F395465

General Info

Members Datasets Scaffolds Average Seq Length
300 229 286 221

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0128298|Ga0373925_0128298_512_1165
Length 205
Sequence VLVVEDERLLADSIAEGLRRFAMAVDVCYDGECALERVGVHEYDVVVLDRDLPDVSGDEVCAAVIAAGDVSDRVEGLGLGADDYLTKPFAFSELVARVQALGRRARPALPPVLSAHGVVLDLPRHQASRDGRFLPLSPKEFAVLRVLMRADGTVVSVESLLEKAWDEHADPFTNAVRMAVMTLRRKLGDPPLIETVPGAGYRFGA

Samples

Sample ID Description Type Environment
1 2558860280 Kutzneria sp. 744 Isolate Unclassified
2 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
3 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
4 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
5 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
6 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
7 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
8 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
9 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
10 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
35 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
36 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
70 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
71 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
72 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
73 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
74 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
75 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
76 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
89 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
90 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
91 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
98 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
99 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
100 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
101 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
102 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
109 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
110 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
111 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
112 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
113 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
117 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
128 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
137 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
141 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
158 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
210 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
213 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
214 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
215 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
216 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
217 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
218 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
221 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
222 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
223 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
224 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
227 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
228 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
229 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.33
Metatranscriptomes 0
Isolates 4.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11
Nodule 0
Rhizoplane 2.33
Rhizosphere 72.67
Stem 0
Stem Tuber 0
Unclassified 14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10001742 3300003203 Bacteria 10232
2 Ga0070683_100353822 3300005329 Bacteria 1399
3 Ga0070709_10040331 3300005434 Bacteria 2870
4 Ga0070713_100102126 3300005436 Bacteria 2486
5 Ga0070710_10000076 3300005437 Bacteria 44489
6 Ga0070710_10156335 3300005437 Bacteria 1410
7 Ga0070681_10558964 3300005458 Bacteria 1058
8 Ga0070706_100017442 3300005467 Bacteria 6625
9 Ga0070707_100029435 3300005468 Bacteria 5228
10 Ga0070698_100001125 3300005471 Bacteria 29557
11 Ga0070698_100066273 3300005471 Bacteria 3635
12 Ga0070698_100067498 3300005471 Bacteria 3596
13 Ga0068853_100013703 3300005539 Bacteria 6622
14 Ga0070665_100319932 3300005548 Bacteria 1556
15 Ga0068855_100519058 3300005563 Bacteria 1292
16 Ga0068852_100410304 3300005616 Bacteria 1334
17 Ga0068859_100116615 3300005617 Bacteria 2735
18 Ga0068860_101148023 3300005843 Bacteria 797
19 Ga0081455_10000365 3300005937 Bacteria 59750
20 Ga0081539_10000186 3300005985 Bacteria 147547
21 Ga0081539_10000937 3300005985 Bacteria 54700
22 Ga0081539_10001066 3300005985 Bacteria 50181
23 Ga0070717_10043824 3300006028 Bacteria 3653
24 Ga0075365_10002502 3300006038 Bacteria 9046
25 Ga0075363_100012611 3300006048 Bacteria 4078
26 Ga0075364_10003665 3300006051 Bacteria 8759
27 Ga0075364_10009421 3300006051 Bacteria 5858
28 Ga0070716_100070379 3300006173 Bacteria 2054
29 Ga0070712_100062236 3300006175 Bacteria 2638
30 Ga0075362_10009664 3300006177 Bacteria 3739
31 Ga0075367_10189337 3300006178 Bacteria 1284
32 Ga0075369_10002427 3300006186 Bacteria 6643
33 Ga0075369_10005391 3300006186 Bacteria 4777
34 Ga0075369_10089666 3300006186 Bacteria 1371
35 Ga0097621_100414856 3300006237 Bacteria 1207
36 Ga0068871_100660369 3300006358 Bacteria 955
37 Ga0075430_100204038 3300006846 Bacteria 1641
38 Ga0097620_100116614 3300006931 Bacteria 2735
39 Ga0105245_10097103 3300009098 Bacteria 2720
40 Ga0105237_10346787 3300009545 Bacteria 1489
41 Ga0105249_11253880 3300009553 Bacteria 813
42 Ga0105239_10288990 3300010375 Bacteria 1846
43 Ga0157369_10222121 3300013105 Bacteria 1977
44 Ga0157374_10237045 3300013296 Bacteria 1793
45 Ga0157378_10397315 3300013297 Bacteria 1357
46 Ga0163162_10883826 3300013306 Bacteria 1007
47 Ga0157375_10370239 3300013308 Bacteria 1599
48 Ga0157379_10062538 3300014968 Bacteria 3329
49 Ga0157376_10598038 3300014969 Bacteria 1097
50 Ga0213875_10004990 3300021388 Bacteria 7199
51 Ga0207692_10003844 3300025898 Bacteria 5901
52 Ga0207692_10194568 3300025898 Bacteria 1189
53 Ga0207685_10313488 3300025905 Bacteria 780
54 Ga0207699_10124708 3300025906 Bacteria 1671
55 Ga0207684_10016302 3300025910 Bacteria 6380
56 Ga0207693_10188859 3300025915 Bacteria 1622
57 Ga0207646_10137137 3300025922 Bacteria 2203
58 Ga0207646_10858840 3300025922 Bacteria 806
59 Ga0207664_10456557 3300025929 Bacteria 1141
60 Ga0207669_10063914 3300025937 Bacteria 2275
61 Ga0207665_10104724 3300025939 Bacteria 1980
62 Ga0207667_10541847 3300025949 Bacteria 1177
63 Ga0207639_10019720 3300026041 Bacteria 4814
64 Ga0207702_10304504 3300026078 Bacteria 1513
65 Ga0207675_100680114 3300026118 Bacteria 1037
66 Ga0207698_10246865 3300026142 Bacteria 1631
67 Ga0207698_10844533 3300026142 Bacteria 920
68 Ga0268266_10353644 3300028379 Bacteria 1381
69 Ga0268264_10439072 3300028381 Bacteria 1262
70 Ga0307517_10015948 3300028786 Bacteria 9921
71 Ga0307517_10190663 3300028786 Bacteria 1302
72 Ga0307515_10012933 3300028794 Bacteria 15651
73 Ga0307515_10017412 3300028794 Bacteria 13088
74 Ga0307515_10022408 3300028794 Bacteria 11134
75 Ga0307515_10053708 3300028794 Bacteria 5935
76 Ga0307515_10060404 3300028794 Bacteria 5406
77 Ga0307515_10205862 3300028794 Bacteria 1828
78 Ga0307511_10000394 3300030521 Bacteria 46522
79 Ga0307512_10002113 3300030522 Bacteria 26083
80 Ga0307512_10024843 3300030522 Bacteria 5321
81 Ga0307512_10137274 3300030522 Bacteria 1509
82 Ga0316177_1186064 3300030731 Bacteria 2538
83 Ga0314311_1068355 3300030733 Bacteria 4857
84 Ga0316180_1184348 3300030736 Bacteria 2850
85 Ga0316181_1026786 3300030744 Bacteria 1772
86 Ga0307513_10000002 3300031456 Bacteria 842612
87 Ga0307513_10015433 3300031456 Bacteria 9259
88 Ga0307513_10046408 3300031456 Bacteria 4736
89 Ga0307513_10425471 3300031456 Bacteria 1057
90 Ga0307513_10433540 3300031456 Bacteria 1042
91 Ga0307509_10015548 3300031507 Bacteria 8870
92 Ga0307509_10129764 3300031507 Bacteria 2479
93 Ga0307408_100179295 3300031548 Bacteria 1697
94 Ga0307508_10015214 3300031616 Bacteria 7012
95 Ga0307508_10024224 3300031616 Bacteria 5508
96 Ga0307508_10053688 3300031616 Bacteria 3575
97 Ga0307508_10065987 3300031616 Bacteria 3187
98 Ga0307508_10227227 3300031616 Bacteria 1465
99 Ga0307516_10001676 3300031730 Bacteria 30536
100 Ga0307516_10014516 3300031730 Bacteria 8329
101 Ga0307405_10448643 3300031731 Bacteria 1022
102 Ga0307518_10000143 3300031838 Bacteria 52098
103 Ga0307410_10325653 3300031852 Bacteria 1221
104 Ga0307406_10260280 3300031901 Bacteria 1312
105 Ga0307409_100574460 3300031995 Bacteria 1110
106 Ga0307416_100569846 3300032002 Bacteria 1208
107 Ga0307411_10022932 3300032005 Bacteria 3686
108 Ga0307415_100005351 3300032126 Bacteria 6802
109 Ga0307415_100203541 3300032126 Bacteria 1573
110 Ga0307507_10046024 3300033179 Bacteria 4283
111 Ga0307507_10051947 3300033179 Bacteria 3938
112 Ga0307507_10076802 3300033179 Bacteria 2976
113 Ga0307510_10057702 3300033180 Bacteria 4026
114 Ga0373934_0082148 3300035086 Bacteria 1295
115 Ga0373940_0012657 3300035088 Bacteria 2024
116 Ga0373936_0101800 3300035113 Bacteria 1212
117 Ga0373954_0044881 3300035118 Bacteria 2064
118 Ga0373956_0067392 3300035119 Bacteria 1629
119 Ga0373960_0124990 3300035121 Bacteria 857
120 Ga0373942_0000564 3300035207 Bacteria 10407
121 Ga0373931_0074948 3300035691 Bacteria 1855
122 Ga0373927_0321876 3300035695 Bacteria 1018
123 Ga0373933_0039453 3300035724 Bacteria 2778
124 Ga0373925_0128298 3300037068 Bacteria 1975
125 Ga0395900_0042761 3300037418 Bacteria 4668
126 Ga0395900_0111431 3300037418 Bacteria 2811
127 Ga0395900_0848507 3300037418 Bacteria 839
128 Ga0395898_0037316 3300037466 Bacteria 4822
129 Ga0395905_0129867 3300037471 Bacteria 2370
130 Ga0395905_0897388 3300037471 Bacteria 789
131 Ga0436364_1353927 3300037853 Bacteria 14043
132 Ga0395901_0065324 3300038443 Bacteria 3788
133 Ga0439436_0006339 3300041404 Bacteria 3632
134 Ga0439439_0007522 3300041406 Bacteria 2550
135 Ga0439461_0043100 3300041410 Bacteria 980
136 Ga0439466_0009134 3300041411 Bacteria 3716
137 Ga0439466_0092479 3300041411 Bacteria 947
138 Ga0439465_0013826 3300041413 Bacteria 2512
139 Ga0439442_031079 3300042002 Bacteria 1115
140 Ga0439449_0001920 3300042007 Bacteria 8161
141 Ga0439435_0009322 3300042436 Bacteria 2302
142 Ga0466972_0002274 3300044658 Bacteria 9441
143 Ga0466965_0000765 3300044683 Bacteria 12102
144 Ga0466960_0022202 3300044901 Bacteria 2835
145 Ga0466960_0025475 3300044901 Bacteria 2677
146 Ga0466967_0274503 3300045976 Bacteria 1616
147 Ga0495627_016130 3300046453 Bacteria 2564
148 Ga0495592_0025214 3300046454 Bacteria 4514
149 Ga0495592_0072391 3300046454 Bacteria 2507
150 Ga0495629_0002765 3300046459 Bacteria 13416
151 Ga0495629_0056777 3300046459 Bacteria 2737
152 Ga0495629_0096256 3300046459 Bacteria 2065
153 Ga0495629_0119413 3300046459 Bacteria 1837
154 Ga0495641_0131951 3300046461 Bacteria 1115
155 Ga0495651_0032623 3300046462 Bacteria 4061
156 Ga0495651_0180661 3300046462 Bacteria 1493
157 Ga0495653_0009600 3300046463 Bacteria 7915
158 Ga0495582_0062879 3300046473 Bacteria 2051
159 Ga0495662_0133027 3300046476 Bacteria 1223
160 Ga0495664_0021490 3300046477 Bacteria 3727
161 Ga0495585_0038238 3300046492 Bacteria 2701
162 Ga0495618_0012115 3300046514 Bacteria 5235
163 Ga0495628_0003623 3300046516 Bacteria 13806
164 Ga0495628_0698689 3300046516 Bacteria 716
165 Ga0495632_0025038 3300046519 Bacteria 3161
166 Ga0495643_0005367 3300046522 Bacteria 8679
167 Ga0495666_0091403 3300046526 Bacteria 1436
168 Ga0495666_0125253 3300046526 Bacteria 1202
169 Ga0495652_0048209 3300046529 Bacteria 3651
170 Ga0495665_0155598 3300046531 Bacteria 1192
171 Ga0495640_0010270 3300046533 Bacteria 7242
172 Ga0495640_0097041 3300046533 Bacteria 1938
173 Ga0495586_0028962 3300046535 Bacteria 2964
174 Ga0495587_0004386 3300046536 Bacteria 9303
175 Ga0495597_0034352 3300046542 Bacteria 2292
176 Ga0495633_0217789 3300046558 Bacteria 874
177 Ga0495667_0005531 3300046559 Bacteria 8543
178 Ga0495667_0045061 3300046559 Bacteria 2921
179 Ga0495634_0002754 3300046642 Bacteria 14446
180 Ga0495634_0060389 3300046642 Bacteria 2522
181 Ga0495625_0043452 3300046660 Bacteria 3258
182 Ga0495635_0020488 3300046663 Bacteria 4606
183 Ga0495588_0012362 3300046674 Bacteria 4033
184 Ga0495588_0140882 3300046674 Bacteria 1274
185 Ga0495657_0002010 3300046675 Bacteria 17314
186 Ga0495657_0048144 3300046675 Bacteria 2877
187 Ga0495599_0008147 3300046678 Bacteria 6364
188 Ga0495613_0020431 3300046689 Bacteria 4936
189 Ga0495613_0321954 3300046689 Bacteria 1067
190 Ga0495613_0481570 3300046689 Bacteria 837
191 Ga0495624_0011067 3300046690 Bacteria 6210
192 Ga0495624_0059426 3300046690 Bacteria 2399
193 Ga0495670_0218773 3300046691 Bacteria 1011
194 Ga0495671_0015410 3300046692 Bacteria 4094
195 Ga0495600_0007248 3300046809 Bacteria 6771
196 Ga0495600_0062774 3300046809 Bacteria 2427
197 Ga0495660_0046463 3300046810 Bacteria 2381
198 Ga0495581_0126816 3300047315 Bacteria 1486
199 Ga0495581_0444174 3300047315 Bacteria 756
200 Ga0495604_0009235 3300047317 Bacteria 7806
201 Ga0495676_0006562 3300047321 Bacteria 10721
202 Ga0495676_0522690 3300047321 Bacteria 777
203 Ga0495680_0016943 3300047322 Bacteria 6239
204 Ga0495683_0018661 3300047323 Bacteria 3584
205 Ga0495687_037368 3300047443 Bacteria 2164
206 Ga0495687_057385 3300047443 Bacteria 1619
207 Ga0495675_0044867 3300047444 Bacteria 2815
208 Ga0495685_002723 3300047447 Bacteria 5573
209 Ga0495681_0000901 3300047470 Bacteria 22973
210 Ga0495681_0008563 3300047470 Bacteria 6399
211 Ga0495684_0019871 3300047471 Bacteria 5175
212 Ga0495602_0027967 3300048088 Bacteria 5408
213 Ga0495614_0011164 3300048089 Bacteria 3952
214 Ga0496101_0275636 3300048904 Bacteria 1314
215 Ga0496102_0349523 3300048905 Bacteria 1392
216 Ga0496104_0209215 3300048907 Bacteria 1862
217 Ga0496108_0022975 3300048911 Bacteria 5132
218 Ga0496109_0063041 3300048912 Bacteria 3390
219 Ga0496111_0083486 3300048914 Bacteria 2334
220 Ga0496114_0482274 3300048917 Bacteria 1097
221 Ga0496126_0048339 3300048929 Bacteria 3889
222 Ga0501031_0057378 3300049568 Bacteria 2537
223 Ga0501032_0001232 3300049569 Bacteria 20538
224 Ga0501033_0072346 3300049570 Bacteria 2531
225 Ga0501033_0171371 3300049570 Bacteria 1558
226 Ga0501034_0015478 3300049571 Bacteria 7837
227 Ga0501034_0284298 3300049571 Bacteria 1593
228 Ga0501036_0274408 3300049572 Bacteria 1411
229 Ga0501037_0001681 3300049573 Bacteria 16077
230 Ga0501037_0192296 3300049573 Bacteria 1444
231 Ga0501038_0000670 3300049574 Bacteria 30475
232 Ga0501038_0201440 3300049574 Bacteria 1597
233 Ga0501039_0037732 3300049575 Bacteria 3730
234 Ga0501040_0133179 3300049576 Bacteria 1748
235 Ga0501041_0013228 3300049577 Bacteria 4888
236 Ga0501042_0065256 3300049578 Bacteria 2601
237 Ga0501043_0000700 3300049579 Bacteria 29670
238 Ga0501046_0022547 3300049580 Bacteria 5187
239 Ga0501047_0000074 3300049581 Bacteria 125728
240 Ga0501047_0001072 3300049581 Bacteria 27270
241 Ga0501067_0002419 3300049583 Bacteria 10315
242 Ga0501068_0001735 3300049584 Bacteria 11587
243 Ga0501069_0005120 3300049585 Bacteria 6806
244 Ga0501070_0206563 3300049586 Bacteria 1612
245 Ga0501073_0010266 3300049589 Bacteria 6876
246 Ga0501076_0035937 3300049592 Bacteria 3879
247 Ga0501079_0040017 3300049741 Bacteria 3616
248 Ga0501083_0002353 3300049744 Bacteria 12945
249 Ga0501035_0000304 3300049822 Bacteria 57980
250 Ga0501035_0012116 3300049822 Bacteria 7975
251 Ga0501035_0094640 3300049822 Bacteria 2626
252 Ga0501035_0113749 3300049822 Bacteria 2370
253 Ga0501044_0000856 3300049823 Bacteria 36592
254 Ga0501044_0032500 3300049823 Bacteria 5486
255 Ga0501045_0250908 3300049824 Bacteria 1317
256 nmdc:mga03683_8859_c1 3300050489 Bacteria 3555
257 nmdc:mga03n38_140758_c1 3300050490 Bacteria 1205
258 nmdc:mga00v17_2114_c1 3300050491 Bacteria 10213
259 nmdc:mga00v17_83078_c1 3300050491 Bacteria 2003
260 nmdc:mga0yw44_7361_c1 3300050492 Bacteria 5409
261 nmdc:mga06z11_430261_c1 3300050494 Bacteria 796
262 nmdc:mga04h51_108783_c1 3300050495 Bacteria 1019
263 nmdc:mga06r32_326209_c1 3300050510 Bacteria 1520
264 nmdc:mga0sz30_4971_c1 3300050516 Bacteria 3490
265 Ga0495612_0052712 3300053078 Bacteria 1674
266 Ga0495655_0009823 3300053083 Bacteria 1869
267 Ga0495595_0018259 3300053084 Bacteria 3030
268 Ga0495619_0008447 3300053085 Bacteria 6511
269 Ga0500578_0008811 3300053086 Bacteria 6584
270 Ga0500644_0045908 3300053088 Bacteria 1474
271 Ga0500646_0000369 3300053090 Bacteria 13609
272 Ga0500646_0000416 3300053090 Bacteria 12637
273 Ga0500641_0017009 3300053096 Bacteria 2713
274 Ga0500660_084572 3300053100 Bacteria 1440
275 Ga0500560_000490 3300053107 Bacteria 5516
276 Ga0500560_004609 3300053107 Bacteria 2953
277 Ga0500569_012185 3300053109 Bacteria 2075
278 Ga0500568_0013533 3300053139 Bacteria 3717
279 Ga0500573_0015951 3300053140 Bacteria 4262
280 Ga0500577_0025680 3300053142 Bacteria 1996
281 Ga0500577_0228889 3300053142 Bacteria 806
282 Ga0500622_0203200 3300053156 Bacteria 900
283 Ga0500656_009380 3300053732 Bacteria 1052
284 Ga0500587_001235 3300053739 Bacteria 3559
285 Ga0501084_0002273 3300054114 Bacteria 15430
286 Ga0530510_0078230 3300061734 Bacteria 2404

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053090 Ga0500646_0000369 Ga0500646_0000369_4524_5180 201
2 3300037068 Ga0373925_0128298 Ga0373925_0128298_512_1165 205
3 3300006186 Ga0075369_10002427 Ga0075369_100024272 208
4 3300005471 Ga0070698_100001125 Ga0070698_1000011254 213
5 iso_pu_bacteria 2558860280 2559425430 213
6 iso_pu_bacteria 3006321560 3006322809 213
7 iso_pu_bacteria 2675903059 2676481286 214
8 iso_pu_bacteria 2795385472 2795794891 214
9 iso_pu_bacteria 2861520306 2861520359 214
10 iso_pu_bacteria 8001781756 8001790321 214
11 iso_pu_bacteria 8056054917 8056056653 214
12 3300037418 Ga0395900_0848507 Ga0395900_0848507_17_664 215
13 iso_pu_bacteria 2791354901 2791911695 215
14 iso_pu_bacteria 2795385470 2795783611 215
15 iso_pu_bacteria 2866612099 2866612751 215
16 iso_pu_bacteria 2899359706 2899366986 215
17 iso_pu_bacteria 2917736166 2917740314 215
18 iso_pu_bacteria 2917736166 2917743495 215
19 iso_pu_bacteria 8047710418 8047714250 215
20 3300053088 Ga0500644_0045908 Ga0500644_0045908_705_1355 216
21 3300053142 Ga0500577_0025680 Ga0500577_0025680_103_753 216
22 3300005539 Ga0068853_100013703 Ga0068853_1000137035 217
23 3300021388 Ga0213875_10004990 Ga0213875_100049902 217
24 3300025910 Ga0207684_10016302 Ga0207684_100163026 217
25 3300026041 Ga0207639_10019720 Ga0207639_100197206 217
26 3300026142 Ga0207698_10246865 Ga0207698_102468652 217
27 3300030521 Ga0307511_10000394 Ga0307511_1000039425 217
28 3300037853 Ga0436364_1353927 Ga0436364_1353927_7770_8423 217
29 3300045976 Ga0466967_0274503 Ga0466967_0274503_149_802 217
30 3300046454 Ga0495592_0025214 Ga0495592_0025214_2697_3350 217
31 3300046459 Ga0495629_0056777 Ga0495629_0056777_1191_1844 217
32 3300046462 Ga0495651_0032623 Ga0495651_0032623_1565_2218 217
33 3300046476 Ga0495662_0133027 Ga0495662_0133027_44_697 217
34 3300046477 Ga0495664_0021490 Ga0495664_0021490_1655_2308 217
35 3300046514 Ga0495618_0012115 Ga0495618_0012115_4218_4871 217
36 3300046516 Ga0495628_0003623 Ga0495628_0003623_11555_12208 217
37 3300046526 Ga0495666_0125253 Ga0495666_0125253_363_1016 217
38 3300046529 Ga0495652_0048209 Ga0495652_0048209_854_1507 217
39 3300046533 Ga0495640_0010270 Ga0495640_0010270_1725_2378 217
40 3300046642 Ga0495634_0002754 Ga0495634_0002754_6345_6998 217
41 3300046675 Ga0495657_0002010 Ga0495657_0002010_3674_4327 217
42 3300046689 Ga0495613_0020431 Ga0495613_0020431_1587_2240 217
43 3300046689 Ga0495613_0321954 Ga0495613_0321954_62_715 217
44 3300046690 Ga0495624_0011067 Ga0495624_0011067_2559_3212 217
45 3300046809 Ga0495600_0007248 Ga0495600_0007248_2037_2690 217
46 3300047315 Ga0495581_0126816 Ga0495581_0126816_669_1322 217
47 3300047315 Ga0495581_0444174 Ga0495581_0444174_49_702 217
48 3300047317 Ga0495604_0009235 Ga0495604_0009235_86_739 217
49 3300047321 Ga0495676_0006562 Ga0495676_0006562_2464_3117 217
50 3300049568 Ga0501031_0057378 Ga0501031_0057378_1611_2303 217
51 3300049569 Ga0501032_0001232 Ga0501032_0001232_12759_13457 217
52 3300049570 Ga0501033_0072346 Ga0501033_0072346_1348_2040 217
53 3300049570 Ga0501033_0171371 Ga0501033_0171371_692_1390 217
54 3300049571 Ga0501034_0015478 Ga0501034_0015478_6971_7669 217
55 3300049571 Ga0501034_0284298 Ga0501034_0284298_563_1255 217
56 3300049572 Ga0501036_0274408 Ga0501036_0274408_590_1282 217
57 3300049573 Ga0501037_0001681 Ga0501037_0001681_10151_10849 217
58 3300049573 Ga0501037_0192296 Ga0501037_0192296_474_1127 217
59 3300049574 Ga0501038_0000670 Ga0501038_0000670_11796_12494 217
60 3300049574 Ga0501038_0201440 Ga0501038_0201440_677_1369 217
61 3300049575 Ga0501039_0037732 Ga0501039_0037732_56_754 217
62 3300049576 Ga0501040_0133179 Ga0501040_0133179_231_929 217
63 3300049577 Ga0501041_0013228 Ga0501041_0013228_446_1144 217
64 3300049578 Ga0501042_0065256 Ga0501042_0065256_1349_2047 217
65 3300049579 Ga0501043_0000700 Ga0501043_0000700_21358_22056 217
66 3300049580 Ga0501046_0022547 Ga0501046_0022547_3081_3779 217
67 3300049581 Ga0501047_0000074 Ga0501047_0000074_109176_109829 217
68 3300049581 Ga0501047_0001072 Ga0501047_0001072_5107_5805 217
69 3300049583 Ga0501067_0002419 Ga0501067_0002419_6627_7325 217
70 3300049584 Ga0501068_0001735 Ga0501068_0001735_6710_7408 217
71 3300049585 Ga0501069_0005120 Ga0501069_0005120_2793_3491 217
72 3300049586 Ga0501070_0206563 Ga0501070_0206563_360_1058 217
73 3300049589 Ga0501073_0010266 Ga0501073_0010266_2863_3561 217
74 3300049592 Ga0501076_0035937 Ga0501076_0035937_2773_3471 217
75 3300049741 Ga0501079_0040017 Ga0501079_0040017_2863_3561 217
76 3300049744 Ga0501083_0002353 Ga0501083_0002353_3509_4207 217
77 3300049822 Ga0501035_0000304 Ga0501035_0000304_33592_34290 217
78 3300049822 Ga0501035_0012116 Ga0501035_0012116_5783_6436 217
79 3300049822 Ga0501035_0094640 Ga0501035_0094640_1424_2116 217
80 3300049822 Ga0501035_0113749 Ga0501035_0113749_107_760 217
81 3300049823 Ga0501044_0000856 Ga0501044_0000856_28567_29265 217
82 3300049823 Ga0501044_0032500 Ga0501044_0032500_501_1154 217
83 3300049824 Ga0501045_0250908 Ga0501045_0250908_83_775 217
84 3300054114 Ga0501084_0002273 Ga0501084_0002273_13493_14191 217
85 3300061734 Ga0530510_0078230 Ga0530510_0078230_85_783 217
86 3300005471 Ga0070698_100066273 Ga0070698_1000662732 218
87 3300005616 Ga0068852_100410304 Ga0068852_1004103041 218
88 3300005937 Ga0081455_10000365 Ga0081455_1000036544 218
89 3300005985 Ga0081539_10000186 Ga0081539_1000018657 218
90 3300005985 Ga0081539_10001066 Ga0081539_1000106642 218
91 3300006038 Ga0075365_10002502 Ga0075365_100025025 218
92 3300006048 Ga0075363_100012611 Ga0075363_1000126115 218
93 3300006051 Ga0075364_10003665 Ga0075364_100036656 218
94 3300006051 Ga0075364_10009421 Ga0075364_100094215 218
95 3300006177 Ga0075362_10009664 Ga0075362_100096643 218
96 3300006178 Ga0075367_10189337 Ga0075367_101893372 218
97 3300006186 Ga0075369_10005391 Ga0075369_100053915 218
98 3300006186 Ga0075369_10089666 Ga0075369_100896661 218
99 3300006846 Ga0075430_100204038 Ga0075430_1002040383 218
100 3300009545 Ga0105237_10346787 Ga0105237_103467872 218
101 3300013297 Ga0157378_10397315 Ga0157378_103973151 218
102 3300026118 Ga0207675_100680114 Ga0207675_1006801142 218
103 3300026142 Ga0207698_10844533 Ga0207698_108445331 218
104 3300028786 Ga0307517_10015948 Ga0307517_100159487 218
105 3300028786 Ga0307517_10190663 Ga0307517_101906632 218
106 3300028794 Ga0307515_10012933 Ga0307515_100129335 218
107 3300028794 Ga0307515_10017412 Ga0307515_100174127 218
108 3300028794 Ga0307515_10022408 Ga0307515_100224089 218
109 3300028794 Ga0307515_10053708 Ga0307515_100537083 218
110 3300028794 Ga0307515_10060404 Ga0307515_100604043 218
111 3300028794 Ga0307515_10205862 Ga0307515_102058622 218
112 3300030522 Ga0307512_10024843 Ga0307512_100248434 218
113 3300030522 Ga0307512_10137274 Ga0307512_101372742 218
114 3300030744 Ga0316181_1026786 Ga0316181_10267862 218
115 3300031456 Ga0307513_10000002 Ga0307513_10000002400 218
116 3300031456 Ga0307513_10015433 Ga0307513_100154338 218
117 3300031456 Ga0307513_10046408 Ga0307513_100464082 218
118 3300031456 Ga0307513_10425471 Ga0307513_104254712 218
119 3300031456 Ga0307513_10433540 Ga0307513_104335401 218
120 3300031507 Ga0307509_10015548 Ga0307509_100155482 218
121 3300031507 Ga0307509_10129764 Ga0307509_101297643 218
122 3300031548 Ga0307408_100179295 Ga0307408_1001792951 218
123 3300031616 Ga0307508_10015214 Ga0307508_100152142 218
124 3300031616 Ga0307508_10024224 Ga0307508_100242244 218
125 3300031616 Ga0307508_10053688 Ga0307508_100536884 218
126 3300031616 Ga0307508_10065987 Ga0307508_100659872 218
127 3300031616 Ga0307508_10227227 Ga0307508_102272272 218
128 3300031730 Ga0307516_10001676 Ga0307516_100016766 218
129 3300031730 Ga0307516_10014516 Ga0307516_100145162 218
130 3300031731 Ga0307405_10448643 Ga0307405_104486432 218
131 3300031838 Ga0307518_10000143 Ga0307518_1000014316 218
132 3300031852 Ga0307410_10325653 Ga0307410_103256532 218
133 3300031901 Ga0307406_10260280 Ga0307406_102602801 218
134 3300031995 Ga0307409_100574460 Ga0307409_1005744601 218
135 3300032002 Ga0307416_100569846 Ga0307416_1005698461 218
136 3300032005 Ga0307411_10022932 Ga0307411_100229325 218
137 3300032126 Ga0307415_100005351 Ga0307415_1000053514 218
138 3300033179 Ga0307507_10046024 Ga0307507_100460242 218
139 3300033179 Ga0307507_10051947 Ga0307507_100519474 218
140 3300033179 Ga0307507_10076802 Ga0307507_100768023 218
141 3300033180 Ga0307510_10057702 Ga0307510_100577023 218
142 3300035088 Ga0373940_0012657 Ga0373940_0012657_1354_2010 218
143 3300035207 Ga0373942_0000564 Ga0373942_0000564_1851_2507 218
144 3300037418 Ga0395900_0042761 Ga0395900_0042761_2961_3617 218
145 3300037418 Ga0395900_0111431 Ga0395900_0111431_1384_2040 218
146 3300037466 Ga0395898_0037316 Ga0395898_0037316_3432_4088 218
147 3300037471 Ga0395905_0129867 Ga0395905_0129867_892_1548 218
148 3300037471 Ga0395905_0897388 Ga0395905_0897388_59_715 218
149 3300038443 Ga0395901_0065324 Ga0395901_0065324_1251_1907 218
150 3300041404 Ga0439436_0006339 Ga0439436_0006339_2031_2687 218
151 3300041406 Ga0439439_0007522 Ga0439439_0007522_1001_1657 218
152 3300041410 Ga0439461_0043100 Ga0439461_0043100_257_913 218
153 3300041411 Ga0439466_0009134 Ga0439466_0009134_510_1166 218
154 3300041411 Ga0439466_0092479 Ga0439466_0092479_229_885 218
155 3300041413 Ga0439465_0013826 Ga0439465_0013826_1042_1698 218
156 3300042002 Ga0439442_031079 Ga0439442_031079_251_907 218
157 3300042007 Ga0439449_0001920 Ga0439449_0001920_6710_7366 218
158 3300042436 Ga0439435_0009322 Ga0439435_0009322_1261_1917 218
159 3300046453 Ga0495627_016130 Ga0495627_016130_902_1636 218
160 3300046459 Ga0495629_0002765 Ga0495629_0002765_8422_9078 218
161 3300046459 Ga0495629_0119413 Ga0495629_0119413_838_1494 218
162 3300046492 Ga0495585_0038238 Ga0495585_0038238_475_1131 218
163 3300046519 Ga0495632_0025038 Ga0495632_0025038_122_778 218
164 3300046522 Ga0495643_0005367 Ga0495643_0005367_5730_6386 218
165 3300046542 Ga0495597_0034352 Ga0495597_0034352_1368_2024 218
166 3300046558 Ga0495633_0217789 Ga0495633_0217789_161_817 218
167 3300046660 Ga0495625_0043452 Ga0495625_0043452_1507_2163 218
168 3300046674 Ga0495588_0012362 Ga0495588_0012362_2265_2921 218
169 3300046690 Ga0495624_0059426 Ga0495624_0059426_1399_2055 218
170 3300046691 Ga0495670_0218773 Ga0495670_0218773_222_878 218
171 3300046692 Ga0495671_0015410 Ga0495671_0015410_1296_1952 218
172 3300046810 Ga0495660_0046463 Ga0495660_0046463_1390_2046 218
173 3300047323 Ga0495683_0018661 Ga0495683_0018661_609_1265 218
174 3300047443 Ga0495687_037368 Ga0495687_037368_151_807 218
175 3300047443 Ga0495687_057385 Ga0495687_057385_545_1201 218
176 3300047447 Ga0495685_002723 Ga0495685_002723_2622_3278 218
177 3300047470 Ga0495681_0000901 Ga0495681_0000901_18114_18770 218
178 3300047470 Ga0495681_0008563 Ga0495681_0008563_5501_6157 218
179 3300048089 Ga0495614_0011164 Ga0495614_0011164_1282_1938 218
180 3300050489 nmdc:mga03683_8859_c1 nmdc:mga03683_8859_c1_579_1235 218
181 3300050490 nmdc:mga03n38_140758_c1 nmdc:mga03n38_140758_c1_207_863 218
182 3300050491 nmdc:mga00v17_2114_c1 nmdc:mga00v17_2114_c1_3290_3946 218
183 3300050491 nmdc:mga00v17_83078_c1 nmdc:mga00v17_83078_c1_387_1043 218
184 3300050492 nmdc:mga0yw44_7361_c1 nmdc:mga0yw44_7361_c1_2473_3129 218
185 3300050494 nmdc:mga06z11_430261_c1 nmdc:mga06z11_430261_c1_67_723 218
186 3300050495 nmdc:mga04h51_108783_c1 nmdc:mga04h51_108783_c1_75_731 218
187 3300050516 nmdc:mga0sz30_4971_c1 nmdc:mga0sz30_4971_c1_1316_1972 218
188 3300053083 Ga0495655_0009823 Ga0495655_0009823_251_907 218
189 3300053086 Ga0500578_0008811 Ga0500578_0008811_970_1626 218
190 3300053090 Ga0500646_0000416 Ga0500646_0000416_11880_12536 218
191 3300053096 Ga0500641_0017009 Ga0500641_0017009_698_1354 218
192 3300053100 Ga0500660_084572 Ga0500660_084572_18_674 218
193 3300053107 Ga0500560_000490 Ga0500560_000490_699_1355 218
194 3300053107 Ga0500560_004609 Ga0500560_004609_189_845 218
195 3300053109 Ga0500569_012185 Ga0500569_012185_859_1515 218
196 3300053139 Ga0500568_0013533 Ga0500568_0013533_2117_2851 218
197 3300053140 Ga0500573_0015951 Ga0500573_0015951_2533_3189 218
198 3300053142 Ga0500577_0228889 Ga0500577_0228889_21_677 218
199 3300053732 Ga0500656_009380 Ga0500656_009380_249_905 218
200 3300053739 Ga0500587_001235 Ga0500587_001235_1366_2022 218
201 3300003203 JGI25406J46586_10001742 JGI25406J46586_100017428 219
202 3300005329 Ga0070683_100353822 Ga0070683_1003538222 219
203 3300005434 Ga0070709_10040331 Ga0070709_100403314 219
204 3300005436 Ga0070713_100102126 Ga0070713_1001021262 219
205 3300005437 Ga0070710_10000076 Ga0070710_1000007619 219
206 3300005437 Ga0070710_10156335 Ga0070710_101563352 219
207 3300005458 Ga0070681_10558964 Ga0070681_105589642 219
208 3300005467 Ga0070706_100017442 Ga0070706_1000174423 219
209 3300005468 Ga0070707_100029435 Ga0070707_1000294355 219
210 3300005471 Ga0070698_100067498 Ga0070698_1000674982 219
211 3300005548 Ga0070665_100319932 Ga0070665_1003199322 219
212 3300005563 Ga0068855_100519058 Ga0068855_1005190582 219
213 3300005617 Ga0068859_100116615 Ga0068859_1001166152 219
214 3300005843 Ga0068860_101148023 Ga0068860_1011480231 219
215 3300005985 Ga0081539_10000937 Ga0081539_100009379 219
216 3300006028 Ga0070717_10043824 Ga0070717_100438242 219
217 3300006173 Ga0070716_100070379 Ga0070716_1000703792 219
218 3300006175 Ga0070712_100062236 Ga0070712_1000622362 219
219 3300006237 Ga0097621_100414856 Ga0097621_1004148562 219
220 3300006358 Ga0068871_100660369 Ga0068871_1006603691 219
221 3300006931 Ga0097620_100116614 Ga0097620_1001166142 219
222 3300009098 Ga0105245_10097103 Ga0105245_100971032 219
223 3300009553 Ga0105249_11253880 Ga0105249_112538801 219
224 3300010375 Ga0105239_10288990 Ga0105239_102889901 219
225 3300013105 Ga0157369_10222121 Ga0157369_102221212 219
226 3300013296 Ga0157374_10237045 Ga0157374_102370452 219
227 3300013306 Ga0163162_10883826 Ga0163162_108838262 219
228 3300013308 Ga0157375_10370239 Ga0157375_103702392 219
229 3300014968 Ga0157379_10062538 Ga0157379_100625382 219
230 3300014969 Ga0157376_10598038 Ga0157376_105980382 219
231 3300025898 Ga0207692_10003844 Ga0207692_100038446 219
232 3300025898 Ga0207692_10194568 Ga0207692_101945682 219
233 3300025905 Ga0207685_10313488 Ga0207685_103134881 219
234 3300025906 Ga0207699_10124708 Ga0207699_101247082 219
235 3300025915 Ga0207693_10188859 Ga0207693_101888592 219
236 3300025922 Ga0207646_10137137 Ga0207646_101371371 219
237 3300025922 Ga0207646_10858840 Ga0207646_108588401 219
238 3300025929 Ga0207664_10456557 Ga0207664_104565571 219
239 3300025937 Ga0207669_10063914 Ga0207669_100639142 219
240 3300025939 Ga0207665_10104724 Ga0207665_101047242 219
241 3300025949 Ga0207667_10541847 Ga0207667_105418472 219
242 3300026078 Ga0207702_10304504 Ga0207702_103045042 219
243 3300028379 Ga0268266_10353644 Ga0268266_103536441 219
244 3300028381 Ga0268264_10439072 Ga0268264_104390721 219
245 3300030522 Ga0307512_10002113 Ga0307512_100021134 219
246 3300030731 Ga0316177_1186064 Ga0316177_11860642 219
247 3300030733 Ga0314311_1068355 Ga0314311_10683555 219
248 3300030736 Ga0316180_1184348 Ga0316180_11843482 219
249 3300032126 Ga0307415_100203541 Ga0307415_1002035412 219
250 3300035086 Ga0373934_0082148 Ga0373934_0082148_38_712 219
251 3300035113 Ga0373936_0101800 Ga0373936_0101800_73_747 219
252 3300035118 Ga0373954_0044881 Ga0373954_0044881_430_1104 219
253 3300035119 Ga0373956_0067392 Ga0373956_0067392_732_1406 219
254 3300035121 Ga0373960_0124990 Ga0373960_0124990_117_797 219
255 3300035691 Ga0373931_0074948 Ga0373931_0074948_412_1092 219
256 3300035695 Ga0373927_0321876 Ga0373927_0321876_270_950 219
257 3300035724 Ga0373933_0039453 Ga0373933_0039453_228_902 219
258 3300044658 Ga0466972_0002274 Ga0466972_0002274_4656_5324 219
259 3300044683 Ga0466965_0000765 Ga0466965_0000765_3446_4114 219
260 3300044901 Ga0466960_0022202 Ga0466960_0022202_150_818 219
261 3300044901 Ga0466960_0025475 Ga0466960_0025475_758_1426 219
262 3300046454 Ga0495592_0072391 Ga0495592_0072391_1613_2287 219
263 3300046459 Ga0495629_0096256 Ga0495629_0096256_417_1091 219
264 3300046461 Ga0495641_0131951 Ga0495641_0131951_403_1083 219
265 3300046462 Ga0495651_0180661 Ga0495651_0180661_53_727 219
266 3300046463 Ga0495653_0009600 Ga0495653_0009600_1896_2570 219
267 3300046473 Ga0495582_0062879 Ga0495582_0062879_52_726 219
268 3300046516 Ga0495628_0698689 Ga0495628_0698689_28_702 219
269 3300046526 Ga0495666_0091403 Ga0495666_0091403_267_941 219
270 3300046531 Ga0495665_0155598 Ga0495665_0155598_402_1076 219
271 3300046533 Ga0495640_0097041 Ga0495640_0097041_612_1286 219
272 3300046535 Ga0495586_0028962 Ga0495586_0028962_795_1469 219
273 3300046536 Ga0495587_0004386 Ga0495587_0004386_5852_6532 219
274 3300046559 Ga0495667_0005531 Ga0495667_0005531_4182_4856 219
275 3300046559 Ga0495667_0045061 Ga0495667_0045061_2196_2870 219
276 3300046642 Ga0495634_0060389 Ga0495634_0060389_706_1380 219
277 3300046663 Ga0495635_0020488 Ga0495635_0020488_3087_3761 219
278 3300046674 Ga0495588_0140882 Ga0495588_0140882_359_1033 219
279 3300046675 Ga0495657_0048144 Ga0495657_0048144_354_1028 219
280 3300046678 Ga0495599_0008147 Ga0495599_0008147_2552_3226 219
281 3300046689 Ga0495613_0481570 Ga0495613_0481570_127_801 219
282 3300046809 Ga0495600_0062774 Ga0495600_0062774_1001_1675 219
283 3300047321 Ga0495676_0522690 Ga0495676_0522690_76_750 219
284 3300047322 Ga0495680_0016943 Ga0495680_0016943_769_1443 219
285 3300047444 Ga0495675_0044867 Ga0495675_0044867_547_1221 219
286 3300047471 Ga0495684_0019871 Ga0495684_0019871_3691_4365 219
287 3300048088 Ga0495602_0027967 Ga0495602_0027967_1471_2145 219
288 3300048904 Ga0496101_0275636 Ga0496101_0275636_451_1125 219
289 3300048905 Ga0496102_0349523 Ga0496102_0349523_548_1222 219
290 3300048907 Ga0496104_0209215 Ga0496104_0209215_471_1145 219
291 3300048911 Ga0496108_0022975 Ga0496108_0022975_2180_2854 219
292 3300048912 Ga0496109_0063041 Ga0496109_0063041_2012_2686 219
293 3300048914 Ga0496111_0083486 Ga0496111_0083486_1497_2171 219
294 3300048917 Ga0496114_0482274 Ga0496114_0482274_185_865 219
295 3300048929 Ga0496126_0048339 Ga0496126_0048339_2477_3136 219
296 3300050510 nmdc:mga06r32_326209_c1 nmdc:mga06r32_326209_c1_727_1386 219
297 3300053078 Ga0495612_0052712 Ga0495612_0052712_667_1341 219
298 3300053084 Ga0495595_0018259 Ga0495595_0018259_895_1569 219
299 3300053085 Ga0495619_0008447 Ga0495619_0008447_4841_5515 219
300 3300053156 Ga0500622_0203200 Ga0500622_0203200_119_796 219

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

131

203

0.96

PF00072

Response_reg

Response regulator receiver domain

1

99

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hml-assembly1.cif.gz_B co-crystal structure of the c terminal dna binding domain of saccharopolyspora erythraea glnr in complex with its conserved promoter dna in 2.95 angstrom resolution 0.9329 131 219
2pmu-assembly1.cif.gz_E crystal structure of the dna-binding domain of phop 0.9246 126 218
7p8c-assembly1.cif.gz_B crystal structure of the receiver domain of a. thaliana cytokinin receptor atcre1 in complex with k+ 0.9224 2 68
2pmu-assembly1.cif.gz_C crystal structure of the dna-binding domain of phop 0.9179 126 218
1zy2-assembly1.cif.gz_A crystal structure of the phosphorylated receiver domain of the transcription regulator ntrc1 from aquifex aeolicus 0.9177 1 120
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9678 1 68 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9608 1 80 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9517 1 80 3.40.50.2300
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9476 1 83 3.40.50.2300
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9442 2 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4R3CQK3-F1-model_v4 deleted 0.9029 1 219
AF-A0A4R3CQK3-F1-model_v4 deleted 0.899 1 219
AF-A0A431KUN9-F1-model_v4 Response regulator transcription factor 0.8971 2 218 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A172YPY8-F1-model_v4 DNA-binding response regulator 0.891 1 219 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A501XJ82-F1-model_v4 Response regulator transcription factor 0.8857 1 219 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
87.33 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map