F395367

General Info

Members Datasets Scaffolds Average Seq Length
300 202 600 363

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10000175|Ga0157372_1000017560
Length 385
Sequence MGRPSGLVTRGGVTRVGAVAVHELTLVEARRIAVRAQLLDRNRPSGLLEVVRGLTLLQSDATAAVAPNADLVVWTRLGSCYRPAEMVEALRDGSLIELRGMIRPGEDIALYRAEMAEWPGSGQVPGWRQAQSDWVDINDRFRQDILDRLEEAGPLTSRGLPDTCLVPWTSSGWNNHRNISMMLEFLELRGEVATVGRRGRDRLWDLASRVYPDDPAVPLAEALRIRDERRLRSLGIARARGPECPVEPMDVSEVGEPAVIDGVKGEWRVDPALLGQPFQGRTALLSPLDRLVFDRKRMVELFAFDYQLEMYKPAAKRRWGYFALPILHSDRLVGKVDATAHRNKGVLQVDAIHQDVPFSKTMAAAVHRELVDLARWLDLDLALPH

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
104 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
123 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
124 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
125 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
126 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
129 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
194 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
195 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
200 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
201 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
202 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.33
Metatranscriptomes 1.33
Isolates 1.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.67
Nodule 0
Rhizoplane 9.67
Rhizosphere 86.67
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10000175 3300013307 Bacteria 71177
2 JGI25406J46586_10023388 3300003203 Bacteria 2442
3 Ga0070670_100022561 3300005331 Bacteria 5416
4 Ga0068869_100034723 3300005334 Bacteria 3569
5 Ga0070680_100029519 3300005336 Bacteria 4405
6 Ga0070680_100057011 3300005336 Bacteria 3193
7 Ga0068868_100038096 3300005338 Bacteria 3731
8 Ga0070660_100017714 3300005339 Bacteria 5194
9 Ga0070661_100010934 3300005344 Bacteria 6323
10 Ga0070668_100008566 3300005347 Bacteria 7597
11 Ga0070659_100252087 3300005366 Bacteria 1463
12 Ga0070714_100000002 3300005435 Bacteria 386673
13 Ga0070713_100038972 3300005436 Bacteria 3854
14 Ga0070713_100130089 3300005436 Bacteria 2219
15 Ga0070701_10005765 3300005438 Bacteria 5153
16 Ga0070711_100011815 3300005439 Bacteria 5433
17 Ga0070711_100012146 3300005439 Bacteria 5374
18 Ga0070700_100000012 3300005441 Bacteria 171410
19 Ga0070700_100006898 3300005441 Bacteria 6099
20 Ga0070663_100012565 3300005455 Bacteria 5362
21 Ga0070663_100220109 3300005455 Bacteria 1490
22 Ga0070678_100001999 3300005456 Bacteria 11014
23 Ga0070681_10056864 3300005458 Bacteria 3892
24 Ga0068867_100021025 3300005459 Bacteria 4654
25 Ga0070685_10044276 3300005466 Bacteria 2547
26 Ga0070698_100171392 3300005471 Bacteria 2111
27 Ga0070679_100020925 3300005530 Bacteria 6382
28 Ga0070684_100112422 3300005535 Bacteria 2443
29 Ga0068853_100018432 3300005539 Bacteria 5776
30 Ga0068853_100375684 3300005539 Bacteria 1326
31 Ga0070672_100031443 3300005543 Bacteria 3995
32 Ga0070693_100018859 3300005547 Bacteria 3609
33 Ga0068856_100522265 3300005614 Bacteria 1208
34 Ga0070702_100001426 3300005615 Bacteria 9764
35 Ga0068852_100147538 3300005616 Bacteria 2184
36 Ga0068861_100024684 3300005719 Bacteria 4350
37 Ga0068870_10004987 3300005840 Bacteria 5761
38 Ga0068863_100039224 3300005841 Bacteria 4507
39 Ga0068858_100017564 3300005842 Bacteria 6709
40 Ga0068860_100163942 3300005843 Bacteria 2144
41 Ga0068862_100051070 3300005844 Bacteria 3536
42 Ga0081538_10002524 3300005981 Bacteria 17830
43 Ga0081538_10083363 3300005981 Bacteria 1690
44 Ga0081540_1007405 3300005983 Bacteria 7829
45 Ga0081539_10000135 3300005985 Bacteria 172789
46 Ga0068871_100112484 3300006358 Bacteria 2291
47 Ga0075428_100084903 3300006844 Bacteria 3453
48 Ga0075433_10018262 3300006852 Bacteria 5825
49 Ga0075433_10304381 3300006852 Bacteria 1411
50 Ga0075434_100334901 3300006871 Bacteria 1534
51 Ga0075429_100052831 3300006880 Bacteria 3534
52 Ga0075429_100100331 3300006880 Bacteria 2526
53 Ga0068865_100131107 3300006881 Bacteria 1878
54 Ga0075436_100007296 3300006914 Bacteria 7557
55 Ga0097620_100108875 3300006931 Bacteria 2832
56 Ga0075435_100007669 3300007076 Bacteria 7707
57 Ga0105240_10040597 3300009093 Bacteria 5949
58 Ga0111539_10229169 3300009094 Bacteria 2163
59 Ga0111539_10319657 3300009094 Bacteria 1806
60 Ga0105245_10017397 3300009098 Bacteria 6271
61 Ga0105245_10019457 3300009098 Bacteria 5948
62 Ga0105245_10108846 3300009098 Bacteria 2574
63 Ga0105245_10113648 3300009098 Bacteria 2521
64 Ga0105245_10295417 3300009098 Bacteria 1588
65 Ga0114129_10002890 3300009147 Bacteria 24043
66 Ga0105243_10017472 3300009148 Bacteria 5423
67 Ga0105241_10008192 3300009174 Bacteria 7694
68 Ga0105248_10027740 3300009177 Bacteria 6306
69 Ga0105237_10279838 3300009545 Bacteria 1671
70 Ga0105238_10008145 3300009551 Bacteria 10483
71 Ga0105249_10472056 3300009553 Bacteria 1296
72 Ga0105246_10009348 3300011119 Bacteria 6040
73 Ga0105246_10030671 3300011119 Bacteria 3552
74 Ga0105246_10095637 3300011119 Bacteria 2151
75 Ga0105246_10105805 3300011119 Bacteria 2057
76 Ga0157371_10005797 3300013102 Bacteria 10339
77 Ga0157370_10015495 3300013104 Bacteria 7751
78 Ga0157369_10123441 3300013105 Bacteria 2747
79 Ga0157369_10125968 3300013105 Bacteria 2716
80 Ga0163162_10240558 3300013306 Bacteria 1941
81 Ga0157372_10020290 3300013307 Bacteria 7168
82 Ga0157372_10092607 3300013307 Bacteria 3438
83 Ga0157372_10167635 3300013307 Bacteria 2540
84 Ga0163163_10133279 3300014325 Bacteria 2525
85 Ga0163163_10156110 3300014325 Bacteria 2326
86 Ga0157377_10004501 3300014745 Bacteria 6429
87 Ga0157377_10024527 3300014745 Bacteria 3206
88 Ga0163161_10161406 3300017792 Bacteria 1709
89 Ga0206353_10576788 3300020082 Bacteria 2191
90 Ga0206353_10602256 3300020082 Bacteria 3132
91 Ga0206353_11131215 3300020082 Bacteria 2421
92 Ga0206353_11758860 3300020082 Bacteria 2726
93 Ga0207692_10041974 3300025898 Bacteria 2268
94 Ga0207688_10007046 3300025901 Bacteria 6112
95 Ga0207647_10009063 3300025904 Bacteria 7085
96 Ga0207643_10004275 3300025908 Bacteria 7685
97 Ga0207643_10004828 3300025908 Bacteria 7217
98 Ga0207695_10139513 3300025913 Bacteria 2374
99 Ga0207671_10055828 3300025914 Bacteria 2926
100 Ga0207663_10029789 3300025916 Bacteria 3211
101 Ga0207657_10021008 3300025919 Bacteria 6155
102 Ga0207652_10038576 3300025921 Bacteria 4051
103 Ga0207687_10009775 3300025927 Bacteria 6276
104 Ga0207687_10010649 3300025927 Bacteria 6007
105 Ga0207700_10174607 3300025928 Bacteria 1795
106 Ga0207664_10000038 3300025929 Bacteria 166264
107 Ga0207704_10077292 3300025938 Bacteria 2136
108 Ga0207691_10015995 3300025940 Bacteria 7126
109 Ga0207689_10005841 3300025942 Bacteria 10914
110 Ga0207661_10184525 3300025944 Bacteria 1825
111 Ga0207679_10027496 3300025945 Bacteria 3934
112 Ga0207667_10058390 3300025949 Bacteria 4047
113 Ga0207667_10345665 3300025949 Bacteria 1517
114 Ga0207640_10125116 3300025981 Bacteria 1849
115 Ga0207703_10024034 3300026035 Bacteria 4795
116 Ga0207678_10014074 3300026067 Bacteria 7034
117 Ga0207708_10000081 3300026075 Bacteria 74669
118 Ga0207708_10000589 3300026075 Bacteria 28085
119 Ga0207708_10030430 3300026075 Bacteria 4092
120 Ga0207702_10008928 3300026078 Bacteria 8453
121 Ga0207702_10045546 3300026078 Bacteria 3689
122 Ga0207648_10013893 3300026089 Bacteria 7467
123 Ga0207676_10155757 3300026095 Bacteria 1973
124 Ga0207674_10066180 3300026116 Bacteria 3641
125 Ga0207674_10081831 3300026116 Bacteria 3231
126 Ga0207674_10111965 3300026116 Bacteria 2703
127 Ga0207675_100039584 3300026118 Bacteria 4400
128 Ga0207675_100217886 3300026118 Bacteria 1838
129 Ga0207675_100286439 3300026118 Bacteria 1602
130 Ga0207683_10009939 3300026121 Bacteria 8116
131 Ga0207428_10011305 3300027907 Bacteria 7904
132 Ga0268265_10133320 3300028380 Bacteria 2068
133 Ga0268264_10249035 3300028381 Bacteria 1649
134 Ga0307511_10000303 3300030521 Bacteria 52216
135 Ga0307512_10070485 3300030522 Bacteria 2603
136 Ga0265340_10011828 3300031247 Bacteria 4625
137 Ga0265340_10036506 3300031247 Unclassified 2435
138 Ga0265313_10041951 3300031595 Bacteria 2251
139 Ga0307508_10101226 3300031616 Bacteria 2477
140 Ga0265342_10091357 3300031712 Bacteria 1745
141 Ga0307405_10001350 3300031731 Bacteria 10295
142 Ga0307405_10007281 3300031731 Bacteria 5518
143 Ga0307405_10161508 3300031731 Bacteria 1588
144 Ga0307410_10011951 3300031852 Bacteria 4992
145 Ga0307410_10342954 3300031852 Bacteria 1191
146 Ga0307406_10031117 3300031901 Bacteria 3247
147 Ga0307407_10019113 3300031903 Bacteria 3482
148 Ga0307412_10025591 3300031911 Bacteria 3656
149 Ga0307409_100008287 3300031995 Bacteria 6296
150 Ga0307409_100059070 3300031995 Bacteria 2982
151 Ga0307409_100169537 3300031995 Bacteria 1920
152 Ga0307416_100000234 3300032002 Bacteria 29531
153 Ga0307416_100150645 3300032002 Bacteria 2132
154 Ga0307416_100484172 3300032002 Bacteria 1298
155 Ga0307411_10025741 3300032005 Bacteria 3531
156 Ga0307411_10102871 3300032005 Bacteria 2025
157 Ga0307415_100000307 3300032126 Bacteria 21167
158 Ga0307415_100035555 3300032126 Bacteria 3254
159 Ga0307415_100048829 3300032126 Bacteria 2857
160 Ga0307415_100060055 3300032126 Bacteria 2625
161 Ga0307415_100260471 3300032126 Bacteria 1415
162 Ga0373951_0000105 3300035091 Bacteria 32574
163 Ga0373933_0070673 3300035724 Bacteria 2124
164 Ga0395899_0076128 3300037312 Bacteria 2450
165 Ga0395899_0107231 3300037312 Bacteria 2011
166 Ga0395900_0169448 3300037418 Bacteria 2224
167 Ga0395900_0357156 3300037418 Bacteria 1433
168 Ga0395898_0058553 3300037466 Bacteria 3750
169 Ga0395905_0108470 3300037471 Bacteria 2606
170 Ga0395901_0181981 3300038443 Bacteria 2204
171 Ga0451787_631787 3300041441 Bacteria 1886
172 Ga0451791_0747670 3300041451 Bacteria 7745
173 Ga0451793_1236031 3300041452 Bacteria 5222
174 Ga0451797_0547002 3300041453 Bacteria 2371
175 Ga0451802_2019758 3300041460 Bacteria 2527
176 Ga0451837_1810344 3300041494 Bacteria 1331
177 Ga0451843_0066275 3300041509 Bacteria 1832
178 Ga0451843_0583555 3300041509 Bacteria 1705
179 Ga0451853_0798471 3300041512 Bacteria 5566
180 Ga0439464_0016167 3300042439 Bacteria 2017
181 Ga0466965_0053682 3300044683 Bacteria 2003
182 Ga0466961_0011412 3300044693 Bacteria 5683
183 Ga0466961_0041896 3300044693 Bacteria 2935
184 Ga0466961_0105147 3300044693 Bacteria 1777
185 Ga0466963_0003836 3300044694 Bacteria 8671
186 Ga0466964_0000567 3300044706 Bacteria 11606
187 Ga0466971_0031319 3300044719 Bacteria 2381
188 Ga0466971_0062644 3300044719 Bacteria 1683
189 Ga0466970_0071734 3300044765 Bacteria 1863
190 Ga0466970_0089127 3300044765 Bacteria 1673
191 Ga0466957_0020783 3300044842 Bacteria 3862
192 Ga0466960_0022235 3300044901 Bacteria 2833
193 Ga0466959_0024443 3300045049 Bacteria 4476
194 Ga0466959_0052905 3300045049 Bacteria 2972
195 Ga0466958_0028374 3300045836 Bacteria 3318
196 Ga0466958_0046034 3300045836 Bacteria 2632
197 Ga0466958_0114893 3300045836 Bacteria 1682
198 Ga0466967_0081593 3300045976 Bacteria 2921
199 Ga0466967_0098365 3300045976 Bacteria 2671
200 Ga0466967_0177330 3300045976 Bacteria 2008
201 Ga0466967_0218183 3300045976 Bacteria 1811
202 Ga0466967_0362672 3300045976 Bacteria 1404
203 Ga0495584_0051194 3300046491 Bacteria 2080
204 Ga0495585_0047382 3300046492 Bacteria 2394
205 Ga0495640_0129114 3300046533 Bacteria 1637
206 Ga0495624_0102380 3300046690 Bacteria 1763
207 Ga0496101_0024492 3300048904 Bacteria 4178
208 Ga0496104_0022349 3300048907 Bacteria 5809
209 Ga0496104_0039535 3300048907 Bacteria 4416
210 Ga0496105_0077815 3300048908 Bacteria 2739
211 Ga0496106_0333902 3300048909 Bacteria 1217
212 Ga0496107_0042667 3300048910 Bacteria 3258
213 Ga0496108_0000627 3300048911 Bacteria 27597
214 Ga0496108_0058353 3300048911 Bacteria 3244
215 Ga0496108_0137356 3300048911 Bacteria 2105
216 Ga0496108_0145724 3300048911 Bacteria 2041
217 Ga0496109_0024505 3300048912 Bacteria 5365
218 Ga0496109_0362775 3300048912 Bacteria 1369
219 Ga0496110_0006065 3300048913 Bacteria 9528
220 Ga0496110_0058541 3300048913 Bacteria 3393
221 Ga0496110_0120781 3300048913 Bacteria 2360
222 Ga0496111_0000306 3300048914 Bacteria 24086
223 Ga0496111_0013365 3300048914 Bacteria 5584
224 Ga0496112_0203067 3300048915 Bacteria 1941
225 Ga0496113_0006730 3300048916 Bacteria 7323
226 Ga0496114_0027025 3300048917 Bacteria 4701
227 Ga0496114_0095083 3300048917 Bacteria 2535
228 Ga0496114_0124766 3300048917 Bacteria 2218
229 Ga0496114_0208952 3300048917 Bacteria 1711
230 Ga0496115_0481901 3300048918 Bacteria 999
231 Ga0501031_0000360 3300049568 Bacteria 26525
232 Ga0501032_0069373 3300049569 Bacteria 2352
233 Ga0501033_0026445 3300049570 Bacteria 4367
234 Ga0501036_0002537 3300049572 Bacteria 14351
235 Ga0501037_0006398 3300049573 Bacteria 8619
236 Ga0501037_0048846 3300049573 Bacteria 3099
237 Ga0501038_0017516 3300049574 Bacteria 6475
238 Ga0501039_0000197 3300049575 Bacteria 43481
239 Ga0501039_0031053 3300049575 Bacteria 4118
240 Ga0501040_0000209 3300049576 Bacteria 34062
241 Ga0501041_0004382 3300049577 Bacteria 8165
242 Ga0501041_0028130 3300049577 Bacteria 3390
243 Ga0501042_0000908 3300049578 Bacteria 16559
244 Ga0501043_0176047 3300049579 Bacteria 1668
245 Ga0501043_0263280 3300049579 Bacteria 1325
246 Ga0501046_0003548 3300049580 Bacteria 14289
247 Ga0501046_0112896 3300049580 Bacteria 2074
248 Ga0501048_0000199 3300049582 Bacteria 39152
249 Ga0501048_0032747 3300049582 Bacteria 3756
250 Ga0501068_0036181 3300049584 Bacteria 2951
251 Ga0501071_0001636 3300049587 Bacteria 13155
252 Ga0501071_0007731 3300049587 Bacteria 7087
253 Ga0501072_0008807 3300049588 Bacteria 7663
254 Ga0501072_0027700 3300049588 Bacteria 4420
255 Ga0501072_0128078 3300049588 Bacteria 2023
256 Ga0501073_0046486 3300049589 Bacteria 3053
257 Ga0501074_0011186 3300049590 Bacteria 6518
258 Ga0501074_0077868 3300049590 Bacteria 2380
259 Ga0501075_0002053 3300049591 Bacteria 13328
260 Ga0501075_0026957 3300049591 Bacteria 4233
261 Ga0501076_0010789 3300049592 Bacteria 6792
262 Ga0501076_0034137 3300049592 Bacteria 3974
263 Ga0501076_0123845 3300049592 Bacteria 2094
264 Ga0501077_0002344 3300049593 Bacteria 11409
265 Ga0501079_0007590 3300049741 Bacteria 8216
266 Ga0501080_0012770 3300049742 Bacteria 7705
267 Ga0501081_0001415 3300049743 Bacteria 14670
268 Ga0501081_0055146 3300049743 Bacteria 2746
269 Ga0501035_0009161 3300049822 Bacteria 9206
270 Ga0501044_0105536 3300049823 Bacteria 2830
271 Ga0501044_0134275 3300049823 Bacteria 2467
272 Ga0501045_0005800 3300049824 Bacteria 8545
273 Ga0501045_0013115 3300049824 Bacteria 5846
274 nmdc:mga05p37_21100_c1 3300050507 Bacteria 7885
275 nmdc:mga05p37_4652_c1 3300050507 Bacteria 16045
276 nmdc:mga09592_231509_c1 3300050508 Bacteria 1601
277 nmdc:mga06r32_379077_c1 3300050510 Bacteria 1397
278 nmdc:mga08y16_204997_c1 3300050511 Bacteria 2043
279 nmdc:mga08y16_22002_c1 3300050511 Bacteria 6732
280 nmdc:mga0n895_164641_c1 3300050512 Bacteria 2249
281 nmdc:mga08x19_15627_c1 3300050514 Bacteria 4619
282 nmdc:mga0a205_21001_c1 3300050515 Bacteria 6171
283 nmdc:mga0a205_44839_c2 3300050515 Bacteria 3654
284 Ga0495601_0045114 3300053077 Bacteria 2771
285 Ga0495619_0056094 3300053085 Bacteria 2611
286 Ga0495619_0058641 3300053085 Bacteria 2556
287 Ga0500646_0000498 3300053090 Bacteria 11486
288 Ga0500573_0000173 3300053140 Bacteria 26169
289 Ga0501084_0000576 3300054114 Bacteria 28065
290 Ga0501084_0024409 3300054114 Bacteria 5043
291 Ga0501084_0374951 3300054114 Bacteria 1202
292 Ga0501082_0005442 3300060353 Bacteria 11054
293 Ga0501082_0129622 3300060353 Bacteria 2188
294 Ga0466962_0018841 3300061719 Bacteria 3317
295 Ga0530510_0005328 3300061734 Bacteria 8891
296 Ga0530510_0059291 3300061734 Bacteria 2768
297 2867320554 2867319477 Bacteria 7069771
298 2887480068 2887478801 Bacteria 8972725
299 2996223573 2996221748 Bacteria 6799777
300 8001787741 8001781756 Bacteria 9586736
301 Ga0157372_10000175
302 JGI25406J46586_10023388
303 Ga0070670_100022561
304 Ga0068869_100034723
305 Ga0070680_100029519
306 Ga0070680_100057011
307 Ga0068868_100038096
308 Ga0070660_100017714
309 Ga0070661_100010934
310 Ga0070668_100008566
311 Ga0070659_100252087
312 Ga0070714_100000002
313 Ga0070713_100038972
314 Ga0070713_100130089
315 Ga0070701_10005765
316 Ga0070711_100011815
317 Ga0070711_100012146
318 Ga0070700_100000012
319 Ga0070700_100006898
320 Ga0070663_100012565
321 Ga0070663_100220109
322 Ga0070678_100001999
323 Ga0070681_10056864
324 Ga0068867_100021025
325 Ga0070685_10044276
326 Ga0070698_100171392
327 Ga0070679_100020925
328 Ga0070684_100112422
329 Ga0068853_100018432
330 Ga0068853_100375684
331 Ga0070672_100031443
332 Ga0070693_100018859
333 Ga0068856_100522265
334 Ga0070702_100001426
335 Ga0068852_100147538
336 Ga0068861_100024684
337 Ga0068870_10004987
338 Ga0068863_100039224
339 Ga0068858_100017564
340 Ga0068860_100163942
341 Ga0068862_100051070
342 Ga0081538_10002524
343 Ga0081538_10083363
344 Ga0081540_1007405
345 Ga0081539_10000135
346 Ga0068871_100112484
347 Ga0075428_100084903
348 Ga0075433_10018262
349 Ga0075433_10304381
350 Ga0075434_100334901
351 Ga0075429_100052831
352 Ga0075429_100100331
353 Ga0068865_100131107
354 Ga0075436_100007296
355 Ga0097620_100108875
356 Ga0075435_100007669
357 Ga0105240_10040597
358 Ga0111539_10229169
359 Ga0111539_10319657
360 Ga0105245_10017397
361 Ga0105245_10019457
362 Ga0105245_10108846
363 Ga0105245_10113648
364 Ga0105245_10295417
365 Ga0114129_10002890
366 Ga0105243_10017472
367 Ga0105241_10008192
368 Ga0105248_10027740
369 Ga0105237_10279838
370 Ga0105238_10008145
371 Ga0105249_10472056
372 Ga0105246_10009348
373 Ga0105246_10030671
374 Ga0105246_10095637
375 Ga0105246_10105805
376 Ga0157371_10005797
377 Ga0157370_10015495
378 Ga0157369_10123441
379 Ga0157369_10125968
380 Ga0163162_10240558
381 Ga0157372_10020290
382 Ga0157372_10092607
383 Ga0157372_10167635
384 Ga0163163_10133279
385 Ga0163163_10156110
386 Ga0157377_10004501
387 Ga0157377_10024527
388 Ga0163161_10161406
389 Ga0206353_10576788
390 Ga0206353_10602256
391 Ga0206353_11131215
392 Ga0206353_11758860
393 Ga0207692_10041974
394 Ga0207688_10007046
395 Ga0207647_10009063
396 Ga0207643_10004275
397 Ga0207643_10004828
398 Ga0207695_10139513
399 Ga0207671_10055828
400 Ga0207663_10029789
401 Ga0207657_10021008
402 Ga0207652_10038576
403 Ga0207687_10009775
404 Ga0207687_10010649
405 Ga0207700_10174607
406 Ga0207664_10000038
407 Ga0207704_10077292
408 Ga0207691_10015995
409 Ga0207689_10005841
410 Ga0207661_10184525
411 Ga0207679_10027496
412 Ga0207667_10058390
413 Ga0207667_10345665
414 Ga0207640_10125116
415 Ga0207703_10024034
416 Ga0207678_10014074
417 Ga0207708_10000081
418 Ga0207708_10000589
419 Ga0207708_10030430
420 Ga0207702_10008928
421 Ga0207702_10045546
422 Ga0207648_10013893
423 Ga0207676_10155757
424 Ga0207674_10066180
425 Ga0207674_10081831
426 Ga0207674_10111965
427 Ga0207675_100039584
428 Ga0207675_100217886
429 Ga0207675_100286439
430 Ga0207683_10009939
431 Ga0207428_10011305
432 Ga0268265_10133320
433 Ga0268264_10249035
434 Ga0307511_10000303
435 Ga0307512_10070485
436 Ga0265340_10011828
437 Ga0265340_10036506
438 Ga0265313_10041951
439 Ga0307508_10101226
440 Ga0265342_10091357
441 Ga0307405_10001350
442 Ga0307405_10007281
443 Ga0307405_10161508
444 Ga0307410_10011951
445 Ga0307410_10342954
446 Ga0307406_10031117
447 Ga0307407_10019113
448 Ga0307412_10025591
449 Ga0307409_100008287
450 Ga0307409_100059070
451 Ga0307409_100169537
452 Ga0307416_100000234
453 Ga0307416_100150645
454 Ga0307416_100484172
455 Ga0307411_10025741
456 Ga0307411_10102871
457 Ga0307415_100000307
458 Ga0307415_100035555
459 Ga0307415_100048829
460 Ga0307415_100060055
461 Ga0307415_100260471
462 Ga0373951_0000105
463 Ga0373933_0070673
464 Ga0395899_0076128
465 Ga0395899_0107231
466 Ga0395900_0169448
467 Ga0395900_0357156
468 Ga0395898_0058553
469 Ga0395905_0108470
470 Ga0395901_0181981
471 Ga0451787_631787
472 Ga0451791_0747670
473 Ga0451793_1236031
474 Ga0451797_0547002
475 Ga0451802_2019758
476 Ga0451837_1810344
477 Ga0451843_0066275
478 Ga0451843_0583555
479 Ga0451853_0798471
480 Ga0439464_0016167
481 Ga0466965_0053682
482 Ga0466961_0011412
483 Ga0466961_0041896
484 Ga0466961_0105147
485 Ga0466963_0003836
486 Ga0466964_0000567
487 Ga0466971_0031319
488 Ga0466971_0062644
489 Ga0466970_0071734
490 Ga0466970_0089127
491 Ga0466957_0020783
492 Ga0466960_0022235
493 Ga0466959_0024443
494 Ga0466959_0052905
495 Ga0466958_0028374
496 Ga0466958_0046034
497 Ga0466958_0114893
498 Ga0466967_0081593
499 Ga0466967_0098365
500 Ga0466967_0177330
501 Ga0466967_0218183
502 Ga0466967_0362672
503 Ga0495584_0051194
504 Ga0495585_0047382
505 Ga0495640_0129114
506 Ga0495624_0102380
507 Ga0496101_0024492
508 Ga0496104_0022349
509 Ga0496104_0039535
510 Ga0496105_0077815
511 Ga0496106_0333902
512 Ga0496107_0042667
513 Ga0496108_0000627
514 Ga0496108_0058353
515 Ga0496108_0137356
516 Ga0496108_0145724
517 Ga0496109_0024505
518 Ga0496109_0362775
519 Ga0496110_0006065
520 Ga0496110_0058541
521 Ga0496110_0120781
522 Ga0496111_0000306
523 Ga0496111_0013365
524 Ga0496112_0203067
525 Ga0496113_0006730
526 Ga0496114_0027025
527 Ga0496114_0095083
528 Ga0496114_0124766
529 Ga0496114_0208952
530 Ga0496115_0481901
531 Ga0501031_0000360
532 Ga0501032_0069373
533 Ga0501033_0026445
534 Ga0501036_0002537
535 Ga0501037_0006398
536 Ga0501037_0048846
537 Ga0501038_0017516
538 Ga0501039_0000197
539 Ga0501039_0031053
540 Ga0501040_0000209
541 Ga0501041_0004382
542 Ga0501041_0028130
543 Ga0501042_0000908
544 Ga0501043_0176047
545 Ga0501043_0263280
546 Ga0501046_0003548
547 Ga0501046_0112896
548 Ga0501048_0000199
549 Ga0501048_0032747
550 Ga0501068_0036181
551 Ga0501071_0001636
552 Ga0501071_0007731
553 Ga0501072_0008807
554 Ga0501072_0027700
555 Ga0501072_0128078
556 Ga0501073_0046486
557 Ga0501074_0011186
558 Ga0501074_0077868
559 Ga0501075_0002053
560 Ga0501075_0026957
561 Ga0501076_0010789
562 Ga0501076_0034137
563 Ga0501076_0123845
564 Ga0501077_0002344
565 Ga0501079_0007590
566 Ga0501080_0012770
567 Ga0501081_0001415
568 Ga0501081_0055146
569 Ga0501035_0009161
570 Ga0501044_0105536
571 Ga0501044_0134275
572 Ga0501045_0005800
573 Ga0501045_0013115
574 nmdc:mga05p37_21100_c1
575 nmdc:mga05p37_4652_c1
576 nmdc:mga09592_231509_c1
577 nmdc:mga06r32_379077_c1
578 nmdc:mga08y16_204997_c1
579 nmdc:mga08y16_22002_c1
580 nmdc:mga0n895_164641_c1
581 nmdc:mga08x19_15627_c1
582 nmdc:mga0a205_21001_c1
583 nmdc:mga0a205_44839_c2
584 Ga0495601_0045114
585 Ga0495619_0056094
586 Ga0495619_0058641
587 Ga0500646_0000498
588 Ga0500573_0000173
589 Ga0501084_0000576
590 Ga0501084_0024409
591 Ga0501084_0374951
592 Ga0501082_0005442
593 Ga0501082_0129622
594 Ga0466962_0018841
595 Ga0530510_0005328
596 Ga0530510_0059291
597 2867320554
598 2887480068
599 2996223573
600 8001787741

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06224

AlkZ-like

DNA glycosylase AlkZ-like

51

376

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v2w-assembly1.cif.gz_H protomer structure from the dimer of yeast tho complex 0.8012 303 338
6woo-assembly1.cif.gz_ZZ cryoem structure of yeast 80s ribosome with met-trnaimet, eif5b, and gdp 0.7473 161 190
7qyi-assembly1.cif.gz_A solution structure of the dna-binding minor pilin fimt from legionella pneumophila 0.7372 305 338
6o8h-assembly1.cif.gz_A crystal structure of uvrb mutant bound to duplex dna 0.7148 301 338
6vx4-assembly1.cif.gz_G density-fitted model structure of antibody variable domains of tytx11 in complex with typhoid toxin 0.7006 315 340
ID Description Score Start End Superfamily
af_Q5VSA6_146_382_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8158 304 338 2.130.10.10
af_Q2FWC9_161_285_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7904 304 339 3.40.630.30
af_Q93WD7_104_336_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7582 304 343 2.130.10.10
af_Q54HV6_481_605_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7549 317 339 2.40.50.140
2vzyB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.7544 305 325 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A444BQ88-F1-model_v4 deleted 0.9514 4 210
AF-A0A6J7JI04-F1-model_v4 Unannotated protein 0.9496 4 298
AF-A0A0Q7Z4D2-F1-model_v4 Winged helix-turn-helix domain-containing protein 0.9368 4 348
AF-A0A444BQ88-F1-model_v4 deleted 0.934 4 210
AF-A0A7W1GNG6-F1-model_v4 Winged helix-turn-helix domain-containing protein 0.9304 4 348

Map