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
159 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
160 2643221548 Streptomyces sp. Root55 Isolate Unclassified
161 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
162 2643221647 Streptomyces sp. Root369 Isolate Unclassified
163 2643221670 Streptomyces sp. Root431 Isolate Unclassified
164 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
165 2643221714 Streptomyces sp. Root264 Isolate Unclassified
166 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
167 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
168 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
169 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
170 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
171 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
172 2808606448 Streptomyces sp. 193411 Isolate Unclassified
173 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
174 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
175 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
176 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
177 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
178 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
179 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
180 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
181 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
182 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
183 2867428634 Streptomyces sp. RP5T Isolate Unclassified
184 2867475112 Streptomyces sp. TM32 Isolate Unclassified
185 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
186 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
187 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
188 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
189 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
190 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
191 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
192 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
193 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
194 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
195 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
196 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
197 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
198 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
199 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
200 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
201 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
202 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
203 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
204 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
205 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
206 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
207 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
208 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
209 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
210 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
211 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
212 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
213 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80
Metatranscriptomes 0
Isolates 20

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.67
Nodule 0
Rhizoplane 1
Rhizosphere 81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0000848 3300044694 Bacteria 15396
2 rootL2_10041285 3300003322 Bacteria 1542
3 JGI25160J50197_1056735 3300003354 Bacteria 801
4 Ga0068853_100332296 3300005539 Bacteria 1411
5 Ga0068855_100276524 3300005563 Bacteria 1866
6 Ga0068856_100414726 3300005614 Bacteria 1367
7 Ga0081539_10093811 3300005985 Bacteria 1545
8 Ga0075367_10001177 3300006178 Bacteria 10965
9 Ga0105250_10070161 3300009092 Bacteria 1415
10 Ga0105245_10412628 3300009098 Bacteria 1352
11 Ga0105248_10158204 3300009177 Bacteria 2556
12 Ga0105239_10583204 3300010375 Bacteria 1275
13 Ga0105246_10001055 3300011119 Bacteria 15889
14 Ga0105246_10621680 3300011119 Bacteria 936
15 Ga0105246_10871906 3300011119 Bacteria 805
16 Ga0157369_10389694 3300013105 Bacteria 1446
17 Ga0157372_10012866 3300013307 Bacteria 8920
18 Ga0182008_10001329 3300014497 Bacteria 16860
19 Ga0182007_10001301 3300015262 Bacteria 13503
20 Ga0183367_1008 3300015688 Bacteria 490626
21 Ga0209758_1005444 3300025297 Bacteria 9802
22 Ga0207426_1004266 3300025302 Bacteria 7086
23 Ga0207426_1012921 3300025302 Bacteria 3117
24 Ga0207647_10004704 3300025904 Bacteria 10106
25 Ga0207644_10196299 3300025931 Bacteria 1590
26 Ga0207709_10133339 3300025935 Bacteria 1696
27 Ga0207691_10215751 3300025940 Bacteria 1665
28 Ga0207711_10051088 3300025941 Bacteria 3539
29 Ga0207702_10343263 3300026078 Bacteria 1427
30 Ga0207674_10528688 3300026116 Bacteria 1139
31 Ga0307517_10015666 3300028786 Bacteria 10048
32 Ga0307515_10013647 3300028794 Bacteria 15141
33 Ga0307511_10009345 3300030521 Bacteria 9770
34 Ga0307511_10034923 3300030521 Bacteria 4401
35 Ga0307512_10003822 3300030522 Bacteria 16980
36 Ga0307513_10050998 3300031456 Bacteria 4468
37 Ga0307513_10083753 3300031456 Bacteria 3278
38 Ga0307509_10051870 3300031507 Bacteria 4381
39 Ga0307408_100266263 3300031548 Bacteria 1421
40 Ga0307508_10001438 3300031616 Bacteria 26820
41 Ga0307508_10007608 3300031616 Bacteria 10068
42 Ga0307508_10023540 3300031616 Bacteria 5591
43 Ga0307508_10099075 3300031616 Bacteria 2508
44 Ga0307514_10002283 3300031649 Bacteria 20311
45 Ga0307514_10050914 3300031649 Bacteria 3212
46 Ga0307516_10209515 3300031730 Bacteria 1664
47 Ga0307518_10094223 3300031838 Bacteria 2151
48 Ga0307518_10178868 3300031838 Bacteria 1436
49 Ga0307416_100312652 3300032002 Bacteria 1568
50 Ga0307507_10017670 3300033179 Bacteria 8172
51 Ga0307510_10009775 3300033180 Bacteria 11413
52 Ga0307510_10056424 3300033180 Bacteria 4090
53 Ga0395899_0060276 3300037312 Bacteria 2796
54 Ga0395900_0038036 3300037418 Bacteria 4961
55 Ga0395898_0002467 3300037466 Bacteria 21817
56 Ga0395898_0002590 3300037466 Bacteria 21126
57 Ga0395905_0123761 3300037471 Bacteria 2432
58 Ga0395901_0566235 3300038443 Bacteria 1150
59 Ga0439454_015709 3300042011 Bacteria 1063
60 Ga0439457_001660 3300042014 Bacteria 6608
61 Ga0450894_003066 3300042131 Bacteria 2204
62 Ga0450906_004411 3300042145 Bacteria 2950
63 Ga0466969_0011841 3300044656 Bacteria 4612
64 Ga0466972_0001883 3300044658 Bacteria 10293
65 Ga0466972_0012991 3300044658 Bacteria 4183
66 Ga0466972_0103250 3300044658 Bacteria 1348
67 Ga0466965_0028575 3300044683 Bacteria 2710
68 Ga0466966_0006565 3300044684 Bacteria 7701
69 Ga0466961_0050489 3300044693 Bacteria 2656
70 Ga0466961_0178931 3300044693 Bacteria 1317
71 Ga0466964_0004159 3300044706 Bacteria 5322
72 Ga0466971_0000467 3300044719 Bacteria 15848
73 Ga0466971_0018523 3300044719 Bacteria 3084
74 Ga0466968_0003566 3300044735 Bacteria 5755
75 Ga0466970_0001720 3300044765 Bacteria 10536
76 Ga0466957_0004536 3300044842 Bacteria 7751
77 Ga0466960_0001906 3300044901 Bacteria 7685
78 Ga0466967_0043469 3300045976 Bacteria 3890
79 Ga0466967_0868780 3300045976 Bacteria 896
80 Ga0466967_0875585 3300045976 Bacteria 893
81 Ga0495617_047220 3300046452 Bacteria 1434
82 Ga0495627_033707 3300046453 Bacteria 1604
83 Ga0495592_0003299 3300046454 Bacteria 11564
84 Ga0495592_0028493 3300046454 Bacteria 4229
85 Ga0495603_0004876 3300046455 Bacteria 8024
86 Ga0495603_0008368 3300046455 Bacteria 6251
87 Ga0495603_0052022 3300046455 Bacteria 2432
88 Ga0495629_0004678 3300046459 Bacteria 10254
89 Ga0495629_0006000 3300046459 Bacteria 9033
90 Ga0495629_0014350 3300046459 Bacteria 5699
91 Ga0495629_0025692 3300046459 Bacteria 4185
92 Ga0495629_0034281 3300046459 Bacteria 3589
93 Ga0495629_0052907 3300046459 Bacteria 2841
94 Ga0495651_0000900 3300046462 Bacteria 23054
95 Ga0495651_0049919 3300046462 Bacteria 3229
96 Ga0495580_0156582 3300046472 Bacteria 1577
97 Ga0495582_0244463 3300046473 Bacteria 1029
98 Ga0495605_0002138 3300046474 Bacteria 12351
99 Ga0495639_0015544 3300046475 Bacteria 3300
100 Ga0495662_0001347 3300046476 Bacteria 12146
101 Ga0495662_0001532 3300046476 Bacteria 11473
102 Ga0495662_0023890 3300046476 Bacteria 2952
103 Ga0495662_0027460 3300046476 Bacteria 2749
104 Ga0495664_0004010 3300046477 Bacteria 8038
105 Ga0495585_0074970 3300046492 Bacteria 1840
106 Ga0495594_0000269 3300046499 Bacteria 25583
107 Ga0495594_0009737 3300046499 Bacteria 4973
108 Ga0495596_0064368 3300046500 Bacteria 1426
109 Ga0495607_0009910 3300046501 Bacteria 6421
110 Ga0495583_0023766 3300046506 Bacteria 3092
111 Ga0495606_0088305 3300046507 Bacteria 1911
112 Ga0495610_0024691 3300046512 Bacteria 3239
113 Ga0495620_0018625 3300046515 Bacteria 3435
114 Ga0495628_0036987 3300046516 Bacteria 3915
115 Ga0495628_0049171 3300046516 Bacteria 3339
116 Ga0495630_0070677 3300046517 Bacteria 2626
117 Ga0495631_0018857 3300046518 Bacteria 3242
118 Ga0495631_0055652 3300046518 Bacteria 1724
119 Ga0495632_0076657 3300046519 Bacteria 1599
120 Ga0495643_0003627 3300046522 Bacteria 11219
121 Ga0495648_0050719 3300046524 Bacteria 2533
122 Ga0495666_0245984 3300046526 Bacteria 815
123 Ga0495652_0075370 3300046529 Bacteria 2802
124 Ga0495652_0075804 3300046529 Bacteria 2792
125 Ga0495654_0027749 3300046530 Bacteria 2898
126 Ga0495640_0059328 3300046533 Bacteria 2606
127 Ga0495586_0016820 3300046535 Bacteria 3893
128 Ga0495587_0000405 3300046536 Bacteria 30522
129 Ga0495609_0211640 3300046538 Bacteria 807
130 Ga0495597_0026936 3300046542 Bacteria 2639
131 Ga0495622_0016325 3300046557 Bacteria 3456
132 Ga0495622_0017728 3300046557 Bacteria 3314
133 Ga0495622_0063780 3300046557 Bacteria 1704
134 Ga0495633_0022787 3300046558 Bacteria 3110
135 Ga0495667_0253868 3300046559 Bacteria 1119
136 Ga0495668_0095139 3300046616 Bacteria 1630
137 Ga0495634_0002661 3300046642 Bacteria 14689
138 Ga0495611_0004672 3300046648 Bacteria 5880
139 Ga0495611_0075298 3300046648 Bacteria 1547
140 Ga0495625_0007186 3300046660 Bacteria 9759
141 Ga0495635_0003903 3300046663 Bacteria 10363
142 Ga0495635_0034327 3300046663 Bacteria 3518
143 Ga0495635_0562901 3300046663 Bacteria 746
144 Ga0495588_0001299 3300046674 Bacteria 10689
145 Ga0495588_0016805 3300046674 Bacteria 3540
146 Ga0495657_0024966 3300046675 Bacteria 4247
147 Ga0495657_0068986 3300046675 Bacteria 2314
148 Ga0495657_0153143 3300046675 Bacteria 1430
149 Ga0495646_0001203 3300046680 Bacteria 15150
150 Ga0495646_0069302 3300046680 Bacteria 2081
151 Ga0495613_0003124 3300046689 Bacteria 12401
152 Ga0495613_0003426 3300046689 Bacteria 11853
153 Ga0495613_0014903 3300046689 Bacteria 5769
154 Ga0495613_0016945 3300046689 Bacteria 5424
155 Ga0495613_0056638 3300046689 Bacteria 2878
156 Ga0495613_0153411 3300046689 Bacteria 1641
157 Ga0495670_0030849 3300046691 Bacteria 2663
158 Ga0495649_0210139 3300046694 Bacteria 1008
159 Ga0495589_0005176 3300046794 Bacteria 6895
160 Ga0495589_0021632 3300046794 Bacteria 3286
161 Ga0495589_0093403 3300046794 Bacteria 1460
162 Ga0495600_0005666 3300046809 Bacteria 7542
163 Ga0495600_0029005 3300046809 Bacteria 3582
164 Ga0495600_0190929 3300046809 Bacteria 1317
165 Ga0495581_0017514 3300047315 Bacteria 4162
166 Ga0495581_0025186 3300047315 Bacteria 3450
167 Ga0495581_0052102 3300047315 Bacteria 2364
168 Ga0495581_0098481 3300047315 Bacteria 1698
169 Ga0495604_0000211 3300047317 Bacteria 53509
170 Ga0495604_0018809 3300047317 Bacteria 5531
171 Ga0495604_0430705 3300047317 Bacteria 864
172 Ga0495636_0030346 3300047318 Bacteria 2210
173 Ga0495636_0080089 3300047318 Bacteria 1405
174 Ga0495674_0184033 3300047319 Bacteria 1738
175 Ga0495676_0002562 3300047321 Bacteria 16183
176 Ga0495676_0006337 3300047321 Bacteria 10898
177 Ga0495676_0089834 3300047321 Bacteria 2300
178 Ga0495676_0108776 3300047321 Bacteria 2038
179 Ga0495680_0007049 3300047322 Bacteria 10358
180 Ga0495683_0030810 3300047323 Bacteria 2735
181 Ga0495683_0095962 3300047323 Bacteria 1431
182 Ga0495683_0230985 3300047323 Bacteria 820
183 Ga0495687_003956 3300047443 Bacteria 10353
184 Ga0495675_0016301 3300047444 Bacteria 4701
185 Ga0495675_0034892 3300047444 Bacteria 3212
186 Ga0495685_002480 3300047447 Bacteria 5785
187 Ga0495685_010920 3300047447 Bacteria 3053
188 Ga0495685_015556 3300047447 Bacteria 2596
189 Ga0495685_083790 3300047447 Bacteria 1060
190 Ga0495681_0004864 3300047470 Bacteria 9081
191 Ga0495681_0035540 3300047470 Bacteria 2473
192 Ga0495686_0079918 3300047472 Bacteria 1999
193 Ga0495593_0007340 3300047673 Bacteria 6455
194 Ga0495593_0045200 3300047673 Bacteria 2351
195 Ga0495593_0047706 3300047673 Bacteria 2277
196 Ga0495602_0178893 3300048088 Bacteria 1638
197 Ga0495614_0000405 3300048089 Bacteria 17587
198 Ga0495614_0008599 3300048089 Bacteria 4538
199 Ga0495614_0093531 3300048089 Bacteria 1309
200 Ga0495626_0017204 3300048091 Bacteria 3657
201 Ga0496106_0499789 3300048909 Bacteria 977
202 Ga0496109_0035311 3300048912 Bacteria 4509
203 Ga0496121_0145874 3300048924 Bacteria 1749
204 Ga0495678_038530 3300049459 Bacteria 1933
205 Ga0495682_0125672 3300049460 Bacteria 918
206 Ga0501031_0004199 3300049568 Bacteria 9308
207 Ga0501032_0036418 3300049569 Bacteria 3358
208 Ga0501032_0078632 3300049569 Bacteria 2196
209 Ga0501033_0001943 3300049570 Bacteria 17996
210 Ga0501033_0008815 3300049570 Bacteria 7795
211 Ga0501034_0009031 3300049571 Bacteria 10466
212 Ga0501034_0030407 3300049571 Bacteria 5490
213 Ga0501036_0000606 3300049572 Bacteria 26021
214 Ga0501036_0018725 3300049572 Bacteria 5807
215 Ga0501037_0004923 3300049573 Bacteria 9720
216 Ga0501038_0001743 3300049574 Bacteria 20226
217 Ga0501039_0002299 3300049575 Bacteria 14180
218 Ga0501043_0005014 3300049579 Bacteria 10718
219 Ga0501043_0174335 3300049579 Bacteria 1677
220 Ga0501046_0032656 3300049580 Bacteria 4213
221 Ga0501046_0059661 3300049580 Bacteria 2988
222 Ga0501047_0019602 3300049581 Bacteria 6491
223 Ga0501047_0029049 3300049581 Bacteria 5333
224 Ga0501047_0030716 3300049581 Bacteria 5178
225 Ga0501047_0395391 3300049581 Bacteria 1215
226 Ga0501048_0095481 3300049582 Bacteria 2096
227 Ga0501070_0006484 3300049586 Bacteria 9960
228 Ga0501074_0000971 3300049590 Bacteria 18563
229 Ga0501282_009282 3300049778 Bacteria 1056
230 Ga0501035_0000852 3300049822 Bacteria 32539
231 Ga0501035_0200777 3300049822 Bacteria 1710
232 Ga0501044_0008227 3300049823 Bacteria 11443
233 Ga0501044_0023983 3300049823 Bacteria 6482
234 Ga0501044_0113224 3300049823 Bacteria 2720
235 Ga0501044_0180579 3300049823 Bacteria 2077
236 nmdc:mga06z11_586_c1 3300050494 Bacteria 13318
237 Ga0500560_011143 3300053107 Bacteria 2283
238 Ga0500572_009234 3300053111 Bacteria 2326
239 Ga0466962_0002527 3300061719 Bacteria 8686
240 Ga0466962_0156669 3300061719 Bacteria 1106
241 2547406161 2547132111 Bacteria 8013147
242 2585298407 2582581312 Bacteria 7308206
243 2585305701 2582581313 Bacteria 10042643
244 2585314609 2582581314 Bacteria 11452267
245 2616702093 2616644814 Bacteria 11555299
246 2643763196 2643221548 Bacteria 8053412
247 2643947966 2643221587 Bacteria 7586415
248 2644262825 2643221647 Bacteria 10741251
249 2644390598 2643221670 Bacteria 6497041
250 2644463934 2643221682 Bacteria 6743283
251 2644627159 2643221714 Bacteria 9015452
252 2784589086 2784132148 Bacteria 8627943
253 2786671109 2786546132 Bacteria 10419719
254 2793983517 2791355406 Bacteria 11364898
255 2804846290 2802429296 Bacteria 7227771
256 2808842547 2808606359 Bacteria 9866990
257 2808921054 2808606375 Bacteria 9466072
258 2809232688 2808606448 Bacteria 8656184
259 2811845693 2808606982 Bacteria 7791042
260 2812357569 2811994879 Bacteria 9313447
261 2812480090 2811994917 Bacteria 7761064
262 2819697440 2818991463 Bacteria 7948711
263 2819741551 2818991472 Bacteria 10089953
264 2852637354 2852635781 Bacteria 8251373
265 2862286138 2862281513 Bacteria 9621493
266 2862295617 2862290372 Bacteria 7471434
267 2862508205 2862507626 Bacteria 9425308
268 2863412657 2863404153 Bacteria 9672205
269 2867430585 2867428634 Bacteria 9590268
270 2867476924 2867475112 Bacteria 6909112
271 2873155269 2873151551 Bacteria 8625867
272 2877680588 2877676314 Bacteria 9512378
273 2912719294 2912715099 Bacteria 9460473
274 2912724011 2912723979 Bacteria 8557534
275 2912731518 2912723979 Bacteria 8557534
276 2912761367 2912757875 Bacteria 7940295
277 2918505022 2918501144 Bacteria 8668083
278 2946068285 2946064051 Bacteria 8957905
279 2946076427 2946072368 Bacteria 8999607
280 2947228636 2947224130 Bacteria 9938529
281 2954385715 2954380949 Bacteria 10050426
282 2954677440 2954673503 Bacteria 9685905
283 2954686714 2954682443 Bacteria 9862841
284 2954696362 2954691527 Bacteria 10720516
285 2954705915 2954701450 Bacteria 10834262
286 2966602161 2966598605 Bacteria 7676064
287 2997604615 2997600082 Bacteria 9896405
288 3006399211 3006393351 Bacteria 6615579
289 3006425799 3006425503 Bacteria 6491253
290 3006499463 3006493962 Bacteria 8825450
291 8008578451 8008574985 Bacteria 7815457
292 8025419953 8025413630 Bacteria 7014048
293 8025534493 8025530807 Bacteria 8495698
294 8047897529 8047893842 Bacteria 11723082
295 8048127883 8048127548 Bacteria 11053136
296 8048361341 8048356638 Bacteria 11044339
297 8048374516 8048369669 Bacteria 11666822
298 8048383706 8048379754 Bacteria 11877923
299 8054167498 8054160619 Bacteria 7783213
300 8056837983 8056829672 Bacteria 9045328
301 Ga0466963_0000848
302 rootL2_10041285
303 JGI25160J50197_1056735
304 Ga0068853_100332296
305 Ga0068855_100276524
306 Ga0068856_100414726
307 Ga0081539_10093811
308 Ga0075367_10001177
309 Ga0105250_10070161
310 Ga0105245_10412628
311 Ga0105248_10158204
312 Ga0105239_10583204
313 Ga0105246_10001055
314 Ga0105246_10621680
315 Ga0105246_10871906
316 Ga0157369_10389694
317 Ga0157372_10012866
318 Ga0182008_10001329
319 Ga0182007_10001301
320 Ga0183367_1008
321 Ga0209758_1005444
322 Ga0207426_1004266
323 Ga0207426_1012921
324 Ga0207647_10004704
325 Ga0207644_10196299
326 Ga0207709_10133339
327 Ga0207691_10215751
328 Ga0207711_10051088
329 Ga0207702_10343263
330 Ga0207674_10528688
331 Ga0307517_10015666
332 Ga0307515_10013647
333 Ga0307511_10009345
334 Ga0307511_10034923
335 Ga0307512_10003822
336 Ga0307513_10050998
337 Ga0307513_10083753
338 Ga0307509_10051870
339 Ga0307408_100266263
340 Ga0307508_10001438
341 Ga0307508_10007608
342 Ga0307508_10023540
343 Ga0307508_10099075
344 Ga0307514_10002283
345 Ga0307514_10050914
346 Ga0307516_10209515
347 Ga0307518_10094223
348 Ga0307518_10178868
349 Ga0307416_100312652
350 Ga0307507_10017670
351 Ga0307510_10009775
352 Ga0307510_10056424
353 Ga0395899_0060276
354 Ga0395900_0038036
355 Ga0395898_0002467
356 Ga0395898_0002590
357 Ga0395905_0123761
358 Ga0395901_0566235
359 Ga0439454_015709
360 Ga0439457_001660
361 Ga0450894_003066
362 Ga0450906_004411
363 Ga0466969_0011841
364 Ga0466972_0001883
365 Ga0466972_0012991
366 Ga0466972_0103250
367 Ga0466965_0028575
368 Ga0466966_0006565
369 Ga0466961_0050489
370 Ga0466961_0178931
371 Ga0466964_0004159
372 Ga0466971_0000467
373 Ga0466971_0018523
374 Ga0466968_0003566
375 Ga0466970_0001720
376 Ga0466957_0004536
377 Ga0466960_0001906
378 Ga0466967_0043469
379 Ga0466967_0868780
380 Ga0466967_0875585
381 Ga0495617_047220
382 Ga0495627_033707
383 Ga0495592_0003299
384 Ga0495592_0028493
385 Ga0495603_0004876
386 Ga0495603_0008368
387 Ga0495603_0052022
388 Ga0495629_0004678
389 Ga0495629_0006000
390 Ga0495629_0014350
391 Ga0495629_0025692
392 Ga0495629_0034281
393 Ga0495629_0052907
394 Ga0495651_0000900
395 Ga0495651_0049919
396 Ga0495580_0156582
397 Ga0495582_0244463
398 Ga0495605_0002138
399 Ga0495639_0015544
400 Ga0495662_0001347
401 Ga0495662_0001532
402 Ga0495662_0023890
403 Ga0495662_0027460
404 Ga0495664_0004010
405 Ga0495585_0074970
406 Ga0495594_0000269
407 Ga0495594_0009737
408 Ga0495596_0064368
409 Ga0495607_0009910
410 Ga0495583_0023766
411 Ga0495606_0088305
412 Ga0495610_0024691
413 Ga0495620_0018625
414 Ga0495628_0036987
415 Ga0495628_0049171
416 Ga0495630_0070677
417 Ga0495631_0018857
418 Ga0495631_0055652
419 Ga0495632_0076657
420 Ga0495643_0003627
421 Ga0495648_0050719
422 Ga0495666_0245984
423 Ga0495652_0075370
424 Ga0495652_0075804
425 Ga0495654_0027749
426 Ga0495640_0059328
427 Ga0495586_0016820
428 Ga0495587_0000405
429 Ga0495609_0211640
430 Ga0495597_0026936
431 Ga0495622_0016325
432 Ga0495622_0017728
433 Ga0495622_0063780
434 Ga0495633_0022787
435 Ga0495667_0253868
436 Ga0495668_0095139
437 Ga0495634_0002661
438 Ga0495611_0004672
439 Ga0495611_0075298
440 Ga0495625_0007186
441 Ga0495635_0003903
442 Ga0495635_0034327
443 Ga0495635_0562901
444 Ga0495588_0001299
445 Ga0495588_0016805
446 Ga0495657_0024966
447 Ga0495657_0068986
448 Ga0495657_0153143
449 Ga0495646_0001203
450 Ga0495646_0069302
451 Ga0495613_0003124
452 Ga0495613_0003426
453 Ga0495613_0014903
454 Ga0495613_0016945
455 Ga0495613_0056638
456 Ga0495613_0153411
457 Ga0495670_0030849
458 Ga0495649_0210139
459 Ga0495589_0005176
460 Ga0495589_0021632
461 Ga0495589_0093403
462 Ga0495600_0005666
463 Ga0495600_0029005
464 Ga0495600_0190929
465 Ga0495581_0017514
466 Ga0495581_0025186
467 Ga0495581_0052102
468 Ga0495581_0098481
469 Ga0495604_0000211
470 Ga0495604_0018809
471 Ga0495604_0430705
472 Ga0495636_0030346
473 Ga0495636_0080089
474 Ga0495674_0184033
475 Ga0495676_0002562
476 Ga0495676_0006337
477 Ga0495676_0089834
478 Ga0495676_0108776
479 Ga0495680_0007049
480 Ga0495683_0030810
481 Ga0495683_0095962
482 Ga0495683_0230985
483 Ga0495687_003956
484 Ga0495675_0016301
485 Ga0495675_0034892
486 Ga0495685_002480
487 Ga0495685_010920
488 Ga0495685_015556
489 Ga0495685_083790
490 Ga0495681_0004864
491 Ga0495681_0035540
492 Ga0495686_0079918
493 Ga0495593_0007340
494 Ga0495593_0045200
495 Ga0495593_0047706
496 Ga0495602_0178893
497 Ga0495614_0000405
498 Ga0495614_0008599
499 Ga0495614_0093531
500 Ga0495626_0017204
501 Ga0496106_0499789
502 Ga0496109_0035311
503 Ga0496121_0145874
504 Ga0495678_038530
505 Ga0495682_0125672
506 Ga0501031_0004199
507 Ga0501032_0036418
508 Ga0501032_0078632
509 Ga0501033_0001943
510 Ga0501033_0008815
511 Ga0501034_0009031
512 Ga0501034_0030407
513 Ga0501036_0000606
514 Ga0501036_0018725
515 Ga0501037_0004923
516 Ga0501038_0001743
517 Ga0501039_0002299
518 Ga0501043_0005014
519 Ga0501043_0174335
520 Ga0501046_0032656
521 Ga0501046_0059661
522 Ga0501047_0019602
523 Ga0501047_0029049
524 Ga0501047_0030716
525 Ga0501047_0395391
526 Ga0501048_0095481
527 Ga0501070_0006484
528 Ga0501074_0000971
529 Ga0501282_009282
530 Ga0501035_0000852
531 Ga0501035_0200777
532 Ga0501044_0008227
533 Ga0501044_0023983
534 Ga0501044_0113224
535 Ga0501044_0180579
536 nmdc:mga06z11_586_c1
537 Ga0500560_011143
538 Ga0500572_009234
539 Ga0466962_0002527
540 Ga0466962_0156669
541 2547406161
542 2585298407
543 2585305701
544 2585314609
545 2616702093
546 2643763196
547 2643947966
548 2644262825
549 2644390598
550 2644463934
551 2644627159
552 2784589086
553 2786671109
554 2793983517
555 2804846290
556 2808842547
557 2808921054
558 2809232688
559 2811845693
560 2812357569
561 2812480090
562 2819697440
563 2819741551
564 2852637354
565 2862286138
566 2862295617
567 2862508205
568 2863412657
569 2867430585
570 2867476924
571 2873155269
572 2877680588
573 2912719294
574 2912724011
575 2912731518
576 2912761367
577 2918505022
578 2946068285
579 2946076427
580 2947228636
581 2954385715
582 2954677440
583 2954686714
584 2954696362
585 2954705915
586 2966602161
587 2997604615
588 3006399211
589 3006425799
590 3006499463
591 8008578451
592 8025419953
593 8025534493
594 8047897529
595 8048127883
596 8048361341
597 8048374516
598 8048383706
599 8054167498
600 8056837983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04203

Sortase

Sortase domain

112

249

0.84

Map