F395465
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 300 | 229 | 286 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0128298|Ga0373925_0128298_512_1165 |
| Length | 205 |
| Sequence | VLVVEDERLLADSIAEGLRRFAMAVDVCYDGECALERVGVHEYDVVVLDRDLPDVSGDEVCAAVIAAGDVSDRVEGLGLGADDYLTKPFAFSELVARVQALGRRARPALPPVLSAHGVVLDLPRHQASRDGRFLPLSPKEFAVLRVLMRADGTVVSVESLLEKAWDEHADPFTNAVRMAVMTLRRKLGDPPLIETVPGAGYRFGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 2 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 3 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 4 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 5 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 6 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 7 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 8 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 9 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 10 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 23 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 24 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 25 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 30 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 31 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 32 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 35 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 36 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 37 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 53 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 70 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 71 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 72 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 73 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 74 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 75 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 76 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 77 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 78 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 79 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 80 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 81 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 82 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 83 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 84 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 85 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 86 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 87 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 88 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 89 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 90 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 91 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 92 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 93 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 95 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 96 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 97 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 98 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 99 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 100 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 101 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 102 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 105 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 106 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 109 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 110 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 111 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 112 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 113 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 114 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 115 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 116 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 117 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 118 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 119 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 120 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 175 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 198 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 199 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 201 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 202 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 203 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 204 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 205 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 206 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 208 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 213 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 214 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 215 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 216 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 217 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 218 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 219 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 220 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 221 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 222 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 223 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 224 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 225 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 227 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 228 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 229 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.33 |
| Metatranscriptomes | 0 |
| Isolates | 4.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11 |
| Nodule | 0 |
| Rhizoplane | 2.33 |
| Rhizosphere | 72.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10001742 | 3300003203 | Bacteria | 10232 |
| 2 | Ga0070683_100353822 | 3300005329 | Bacteria | 1399 |
| 3 | Ga0070709_10040331 | 3300005434 | Bacteria | 2870 |
| 4 | Ga0070713_100102126 | 3300005436 | Bacteria | 2486 |
| 5 | Ga0070710_10000076 | 3300005437 | Bacteria | 44489 |
| 6 | Ga0070710_10156335 | 3300005437 | Bacteria | 1410 |
| 7 | Ga0070681_10558964 | 3300005458 | Bacteria | 1058 |
| 8 | Ga0070706_100017442 | 3300005467 | Bacteria | 6625 |
| 9 | Ga0070707_100029435 | 3300005468 | Bacteria | 5228 |
| 10 | Ga0070698_100001125 | 3300005471 | Bacteria | 29557 |
| 11 | Ga0070698_100066273 | 3300005471 | Bacteria | 3635 |
| 12 | Ga0070698_100067498 | 3300005471 | Bacteria | 3596 |
| 13 | Ga0068853_100013703 | 3300005539 | Bacteria | 6622 |
| 14 | Ga0070665_100319932 | 3300005548 | Bacteria | 1556 |
| 15 | Ga0068855_100519058 | 3300005563 | Bacteria | 1292 |
| 16 | Ga0068852_100410304 | 3300005616 | Bacteria | 1334 |
| 17 | Ga0068859_100116615 | 3300005617 | Bacteria | 2735 |
| 18 | Ga0068860_101148023 | 3300005843 | Bacteria | 797 |
| 19 | Ga0081455_10000365 | 3300005937 | Bacteria | 59750 |
| 20 | Ga0081539_10000186 | 3300005985 | Bacteria | 147547 |
| 21 | Ga0081539_10000937 | 3300005985 | Bacteria | 54700 |
| 22 | Ga0081539_10001066 | 3300005985 | Bacteria | 50181 |
| 23 | Ga0070717_10043824 | 3300006028 | Bacteria | 3653 |
| 24 | Ga0075365_10002502 | 3300006038 | Bacteria | 9046 |
| 25 | Ga0075363_100012611 | 3300006048 | Bacteria | 4078 |
| 26 | Ga0075364_10003665 | 3300006051 | Bacteria | 8759 |
| 27 | Ga0075364_10009421 | 3300006051 | Bacteria | 5858 |
| 28 | Ga0070716_100070379 | 3300006173 | Bacteria | 2054 |
| 29 | Ga0070712_100062236 | 3300006175 | Bacteria | 2638 |
| 30 | Ga0075362_10009664 | 3300006177 | Bacteria | 3739 |
| 31 | Ga0075367_10189337 | 3300006178 | Bacteria | 1284 |
| 32 | Ga0075369_10002427 | 3300006186 | Bacteria | 6643 |
| 33 | Ga0075369_10005391 | 3300006186 | Bacteria | 4777 |
| 34 | Ga0075369_10089666 | 3300006186 | Bacteria | 1371 |
| 35 | Ga0097621_100414856 | 3300006237 | Bacteria | 1207 |
| 36 | Ga0068871_100660369 | 3300006358 | Bacteria | 955 |
| 37 | Ga0075430_100204038 | 3300006846 | Bacteria | 1641 |
| 38 | Ga0097620_100116614 | 3300006931 | Bacteria | 2735 |
| 39 | Ga0105245_10097103 | 3300009098 | Bacteria | 2720 |
| 40 | Ga0105237_10346787 | 3300009545 | Bacteria | 1489 |
| 41 | Ga0105249_11253880 | 3300009553 | Bacteria | 813 |
| 42 | Ga0105239_10288990 | 3300010375 | Bacteria | 1846 |
| 43 | Ga0157369_10222121 | 3300013105 | Bacteria | 1977 |
| 44 | Ga0157374_10237045 | 3300013296 | Bacteria | 1793 |
| 45 | Ga0157378_10397315 | 3300013297 | Bacteria | 1357 |
| 46 | Ga0163162_10883826 | 3300013306 | Bacteria | 1007 |
| 47 | Ga0157375_10370239 | 3300013308 | Bacteria | 1599 |
| 48 | Ga0157379_10062538 | 3300014968 | Bacteria | 3329 |
| 49 | Ga0157376_10598038 | 3300014969 | Bacteria | 1097 |
| 50 | Ga0213875_10004990 | 3300021388 | Bacteria | 7199 |
| 51 | Ga0207692_10003844 | 3300025898 | Bacteria | 5901 |
| 52 | Ga0207692_10194568 | 3300025898 | Bacteria | 1189 |
| 53 | Ga0207685_10313488 | 3300025905 | Bacteria | 780 |
| 54 | Ga0207699_10124708 | 3300025906 | Bacteria | 1671 |
| 55 | Ga0207684_10016302 | 3300025910 | Bacteria | 6380 |
| 56 | Ga0207693_10188859 | 3300025915 | Bacteria | 1622 |
| 57 | Ga0207646_10137137 | 3300025922 | Bacteria | 2203 |
| 58 | Ga0207646_10858840 | 3300025922 | Bacteria | 806 |
| 59 | Ga0207664_10456557 | 3300025929 | Bacteria | 1141 |
| 60 | Ga0207669_10063914 | 3300025937 | Bacteria | 2275 |
| 61 | Ga0207665_10104724 | 3300025939 | Bacteria | 1980 |
| 62 | Ga0207667_10541847 | 3300025949 | Bacteria | 1177 |
| 63 | Ga0207639_10019720 | 3300026041 | Bacteria | 4814 |
| 64 | Ga0207702_10304504 | 3300026078 | Bacteria | 1513 |
| 65 | Ga0207675_100680114 | 3300026118 | Bacteria | 1037 |
| 66 | Ga0207698_10246865 | 3300026142 | Bacteria | 1631 |
| 67 | Ga0207698_10844533 | 3300026142 | Bacteria | 920 |
| 68 | Ga0268266_10353644 | 3300028379 | Bacteria | 1381 |
| 69 | Ga0268264_10439072 | 3300028381 | Bacteria | 1262 |
| 70 | Ga0307517_10015948 | 3300028786 | Bacteria | 9921 |
| 71 | Ga0307517_10190663 | 3300028786 | Bacteria | 1302 |
| 72 | Ga0307515_10012933 | 3300028794 | Bacteria | 15651 |
| 73 | Ga0307515_10017412 | 3300028794 | Bacteria | 13088 |
| 74 | Ga0307515_10022408 | 3300028794 | Bacteria | 11134 |
| 75 | Ga0307515_10053708 | 3300028794 | Bacteria | 5935 |
| 76 | Ga0307515_10060404 | 3300028794 | Bacteria | 5406 |
| 77 | Ga0307515_10205862 | 3300028794 | Bacteria | 1828 |
| 78 | Ga0307511_10000394 | 3300030521 | Bacteria | 46522 |
| 79 | Ga0307512_10002113 | 3300030522 | Bacteria | 26083 |
| 80 | Ga0307512_10024843 | 3300030522 | Bacteria | 5321 |
| 81 | Ga0307512_10137274 | 3300030522 | Bacteria | 1509 |
| 82 | Ga0316177_1186064 | 3300030731 | Bacteria | 2538 |
| 83 | Ga0314311_1068355 | 3300030733 | Bacteria | 4857 |
| 84 | Ga0316180_1184348 | 3300030736 | Bacteria | 2850 |
| 85 | Ga0316181_1026786 | 3300030744 | Bacteria | 1772 |
| 86 | Ga0307513_10000002 | 3300031456 | Bacteria | 842612 |
| 87 | Ga0307513_10015433 | 3300031456 | Bacteria | 9259 |
| 88 | Ga0307513_10046408 | 3300031456 | Bacteria | 4736 |
| 89 | Ga0307513_10425471 | 3300031456 | Bacteria | 1057 |
| 90 | Ga0307513_10433540 | 3300031456 | Bacteria | 1042 |
| 91 | Ga0307509_10015548 | 3300031507 | Bacteria | 8870 |
| 92 | Ga0307509_10129764 | 3300031507 | Bacteria | 2479 |
| 93 | Ga0307408_100179295 | 3300031548 | Bacteria | 1697 |
| 94 | Ga0307508_10015214 | 3300031616 | Bacteria | 7012 |
| 95 | Ga0307508_10024224 | 3300031616 | Bacteria | 5508 |
| 96 | Ga0307508_10053688 | 3300031616 | Bacteria | 3575 |
| 97 | Ga0307508_10065987 | 3300031616 | Bacteria | 3187 |
| 98 | Ga0307508_10227227 | 3300031616 | Bacteria | 1465 |
| 99 | Ga0307516_10001676 | 3300031730 | Bacteria | 30536 |
| 100 | Ga0307516_10014516 | 3300031730 | Bacteria | 8329 |
| 101 | Ga0307405_10448643 | 3300031731 | Bacteria | 1022 |
| 102 | Ga0307518_10000143 | 3300031838 | Bacteria | 52098 |
| 103 | Ga0307410_10325653 | 3300031852 | Bacteria | 1221 |
| 104 | Ga0307406_10260280 | 3300031901 | Bacteria | 1312 |
| 105 | Ga0307409_100574460 | 3300031995 | Bacteria | 1110 |
| 106 | Ga0307416_100569846 | 3300032002 | Bacteria | 1208 |
| 107 | Ga0307411_10022932 | 3300032005 | Bacteria | 3686 |
| 108 | Ga0307415_100005351 | 3300032126 | Bacteria | 6802 |
| 109 | Ga0307415_100203541 | 3300032126 | Bacteria | 1573 |
| 110 | Ga0307507_10046024 | 3300033179 | Bacteria | 4283 |
| 111 | Ga0307507_10051947 | 3300033179 | Bacteria | 3938 |
| 112 | Ga0307507_10076802 | 3300033179 | Bacteria | 2976 |
| 113 | Ga0307510_10057702 | 3300033180 | Bacteria | 4026 |
| 114 | Ga0373934_0082148 | 3300035086 | Bacteria | 1295 |
| 115 | Ga0373940_0012657 | 3300035088 | Bacteria | 2024 |
| 116 | Ga0373936_0101800 | 3300035113 | Bacteria | 1212 |
| 117 | Ga0373954_0044881 | 3300035118 | Bacteria | 2064 |
| 118 | Ga0373956_0067392 | 3300035119 | Bacteria | 1629 |
| 119 | Ga0373960_0124990 | 3300035121 | Bacteria | 857 |
| 120 | Ga0373942_0000564 | 3300035207 | Bacteria | 10407 |
| 121 | Ga0373931_0074948 | 3300035691 | Bacteria | 1855 |
| 122 | Ga0373927_0321876 | 3300035695 | Bacteria | 1018 |
| 123 | Ga0373933_0039453 | 3300035724 | Bacteria | 2778 |
| 124 | Ga0373925_0128298 | 3300037068 | Bacteria | 1975 |
| 125 | Ga0395900_0042761 | 3300037418 | Bacteria | 4668 |
| 126 | Ga0395900_0111431 | 3300037418 | Bacteria | 2811 |
| 127 | Ga0395900_0848507 | 3300037418 | Bacteria | 839 |
| 128 | Ga0395898_0037316 | 3300037466 | Bacteria | 4822 |
| 129 | Ga0395905_0129867 | 3300037471 | Bacteria | 2370 |
| 130 | Ga0395905_0897388 | 3300037471 | Bacteria | 789 |
| 131 | Ga0436364_1353927 | 3300037853 | Bacteria | 14043 |
| 132 | Ga0395901_0065324 | 3300038443 | Bacteria | 3788 |
| 133 | Ga0439436_0006339 | 3300041404 | Bacteria | 3632 |
| 134 | Ga0439439_0007522 | 3300041406 | Bacteria | 2550 |
| 135 | Ga0439461_0043100 | 3300041410 | Bacteria | 980 |
| 136 | Ga0439466_0009134 | 3300041411 | Bacteria | 3716 |
| 137 | Ga0439466_0092479 | 3300041411 | Bacteria | 947 |
| 138 | Ga0439465_0013826 | 3300041413 | Bacteria | 2512 |
| 139 | Ga0439442_031079 | 3300042002 | Bacteria | 1115 |
| 140 | Ga0439449_0001920 | 3300042007 | Bacteria | 8161 |
| 141 | Ga0439435_0009322 | 3300042436 | Bacteria | 2302 |
| 142 | Ga0466972_0002274 | 3300044658 | Bacteria | 9441 |
| 143 | Ga0466965_0000765 | 3300044683 | Bacteria | 12102 |
| 144 | Ga0466960_0022202 | 3300044901 | Bacteria | 2835 |
| 145 | Ga0466960_0025475 | 3300044901 | Bacteria | 2677 |
| 146 | Ga0466967_0274503 | 3300045976 | Bacteria | 1616 |
| 147 | Ga0495627_016130 | 3300046453 | Bacteria | 2564 |
| 148 | Ga0495592_0025214 | 3300046454 | Bacteria | 4514 |
| 149 | Ga0495592_0072391 | 3300046454 | Bacteria | 2507 |
| 150 | Ga0495629_0002765 | 3300046459 | Bacteria | 13416 |
| 151 | Ga0495629_0056777 | 3300046459 | Bacteria | 2737 |
| 152 | Ga0495629_0096256 | 3300046459 | Bacteria | 2065 |
| 153 | Ga0495629_0119413 | 3300046459 | Bacteria | 1837 |
| 154 | Ga0495641_0131951 | 3300046461 | Bacteria | 1115 |
| 155 | Ga0495651_0032623 | 3300046462 | Bacteria | 4061 |
| 156 | Ga0495651_0180661 | 3300046462 | Bacteria | 1493 |
| 157 | Ga0495653_0009600 | 3300046463 | Bacteria | 7915 |
| 158 | Ga0495582_0062879 | 3300046473 | Bacteria | 2051 |
| 159 | Ga0495662_0133027 | 3300046476 | Bacteria | 1223 |
| 160 | Ga0495664_0021490 | 3300046477 | Bacteria | 3727 |
| 161 | Ga0495585_0038238 | 3300046492 | Bacteria | 2701 |
| 162 | Ga0495618_0012115 | 3300046514 | Bacteria | 5235 |
| 163 | Ga0495628_0003623 | 3300046516 | Bacteria | 13806 |
| 164 | Ga0495628_0698689 | 3300046516 | Bacteria | 716 |
| 165 | Ga0495632_0025038 | 3300046519 | Bacteria | 3161 |
| 166 | Ga0495643_0005367 | 3300046522 | Bacteria | 8679 |
| 167 | Ga0495666_0091403 | 3300046526 | Bacteria | 1436 |
| 168 | Ga0495666_0125253 | 3300046526 | Bacteria | 1202 |
| 169 | Ga0495652_0048209 | 3300046529 | Bacteria | 3651 |
| 170 | Ga0495665_0155598 | 3300046531 | Bacteria | 1192 |
| 171 | Ga0495640_0010270 | 3300046533 | Bacteria | 7242 |
| 172 | Ga0495640_0097041 | 3300046533 | Bacteria | 1938 |
| 173 | Ga0495586_0028962 | 3300046535 | Bacteria | 2964 |
| 174 | Ga0495587_0004386 | 3300046536 | Bacteria | 9303 |
| 175 | Ga0495597_0034352 | 3300046542 | Bacteria | 2292 |
| 176 | Ga0495633_0217789 | 3300046558 | Bacteria | 874 |
| 177 | Ga0495667_0005531 | 3300046559 | Bacteria | 8543 |
| 178 | Ga0495667_0045061 | 3300046559 | Bacteria | 2921 |
| 179 | Ga0495634_0002754 | 3300046642 | Bacteria | 14446 |
| 180 | Ga0495634_0060389 | 3300046642 | Bacteria | 2522 |
| 181 | Ga0495625_0043452 | 3300046660 | Bacteria | 3258 |
| 182 | Ga0495635_0020488 | 3300046663 | Bacteria | 4606 |
| 183 | Ga0495588_0012362 | 3300046674 | Bacteria | 4033 |
| 184 | Ga0495588_0140882 | 3300046674 | Bacteria | 1274 |
| 185 | Ga0495657_0002010 | 3300046675 | Bacteria | 17314 |
| 186 | Ga0495657_0048144 | 3300046675 | Bacteria | 2877 |
| 187 | Ga0495599_0008147 | 3300046678 | Bacteria | 6364 |
| 188 | Ga0495613_0020431 | 3300046689 | Bacteria | 4936 |
| 189 | Ga0495613_0321954 | 3300046689 | Bacteria | 1067 |
| 190 | Ga0495613_0481570 | 3300046689 | Bacteria | 837 |
| 191 | Ga0495624_0011067 | 3300046690 | Bacteria | 6210 |
| 192 | Ga0495624_0059426 | 3300046690 | Bacteria | 2399 |
| 193 | Ga0495670_0218773 | 3300046691 | Bacteria | 1011 |
| 194 | Ga0495671_0015410 | 3300046692 | Bacteria | 4094 |
| 195 | Ga0495600_0007248 | 3300046809 | Bacteria | 6771 |
| 196 | Ga0495600_0062774 | 3300046809 | Bacteria | 2427 |
| 197 | Ga0495660_0046463 | 3300046810 | Bacteria | 2381 |
| 198 | Ga0495581_0126816 | 3300047315 | Bacteria | 1486 |
| 199 | Ga0495581_0444174 | 3300047315 | Bacteria | 756 |
| 200 | Ga0495604_0009235 | 3300047317 | Bacteria | 7806 |
| 201 | Ga0495676_0006562 | 3300047321 | Bacteria | 10721 |
| 202 | Ga0495676_0522690 | 3300047321 | Bacteria | 777 |
| 203 | Ga0495680_0016943 | 3300047322 | Bacteria | 6239 |
| 204 | Ga0495683_0018661 | 3300047323 | Bacteria | 3584 |
| 205 | Ga0495687_037368 | 3300047443 | Bacteria | 2164 |
| 206 | Ga0495687_057385 | 3300047443 | Bacteria | 1619 |
| 207 | Ga0495675_0044867 | 3300047444 | Bacteria | 2815 |
| 208 | Ga0495685_002723 | 3300047447 | Bacteria | 5573 |
| 209 | Ga0495681_0000901 | 3300047470 | Bacteria | 22973 |
| 210 | Ga0495681_0008563 | 3300047470 | Bacteria | 6399 |
| 211 | Ga0495684_0019871 | 3300047471 | Bacteria | 5175 |
| 212 | Ga0495602_0027967 | 3300048088 | Bacteria | 5408 |
| 213 | Ga0495614_0011164 | 3300048089 | Bacteria | 3952 |
| 214 | Ga0496101_0275636 | 3300048904 | Bacteria | 1314 |
| 215 | Ga0496102_0349523 | 3300048905 | Bacteria | 1392 |
| 216 | Ga0496104_0209215 | 3300048907 | Bacteria | 1862 |
| 217 | Ga0496108_0022975 | 3300048911 | Bacteria | 5132 |
| 218 | Ga0496109_0063041 | 3300048912 | Bacteria | 3390 |
| 219 | Ga0496111_0083486 | 3300048914 | Bacteria | 2334 |
| 220 | Ga0496114_0482274 | 3300048917 | Bacteria | 1097 |
| 221 | Ga0496126_0048339 | 3300048929 | Bacteria | 3889 |
| 222 | Ga0501031_0057378 | 3300049568 | Bacteria | 2537 |
| 223 | Ga0501032_0001232 | 3300049569 | Bacteria | 20538 |
| 224 | Ga0501033_0072346 | 3300049570 | Bacteria | 2531 |
| 225 | Ga0501033_0171371 | 3300049570 | Bacteria | 1558 |
| 226 | Ga0501034_0015478 | 3300049571 | Bacteria | 7837 |
| 227 | Ga0501034_0284298 | 3300049571 | Bacteria | 1593 |
| 228 | Ga0501036_0274408 | 3300049572 | Bacteria | 1411 |
| 229 | Ga0501037_0001681 | 3300049573 | Bacteria | 16077 |
| 230 | Ga0501037_0192296 | 3300049573 | Bacteria | 1444 |
| 231 | Ga0501038_0000670 | 3300049574 | Bacteria | 30475 |
| 232 | Ga0501038_0201440 | 3300049574 | Bacteria | 1597 |
| 233 | Ga0501039_0037732 | 3300049575 | Bacteria | 3730 |
| 234 | Ga0501040_0133179 | 3300049576 | Bacteria | 1748 |
| 235 | Ga0501041_0013228 | 3300049577 | Bacteria | 4888 |
| 236 | Ga0501042_0065256 | 3300049578 | Bacteria | 2601 |
| 237 | Ga0501043_0000700 | 3300049579 | Bacteria | 29670 |
| 238 | Ga0501046_0022547 | 3300049580 | Bacteria | 5187 |
| 239 | Ga0501047_0000074 | 3300049581 | Bacteria | 125728 |
| 240 | Ga0501047_0001072 | 3300049581 | Bacteria | 27270 |
| 241 | Ga0501067_0002419 | 3300049583 | Bacteria | 10315 |
| 242 | Ga0501068_0001735 | 3300049584 | Bacteria | 11587 |
| 243 | Ga0501069_0005120 | 3300049585 | Bacteria | 6806 |
| 244 | Ga0501070_0206563 | 3300049586 | Bacteria | 1612 |
| 245 | Ga0501073_0010266 | 3300049589 | Bacteria | 6876 |
| 246 | Ga0501076_0035937 | 3300049592 | Bacteria | 3879 |
| 247 | Ga0501079_0040017 | 3300049741 | Bacteria | 3616 |
| 248 | Ga0501083_0002353 | 3300049744 | Bacteria | 12945 |
| 249 | Ga0501035_0000304 | 3300049822 | Bacteria | 57980 |
| 250 | Ga0501035_0012116 | 3300049822 | Bacteria | 7975 |
| 251 | Ga0501035_0094640 | 3300049822 | Bacteria | 2626 |
| 252 | Ga0501035_0113749 | 3300049822 | Bacteria | 2370 |
| 253 | Ga0501044_0000856 | 3300049823 | Bacteria | 36592 |
| 254 | Ga0501044_0032500 | 3300049823 | Bacteria | 5486 |
| 255 | Ga0501045_0250908 | 3300049824 | Bacteria | 1317 |
| 256 | nmdc:mga03683_8859_c1 | 3300050489 | Bacteria | 3555 |
| 257 | nmdc:mga03n38_140758_c1 | 3300050490 | Bacteria | 1205 |
| 258 | nmdc:mga00v17_2114_c1 | 3300050491 | Bacteria | 10213 |
| 259 | nmdc:mga00v17_83078_c1 | 3300050491 | Bacteria | 2003 |
| 260 | nmdc:mga0yw44_7361_c1 | 3300050492 | Bacteria | 5409 |
| 261 | nmdc:mga06z11_430261_c1 | 3300050494 | Bacteria | 796 |
| 262 | nmdc:mga04h51_108783_c1 | 3300050495 | Bacteria | 1019 |
| 263 | nmdc:mga06r32_326209_c1 | 3300050510 | Bacteria | 1520 |
| 264 | nmdc:mga0sz30_4971_c1 | 3300050516 | Bacteria | 3490 |
| 265 | Ga0495612_0052712 | 3300053078 | Bacteria | 1674 |
| 266 | Ga0495655_0009823 | 3300053083 | Bacteria | 1869 |
| 267 | Ga0495595_0018259 | 3300053084 | Bacteria | 3030 |
| 268 | Ga0495619_0008447 | 3300053085 | Bacteria | 6511 |
| 269 | Ga0500578_0008811 | 3300053086 | Bacteria | 6584 |
| 270 | Ga0500644_0045908 | 3300053088 | Bacteria | 1474 |
| 271 | Ga0500646_0000369 | 3300053090 | Bacteria | 13609 |
| 272 | Ga0500646_0000416 | 3300053090 | Bacteria | 12637 |
| 273 | Ga0500641_0017009 | 3300053096 | Bacteria | 2713 |
| 274 | Ga0500660_084572 | 3300053100 | Bacteria | 1440 |
| 275 | Ga0500560_000490 | 3300053107 | Bacteria | 5516 |
| 276 | Ga0500560_004609 | 3300053107 | Bacteria | 2953 |
| 277 | Ga0500569_012185 | 3300053109 | Bacteria | 2075 |
| 278 | Ga0500568_0013533 | 3300053139 | Bacteria | 3717 |
| 279 | Ga0500573_0015951 | 3300053140 | Bacteria | 4262 |
| 280 | Ga0500577_0025680 | 3300053142 | Bacteria | 1996 |
| 281 | Ga0500577_0228889 | 3300053142 | Bacteria | 806 |
| 282 | Ga0500622_0203200 | 3300053156 | Bacteria | 900 |
| 283 | Ga0500656_009380 | 3300053732 | Bacteria | 1052 |
| 284 | Ga0500587_001235 | 3300053739 | Bacteria | 3559 |
| 285 | Ga0501084_0002273 | 3300054114 | Bacteria | 15430 |
| 286 | Ga0530510_0078230 | 3300061734 | Bacteria | 2404 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053090 | Ga0500646_0000369 | Ga0500646_0000369_4524_5180 | 201 |
| 2 | 3300037068 | Ga0373925_0128298 | Ga0373925_0128298_512_1165 | 205 |
| 3 | 3300006186 | Ga0075369_10002427 | Ga0075369_100024272 | 208 |
| 4 | 3300005471 | Ga0070698_100001125 | Ga0070698_1000011254 | 213 |
| 5 | iso_pu_bacteria | 2558860280 | 2559425430 | 213 |
| 6 | iso_pu_bacteria | 3006321560 | 3006322809 | 213 |
| 7 | iso_pu_bacteria | 2675903059 | 2676481286 | 214 |
| 8 | iso_pu_bacteria | 2795385472 | 2795794891 | 214 |
| 9 | iso_pu_bacteria | 2861520306 | 2861520359 | 214 |
| 10 | iso_pu_bacteria | 8001781756 | 8001790321 | 214 |
| 11 | iso_pu_bacteria | 8056054917 | 8056056653 | 214 |
| 12 | 3300037418 | Ga0395900_0848507 | Ga0395900_0848507_17_664 | 215 |
| 13 | iso_pu_bacteria | 2791354901 | 2791911695 | 215 |
| 14 | iso_pu_bacteria | 2795385470 | 2795783611 | 215 |
| 15 | iso_pu_bacteria | 2866612099 | 2866612751 | 215 |
| 16 | iso_pu_bacteria | 2899359706 | 2899366986 | 215 |
| 17 | iso_pu_bacteria | 2917736166 | 2917740314 | 215 |
| 18 | iso_pu_bacteria | 2917736166 | 2917743495 | 215 |
| 19 | iso_pu_bacteria | 8047710418 | 8047714250 | 215 |
| 20 | 3300053088 | Ga0500644_0045908 | Ga0500644_0045908_705_1355 | 216 |
| 21 | 3300053142 | Ga0500577_0025680 | Ga0500577_0025680_103_753 | 216 |
| 22 | 3300005539 | Ga0068853_100013703 | Ga0068853_1000137035 | 217 |
| 23 | 3300021388 | Ga0213875_10004990 | Ga0213875_100049902 | 217 |
| 24 | 3300025910 | Ga0207684_10016302 | Ga0207684_100163026 | 217 |
| 25 | 3300026041 | Ga0207639_10019720 | Ga0207639_100197206 | 217 |
| 26 | 3300026142 | Ga0207698_10246865 | Ga0207698_102468652 | 217 |
| 27 | 3300030521 | Ga0307511_10000394 | Ga0307511_1000039425 | 217 |
| 28 | 3300037853 | Ga0436364_1353927 | Ga0436364_1353927_7770_8423 | 217 |
| 29 | 3300045976 | Ga0466967_0274503 | Ga0466967_0274503_149_802 | 217 |
| 30 | 3300046454 | Ga0495592_0025214 | Ga0495592_0025214_2697_3350 | 217 |
| 31 | 3300046459 | Ga0495629_0056777 | Ga0495629_0056777_1191_1844 | 217 |
| 32 | 3300046462 | Ga0495651_0032623 | Ga0495651_0032623_1565_2218 | 217 |
| 33 | 3300046476 | Ga0495662_0133027 | Ga0495662_0133027_44_697 | 217 |
| 34 | 3300046477 | Ga0495664_0021490 | Ga0495664_0021490_1655_2308 | 217 |
| 35 | 3300046514 | Ga0495618_0012115 | Ga0495618_0012115_4218_4871 | 217 |
| 36 | 3300046516 | Ga0495628_0003623 | Ga0495628_0003623_11555_12208 | 217 |
| 37 | 3300046526 | Ga0495666_0125253 | Ga0495666_0125253_363_1016 | 217 |
| 38 | 3300046529 | Ga0495652_0048209 | Ga0495652_0048209_854_1507 | 217 |
| 39 | 3300046533 | Ga0495640_0010270 | Ga0495640_0010270_1725_2378 | 217 |
| 40 | 3300046642 | Ga0495634_0002754 | Ga0495634_0002754_6345_6998 | 217 |
| 41 | 3300046675 | Ga0495657_0002010 | Ga0495657_0002010_3674_4327 | 217 |
| 42 | 3300046689 | Ga0495613_0020431 | Ga0495613_0020431_1587_2240 | 217 |
| 43 | 3300046689 | Ga0495613_0321954 | Ga0495613_0321954_62_715 | 217 |
| 44 | 3300046690 | Ga0495624_0011067 | Ga0495624_0011067_2559_3212 | 217 |
| 45 | 3300046809 | Ga0495600_0007248 | Ga0495600_0007248_2037_2690 | 217 |
| 46 | 3300047315 | Ga0495581_0126816 | Ga0495581_0126816_669_1322 | 217 |
| 47 | 3300047315 | Ga0495581_0444174 | Ga0495581_0444174_49_702 | 217 |
| 48 | 3300047317 | Ga0495604_0009235 | Ga0495604_0009235_86_739 | 217 |
| 49 | 3300047321 | Ga0495676_0006562 | Ga0495676_0006562_2464_3117 | 217 |
| 50 | 3300049568 | Ga0501031_0057378 | Ga0501031_0057378_1611_2303 | 217 |
| 51 | 3300049569 | Ga0501032_0001232 | Ga0501032_0001232_12759_13457 | 217 |
| 52 | 3300049570 | Ga0501033_0072346 | Ga0501033_0072346_1348_2040 | 217 |
| 53 | 3300049570 | Ga0501033_0171371 | Ga0501033_0171371_692_1390 | 217 |
| 54 | 3300049571 | Ga0501034_0015478 | Ga0501034_0015478_6971_7669 | 217 |
| 55 | 3300049571 | Ga0501034_0284298 | Ga0501034_0284298_563_1255 | 217 |
| 56 | 3300049572 | Ga0501036_0274408 | Ga0501036_0274408_590_1282 | 217 |
| 57 | 3300049573 | Ga0501037_0001681 | Ga0501037_0001681_10151_10849 | 217 |
| 58 | 3300049573 | Ga0501037_0192296 | Ga0501037_0192296_474_1127 | 217 |
| 59 | 3300049574 | Ga0501038_0000670 | Ga0501038_0000670_11796_12494 | 217 |
| 60 | 3300049574 | Ga0501038_0201440 | Ga0501038_0201440_677_1369 | 217 |
| 61 | 3300049575 | Ga0501039_0037732 | Ga0501039_0037732_56_754 | 217 |
| 62 | 3300049576 | Ga0501040_0133179 | Ga0501040_0133179_231_929 | 217 |
| 63 | 3300049577 | Ga0501041_0013228 | Ga0501041_0013228_446_1144 | 217 |
| 64 | 3300049578 | Ga0501042_0065256 | Ga0501042_0065256_1349_2047 | 217 |
| 65 | 3300049579 | Ga0501043_0000700 | Ga0501043_0000700_21358_22056 | 217 |
| 66 | 3300049580 | Ga0501046_0022547 | Ga0501046_0022547_3081_3779 | 217 |
| 67 | 3300049581 | Ga0501047_0000074 | Ga0501047_0000074_109176_109829 | 217 |
| 68 | 3300049581 | Ga0501047_0001072 | Ga0501047_0001072_5107_5805 | 217 |
| 69 | 3300049583 | Ga0501067_0002419 | Ga0501067_0002419_6627_7325 | 217 |
| 70 | 3300049584 | Ga0501068_0001735 | Ga0501068_0001735_6710_7408 | 217 |
| 71 | 3300049585 | Ga0501069_0005120 | Ga0501069_0005120_2793_3491 | 217 |
| 72 | 3300049586 | Ga0501070_0206563 | Ga0501070_0206563_360_1058 | 217 |
| 73 | 3300049589 | Ga0501073_0010266 | Ga0501073_0010266_2863_3561 | 217 |
| 74 | 3300049592 | Ga0501076_0035937 | Ga0501076_0035937_2773_3471 | 217 |
| 75 | 3300049741 | Ga0501079_0040017 | Ga0501079_0040017_2863_3561 | 217 |
| 76 | 3300049744 | Ga0501083_0002353 | Ga0501083_0002353_3509_4207 | 217 |
| 77 | 3300049822 | Ga0501035_0000304 | Ga0501035_0000304_33592_34290 | 217 |
| 78 | 3300049822 | Ga0501035_0012116 | Ga0501035_0012116_5783_6436 | 217 |
| 79 | 3300049822 | Ga0501035_0094640 | Ga0501035_0094640_1424_2116 | 217 |
| 80 | 3300049822 | Ga0501035_0113749 | Ga0501035_0113749_107_760 | 217 |
| 81 | 3300049823 | Ga0501044_0000856 | Ga0501044_0000856_28567_29265 | 217 |
| 82 | 3300049823 | Ga0501044_0032500 | Ga0501044_0032500_501_1154 | 217 |
| 83 | 3300049824 | Ga0501045_0250908 | Ga0501045_0250908_83_775 | 217 |
| 84 | 3300054114 | Ga0501084_0002273 | Ga0501084_0002273_13493_14191 | 217 |
| 85 | 3300061734 | Ga0530510_0078230 | Ga0530510_0078230_85_783 | 217 |
| 86 | 3300005471 | Ga0070698_100066273 | Ga0070698_1000662732 | 218 |
| 87 | 3300005616 | Ga0068852_100410304 | Ga0068852_1004103041 | 218 |
| 88 | 3300005937 | Ga0081455_10000365 | Ga0081455_1000036544 | 218 |
| 89 | 3300005985 | Ga0081539_10000186 | Ga0081539_1000018657 | 218 |
| 90 | 3300005985 | Ga0081539_10001066 | Ga0081539_1000106642 | 218 |
| 91 | 3300006038 | Ga0075365_10002502 | Ga0075365_100025025 | 218 |
| 92 | 3300006048 | Ga0075363_100012611 | Ga0075363_1000126115 | 218 |
| 93 | 3300006051 | Ga0075364_10003665 | Ga0075364_100036656 | 218 |
| 94 | 3300006051 | Ga0075364_10009421 | Ga0075364_100094215 | 218 |
| 95 | 3300006177 | Ga0075362_10009664 | Ga0075362_100096643 | 218 |
| 96 | 3300006178 | Ga0075367_10189337 | Ga0075367_101893372 | 218 |
| 97 | 3300006186 | Ga0075369_10005391 | Ga0075369_100053915 | 218 |
| 98 | 3300006186 | Ga0075369_10089666 | Ga0075369_100896661 | 218 |
| 99 | 3300006846 | Ga0075430_100204038 | Ga0075430_1002040383 | 218 |
| 100 | 3300009545 | Ga0105237_10346787 | Ga0105237_103467872 | 218 |
| 101 | 3300013297 | Ga0157378_10397315 | Ga0157378_103973151 | 218 |
| 102 | 3300026118 | Ga0207675_100680114 | Ga0207675_1006801142 | 218 |
| 103 | 3300026142 | Ga0207698_10844533 | Ga0207698_108445331 | 218 |
| 104 | 3300028786 | Ga0307517_10015948 | Ga0307517_100159487 | 218 |
| 105 | 3300028786 | Ga0307517_10190663 | Ga0307517_101906632 | 218 |
| 106 | 3300028794 | Ga0307515_10012933 | Ga0307515_100129335 | 218 |
| 107 | 3300028794 | Ga0307515_10017412 | Ga0307515_100174127 | 218 |
| 108 | 3300028794 | Ga0307515_10022408 | Ga0307515_100224089 | 218 |
| 109 | 3300028794 | Ga0307515_10053708 | Ga0307515_100537083 | 218 |
| 110 | 3300028794 | Ga0307515_10060404 | Ga0307515_100604043 | 218 |
| 111 | 3300028794 | Ga0307515_10205862 | Ga0307515_102058622 | 218 |
| 112 | 3300030522 | Ga0307512_10024843 | Ga0307512_100248434 | 218 |
| 113 | 3300030522 | Ga0307512_10137274 | Ga0307512_101372742 | 218 |
| 114 | 3300030744 | Ga0316181_1026786 | Ga0316181_10267862 | 218 |
| 115 | 3300031456 | Ga0307513_10000002 | Ga0307513_10000002400 | 218 |
| 116 | 3300031456 | Ga0307513_10015433 | Ga0307513_100154338 | 218 |
| 117 | 3300031456 | Ga0307513_10046408 | Ga0307513_100464082 | 218 |
| 118 | 3300031456 | Ga0307513_10425471 | Ga0307513_104254712 | 218 |
| 119 | 3300031456 | Ga0307513_10433540 | Ga0307513_104335401 | 218 |
| 120 | 3300031507 | Ga0307509_10015548 | Ga0307509_100155482 | 218 |
| 121 | 3300031507 | Ga0307509_10129764 | Ga0307509_101297643 | 218 |
| 122 | 3300031548 | Ga0307408_100179295 | Ga0307408_1001792951 | 218 |
| 123 | 3300031616 | Ga0307508_10015214 | Ga0307508_100152142 | 218 |
| 124 | 3300031616 | Ga0307508_10024224 | Ga0307508_100242244 | 218 |
| 125 | 3300031616 | Ga0307508_10053688 | Ga0307508_100536884 | 218 |
| 126 | 3300031616 | Ga0307508_10065987 | Ga0307508_100659872 | 218 |
| 127 | 3300031616 | Ga0307508_10227227 | Ga0307508_102272272 | 218 |
| 128 | 3300031730 | Ga0307516_10001676 | Ga0307516_100016766 | 218 |
| 129 | 3300031730 | Ga0307516_10014516 | Ga0307516_100145162 | 218 |
| 130 | 3300031731 | Ga0307405_10448643 | Ga0307405_104486432 | 218 |
| 131 | 3300031838 | Ga0307518_10000143 | Ga0307518_1000014316 | 218 |
| 132 | 3300031852 | Ga0307410_10325653 | Ga0307410_103256532 | 218 |
| 133 | 3300031901 | Ga0307406_10260280 | Ga0307406_102602801 | 218 |
| 134 | 3300031995 | Ga0307409_100574460 | Ga0307409_1005744601 | 218 |
| 135 | 3300032002 | Ga0307416_100569846 | Ga0307416_1005698461 | 218 |
| 136 | 3300032005 | Ga0307411_10022932 | Ga0307411_100229325 | 218 |
| 137 | 3300032126 | Ga0307415_100005351 | Ga0307415_1000053514 | 218 |
| 138 | 3300033179 | Ga0307507_10046024 | Ga0307507_100460242 | 218 |
| 139 | 3300033179 | Ga0307507_10051947 | Ga0307507_100519474 | 218 |
| 140 | 3300033179 | Ga0307507_10076802 | Ga0307507_100768023 | 218 |
| 141 | 3300033180 | Ga0307510_10057702 | Ga0307510_100577023 | 218 |
| 142 | 3300035088 | Ga0373940_0012657 | Ga0373940_0012657_1354_2010 | 218 |
| 143 | 3300035207 | Ga0373942_0000564 | Ga0373942_0000564_1851_2507 | 218 |
| 144 | 3300037418 | Ga0395900_0042761 | Ga0395900_0042761_2961_3617 | 218 |
| 145 | 3300037418 | Ga0395900_0111431 | Ga0395900_0111431_1384_2040 | 218 |
| 146 | 3300037466 | Ga0395898_0037316 | Ga0395898_0037316_3432_4088 | 218 |
| 147 | 3300037471 | Ga0395905_0129867 | Ga0395905_0129867_892_1548 | 218 |
| 148 | 3300037471 | Ga0395905_0897388 | Ga0395905_0897388_59_715 | 218 |
| 149 | 3300038443 | Ga0395901_0065324 | Ga0395901_0065324_1251_1907 | 218 |
| 150 | 3300041404 | Ga0439436_0006339 | Ga0439436_0006339_2031_2687 | 218 |
| 151 | 3300041406 | Ga0439439_0007522 | Ga0439439_0007522_1001_1657 | 218 |
| 152 | 3300041410 | Ga0439461_0043100 | Ga0439461_0043100_257_913 | 218 |
| 153 | 3300041411 | Ga0439466_0009134 | Ga0439466_0009134_510_1166 | 218 |
| 154 | 3300041411 | Ga0439466_0092479 | Ga0439466_0092479_229_885 | 218 |
| 155 | 3300041413 | Ga0439465_0013826 | Ga0439465_0013826_1042_1698 | 218 |
| 156 | 3300042002 | Ga0439442_031079 | Ga0439442_031079_251_907 | 218 |
| 157 | 3300042007 | Ga0439449_0001920 | Ga0439449_0001920_6710_7366 | 218 |
| 158 | 3300042436 | Ga0439435_0009322 | Ga0439435_0009322_1261_1917 | 218 |
| 159 | 3300046453 | Ga0495627_016130 | Ga0495627_016130_902_1636 | 218 |
| 160 | 3300046459 | Ga0495629_0002765 | Ga0495629_0002765_8422_9078 | 218 |
| 161 | 3300046459 | Ga0495629_0119413 | Ga0495629_0119413_838_1494 | 218 |
| 162 | 3300046492 | Ga0495585_0038238 | Ga0495585_0038238_475_1131 | 218 |
| 163 | 3300046519 | Ga0495632_0025038 | Ga0495632_0025038_122_778 | 218 |
| 164 | 3300046522 | Ga0495643_0005367 | Ga0495643_0005367_5730_6386 | 218 |
| 165 | 3300046542 | Ga0495597_0034352 | Ga0495597_0034352_1368_2024 | 218 |
| 166 | 3300046558 | Ga0495633_0217789 | Ga0495633_0217789_161_817 | 218 |
| 167 | 3300046660 | Ga0495625_0043452 | Ga0495625_0043452_1507_2163 | 218 |
| 168 | 3300046674 | Ga0495588_0012362 | Ga0495588_0012362_2265_2921 | 218 |
| 169 | 3300046690 | Ga0495624_0059426 | Ga0495624_0059426_1399_2055 | 218 |
| 170 | 3300046691 | Ga0495670_0218773 | Ga0495670_0218773_222_878 | 218 |
| 171 | 3300046692 | Ga0495671_0015410 | Ga0495671_0015410_1296_1952 | 218 |
| 172 | 3300046810 | Ga0495660_0046463 | Ga0495660_0046463_1390_2046 | 218 |
| 173 | 3300047323 | Ga0495683_0018661 | Ga0495683_0018661_609_1265 | 218 |
| 174 | 3300047443 | Ga0495687_037368 | Ga0495687_037368_151_807 | 218 |
| 175 | 3300047443 | Ga0495687_057385 | Ga0495687_057385_545_1201 | 218 |
| 176 | 3300047447 | Ga0495685_002723 | Ga0495685_002723_2622_3278 | 218 |
| 177 | 3300047470 | Ga0495681_0000901 | Ga0495681_0000901_18114_18770 | 218 |
| 178 | 3300047470 | Ga0495681_0008563 | Ga0495681_0008563_5501_6157 | 218 |
| 179 | 3300048089 | Ga0495614_0011164 | Ga0495614_0011164_1282_1938 | 218 |
| 180 | 3300050489 | nmdc:mga03683_8859_c1 | nmdc:mga03683_8859_c1_579_1235 | 218 |
| 181 | 3300050490 | nmdc:mga03n38_140758_c1 | nmdc:mga03n38_140758_c1_207_863 | 218 |
| 182 | 3300050491 | nmdc:mga00v17_2114_c1 | nmdc:mga00v17_2114_c1_3290_3946 | 218 |
| 183 | 3300050491 | nmdc:mga00v17_83078_c1 | nmdc:mga00v17_83078_c1_387_1043 | 218 |
| 184 | 3300050492 | nmdc:mga0yw44_7361_c1 | nmdc:mga0yw44_7361_c1_2473_3129 | 218 |
| 185 | 3300050494 | nmdc:mga06z11_430261_c1 | nmdc:mga06z11_430261_c1_67_723 | 218 |
| 186 | 3300050495 | nmdc:mga04h51_108783_c1 | nmdc:mga04h51_108783_c1_75_731 | 218 |
| 187 | 3300050516 | nmdc:mga0sz30_4971_c1 | nmdc:mga0sz30_4971_c1_1316_1972 | 218 |
| 188 | 3300053083 | Ga0495655_0009823 | Ga0495655_0009823_251_907 | 218 |
| 189 | 3300053086 | Ga0500578_0008811 | Ga0500578_0008811_970_1626 | 218 |
| 190 | 3300053090 | Ga0500646_0000416 | Ga0500646_0000416_11880_12536 | 218 |
| 191 | 3300053096 | Ga0500641_0017009 | Ga0500641_0017009_698_1354 | 218 |
| 192 | 3300053100 | Ga0500660_084572 | Ga0500660_084572_18_674 | 218 |
| 193 | 3300053107 | Ga0500560_000490 | Ga0500560_000490_699_1355 | 218 |
| 194 | 3300053107 | Ga0500560_004609 | Ga0500560_004609_189_845 | 218 |
| 195 | 3300053109 | Ga0500569_012185 | Ga0500569_012185_859_1515 | 218 |
| 196 | 3300053139 | Ga0500568_0013533 | Ga0500568_0013533_2117_2851 | 218 |
| 197 | 3300053140 | Ga0500573_0015951 | Ga0500573_0015951_2533_3189 | 218 |
| 198 | 3300053142 | Ga0500577_0228889 | Ga0500577_0228889_21_677 | 218 |
| 199 | 3300053732 | Ga0500656_009380 | Ga0500656_009380_249_905 | 218 |
| 200 | 3300053739 | Ga0500587_001235 | Ga0500587_001235_1366_2022 | 218 |
| 201 | 3300003203 | JGI25406J46586_10001742 | JGI25406J46586_100017428 | 219 |
| 202 | 3300005329 | Ga0070683_100353822 | Ga0070683_1003538222 | 219 |
| 203 | 3300005434 | Ga0070709_10040331 | Ga0070709_100403314 | 219 |
| 204 | 3300005436 | Ga0070713_100102126 | Ga0070713_1001021262 | 219 |
| 205 | 3300005437 | Ga0070710_10000076 | Ga0070710_1000007619 | 219 |
| 206 | 3300005437 | Ga0070710_10156335 | Ga0070710_101563352 | 219 |
| 207 | 3300005458 | Ga0070681_10558964 | Ga0070681_105589642 | 219 |
| 208 | 3300005467 | Ga0070706_100017442 | Ga0070706_1000174423 | 219 |
| 209 | 3300005468 | Ga0070707_100029435 | Ga0070707_1000294355 | 219 |
| 210 | 3300005471 | Ga0070698_100067498 | Ga0070698_1000674982 | 219 |
| 211 | 3300005548 | Ga0070665_100319932 | Ga0070665_1003199322 | 219 |
| 212 | 3300005563 | Ga0068855_100519058 | Ga0068855_1005190582 | 219 |
| 213 | 3300005617 | Ga0068859_100116615 | Ga0068859_1001166152 | 219 |
| 214 | 3300005843 | Ga0068860_101148023 | Ga0068860_1011480231 | 219 |
| 215 | 3300005985 | Ga0081539_10000937 | Ga0081539_100009379 | 219 |
| 216 | 3300006028 | Ga0070717_10043824 | Ga0070717_100438242 | 219 |
| 217 | 3300006173 | Ga0070716_100070379 | Ga0070716_1000703792 | 219 |
| 218 | 3300006175 | Ga0070712_100062236 | Ga0070712_1000622362 | 219 |
| 219 | 3300006237 | Ga0097621_100414856 | Ga0097621_1004148562 | 219 |
| 220 | 3300006358 | Ga0068871_100660369 | Ga0068871_1006603691 | 219 |
| 221 | 3300006931 | Ga0097620_100116614 | Ga0097620_1001166142 | 219 |
| 222 | 3300009098 | Ga0105245_10097103 | Ga0105245_100971032 | 219 |
| 223 | 3300009553 | Ga0105249_11253880 | Ga0105249_112538801 | 219 |
| 224 | 3300010375 | Ga0105239_10288990 | Ga0105239_102889901 | 219 |
| 225 | 3300013105 | Ga0157369_10222121 | Ga0157369_102221212 | 219 |
| 226 | 3300013296 | Ga0157374_10237045 | Ga0157374_102370452 | 219 |
| 227 | 3300013306 | Ga0163162_10883826 | Ga0163162_108838262 | 219 |
| 228 | 3300013308 | Ga0157375_10370239 | Ga0157375_103702392 | 219 |
| 229 | 3300014968 | Ga0157379_10062538 | Ga0157379_100625382 | 219 |
| 230 | 3300014969 | Ga0157376_10598038 | Ga0157376_105980382 | 219 |
| 231 | 3300025898 | Ga0207692_10003844 | Ga0207692_100038446 | 219 |
| 232 | 3300025898 | Ga0207692_10194568 | Ga0207692_101945682 | 219 |
| 233 | 3300025905 | Ga0207685_10313488 | Ga0207685_103134881 | 219 |
| 234 | 3300025906 | Ga0207699_10124708 | Ga0207699_101247082 | 219 |
| 235 | 3300025915 | Ga0207693_10188859 | Ga0207693_101888592 | 219 |
| 236 | 3300025922 | Ga0207646_10137137 | Ga0207646_101371371 | 219 |
| 237 | 3300025922 | Ga0207646_10858840 | Ga0207646_108588401 | 219 |
| 238 | 3300025929 | Ga0207664_10456557 | Ga0207664_104565571 | 219 |
| 239 | 3300025937 | Ga0207669_10063914 | Ga0207669_100639142 | 219 |
| 240 | 3300025939 | Ga0207665_10104724 | Ga0207665_101047242 | 219 |
| 241 | 3300025949 | Ga0207667_10541847 | Ga0207667_105418472 | 219 |
| 242 | 3300026078 | Ga0207702_10304504 | Ga0207702_103045042 | 219 |
| 243 | 3300028379 | Ga0268266_10353644 | Ga0268266_103536441 | 219 |
| 244 | 3300028381 | Ga0268264_10439072 | Ga0268264_104390721 | 219 |
| 245 | 3300030522 | Ga0307512_10002113 | Ga0307512_100021134 | 219 |
| 246 | 3300030731 | Ga0316177_1186064 | Ga0316177_11860642 | 219 |
| 247 | 3300030733 | Ga0314311_1068355 | Ga0314311_10683555 | 219 |
| 248 | 3300030736 | Ga0316180_1184348 | Ga0316180_11843482 | 219 |
| 249 | 3300032126 | Ga0307415_100203541 | Ga0307415_1002035412 | 219 |
| 250 | 3300035086 | Ga0373934_0082148 | Ga0373934_0082148_38_712 | 219 |
| 251 | 3300035113 | Ga0373936_0101800 | Ga0373936_0101800_73_747 | 219 |
| 252 | 3300035118 | Ga0373954_0044881 | Ga0373954_0044881_430_1104 | 219 |
| 253 | 3300035119 | Ga0373956_0067392 | Ga0373956_0067392_732_1406 | 219 |
| 254 | 3300035121 | Ga0373960_0124990 | Ga0373960_0124990_117_797 | 219 |
| 255 | 3300035691 | Ga0373931_0074948 | Ga0373931_0074948_412_1092 | 219 |
| 256 | 3300035695 | Ga0373927_0321876 | Ga0373927_0321876_270_950 | 219 |
| 257 | 3300035724 | Ga0373933_0039453 | Ga0373933_0039453_228_902 | 219 |
| 258 | 3300044658 | Ga0466972_0002274 | Ga0466972_0002274_4656_5324 | 219 |
| 259 | 3300044683 | Ga0466965_0000765 | Ga0466965_0000765_3446_4114 | 219 |
| 260 | 3300044901 | Ga0466960_0022202 | Ga0466960_0022202_150_818 | 219 |
| 261 | 3300044901 | Ga0466960_0025475 | Ga0466960_0025475_758_1426 | 219 |
| 262 | 3300046454 | Ga0495592_0072391 | Ga0495592_0072391_1613_2287 | 219 |
| 263 | 3300046459 | Ga0495629_0096256 | Ga0495629_0096256_417_1091 | 219 |
| 264 | 3300046461 | Ga0495641_0131951 | Ga0495641_0131951_403_1083 | 219 |
| 265 | 3300046462 | Ga0495651_0180661 | Ga0495651_0180661_53_727 | 219 |
| 266 | 3300046463 | Ga0495653_0009600 | Ga0495653_0009600_1896_2570 | 219 |
| 267 | 3300046473 | Ga0495582_0062879 | Ga0495582_0062879_52_726 | 219 |
| 268 | 3300046516 | Ga0495628_0698689 | Ga0495628_0698689_28_702 | 219 |
| 269 | 3300046526 | Ga0495666_0091403 | Ga0495666_0091403_267_941 | 219 |
| 270 | 3300046531 | Ga0495665_0155598 | Ga0495665_0155598_402_1076 | 219 |
| 271 | 3300046533 | Ga0495640_0097041 | Ga0495640_0097041_612_1286 | 219 |
| 272 | 3300046535 | Ga0495586_0028962 | Ga0495586_0028962_795_1469 | 219 |
| 273 | 3300046536 | Ga0495587_0004386 | Ga0495587_0004386_5852_6532 | 219 |
| 274 | 3300046559 | Ga0495667_0005531 | Ga0495667_0005531_4182_4856 | 219 |
| 275 | 3300046559 | Ga0495667_0045061 | Ga0495667_0045061_2196_2870 | 219 |
| 276 | 3300046642 | Ga0495634_0060389 | Ga0495634_0060389_706_1380 | 219 |
| 277 | 3300046663 | Ga0495635_0020488 | Ga0495635_0020488_3087_3761 | 219 |
| 278 | 3300046674 | Ga0495588_0140882 | Ga0495588_0140882_359_1033 | 219 |
| 279 | 3300046675 | Ga0495657_0048144 | Ga0495657_0048144_354_1028 | 219 |
| 280 | 3300046678 | Ga0495599_0008147 | Ga0495599_0008147_2552_3226 | 219 |
| 281 | 3300046689 | Ga0495613_0481570 | Ga0495613_0481570_127_801 | 219 |
| 282 | 3300046809 | Ga0495600_0062774 | Ga0495600_0062774_1001_1675 | 219 |
| 283 | 3300047321 | Ga0495676_0522690 | Ga0495676_0522690_76_750 | 219 |
| 284 | 3300047322 | Ga0495680_0016943 | Ga0495680_0016943_769_1443 | 219 |
| 285 | 3300047444 | Ga0495675_0044867 | Ga0495675_0044867_547_1221 | 219 |
| 286 | 3300047471 | Ga0495684_0019871 | Ga0495684_0019871_3691_4365 | 219 |
| 287 | 3300048088 | Ga0495602_0027967 | Ga0495602_0027967_1471_2145 | 219 |
| 288 | 3300048904 | Ga0496101_0275636 | Ga0496101_0275636_451_1125 | 219 |
| 289 | 3300048905 | Ga0496102_0349523 | Ga0496102_0349523_548_1222 | 219 |
| 290 | 3300048907 | Ga0496104_0209215 | Ga0496104_0209215_471_1145 | 219 |
| 291 | 3300048911 | Ga0496108_0022975 | Ga0496108_0022975_2180_2854 | 219 |
| 292 | 3300048912 | Ga0496109_0063041 | Ga0496109_0063041_2012_2686 | 219 |
| 293 | 3300048914 | Ga0496111_0083486 | Ga0496111_0083486_1497_2171 | 219 |
| 294 | 3300048917 | Ga0496114_0482274 | Ga0496114_0482274_185_865 | 219 |
| 295 | 3300048929 | Ga0496126_0048339 | Ga0496126_0048339_2477_3136 | 219 |
| 296 | 3300050510 | nmdc:mga06r32_326209_c1 | nmdc:mga06r32_326209_c1_727_1386 | 219 |
| 297 | 3300053078 | Ga0495612_0052712 | Ga0495612_0052712_667_1341 | 219 |
| 298 | 3300053084 | Ga0495595_0018259 | Ga0495595_0018259_895_1569 | 219 |
| 299 | 3300053085 | Ga0495619_0008447 | Ga0495619_0008447_4841_5515 | 219 |
| 300 | 3300053156 | Ga0500622_0203200 | Ga0500622_0203200_119_796 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hml-assembly1.cif.gz_B | co-crystal structure of the c terminal dna binding domain of saccharopolyspora erythraea glnr in complex with its conserved promoter dna in 2.95 angstrom resolution | 0.9329 | 131 | 219 |
| 2pmu-assembly1.cif.gz_E | crystal structure of the dna-binding domain of phop | 0.9246 | 126 | 218 |
| 7p8c-assembly1.cif.gz_B | crystal structure of the receiver domain of a. thaliana cytokinin receptor atcre1 in complex with k+ | 0.9224 | 2 | 68 |
| 2pmu-assembly1.cif.gz_C | crystal structure of the dna-binding domain of phop | 0.9179 | 126 | 218 |
| 1zy2-assembly1.cif.gz_A | crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus | 0.9177 | 1 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9678 | 1 | 68 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9608 | 1 | 80 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9517 | 1 | 80 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9476 | 1 | 83 | 3.40.50.2300 |
| af_Q2FY79_1_81_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9442 | 2 | 80 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R3CQK3-F1-model_v4 | deleted | 0.9029 | 1 | 219 |
|
| AF-A0A4R3CQK3-F1-model_v4 | deleted | 0.899 | 1 | 219 |
|
| AF-A0A431KUN9-F1-model_v4 | Response regulator transcription factor | 0.8971 | 2 | 218 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A172YPY8-F1-model_v4 | DNA-binding response regulator | 0.891 | 1 | 219 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A501XJ82-F1-model_v4 | Response regulator transcription factor | 0.8857 | 1 | 219 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar