F395335

General Info

Members Datasets Scaffolds Average Seq Length
300 140 600 279

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10000975|Ga0114129_1000097515
Length 292
Sequence LTKRRQEKEEKMATVLSTEKTSESYPAPAWPLVLAFGFTLLFAGLLTSVSVSALGAVLAIAGCVGWFREVFPREHEETVPLVAQELQIVTSRRVVERVPVSEDQVRAWLPVHTYPLSAGVKGGLAGSVAMAVLACGYGLLKAGSIWYPINLLAAVVYAQSVRLGPEQLNSFHADSFAIALALHAFVSTLVGLLYGAMIPMLARRPIVLGGLIAPPLWSGLLYSFLGLLNPLLASRIDWFWFTASQVAFGIVAGIVVVRQSPIPTRENLSFALRAGIEAPGLIPPRERGEKVS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
130 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.67
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 13.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10000975 3300009147 Bacteria 37455
2 JGI25406J46586_10013201 3300003203 Bacteria 3559
3 Ga0065715_10002261 3300005293 Bacteria 8278
4 Ga0065715_10092729 3300005293 Bacteria 4967
5 Ga0070676_10001459 3300005328 Bacteria 11954
6 Ga0070690_100004466 3300005330 Bacteria 7770
7 Ga0068869_100002719 3300005334 Bacteria 10706
8 Ga0070666_10002341 3300005335 Bacteria 11446
9 Ga0070660_100190948 3300005339 Bacteria 1659
10 Ga0070689_100010795 3300005340 Bacteria 6526
11 Ga0070687_100034112 3300005343 Bacteria 2517
12 Ga0070669_100005974 3300005353 Bacteria 8783
13 Ga0070669_100564501 3300005353 Bacteria 950
14 Ga0070675_100128822 3300005354 Bacteria 2155
15 Ga0070671_100000183 3300005355 Bacteria 41872
16 Ga0070673_100001552 3300005364 Bacteria 13528
17 Ga0070688_100003562 3300005365 Bacteria 8024
18 Ga0070659_100250428 3300005366 Bacteria 1468
19 Ga0070667_100049228 3300005367 Bacteria 3549
20 Ga0070667_100203175 3300005367 Bacteria 1759
21 Ga0070703_10033213 3300005406 Unclassified 1570
22 Ga0070703_10113927 3300005406 Unclassified 971
23 Ga0070709_10030063 3300005434 Unclassified 3256
24 Ga0070711_100016472 3300005439 Bacteria 4696
25 Ga0070705_100109142 3300005440 Bacteria 1764
26 Ga0070700_100045028 3300005441 Bacteria 2720
27 Ga0070694_100093226 3300005444 Bacteria 2117
28 Ga0070694_100119293 3300005444 Bacteria 1891
29 Ga0070694_100489624 3300005444 Unclassified 977
30 Ga0070708_100089499 3300005445 Bacteria 2800
31 Ga0070708_100163101 3300005445 Bacteria 2078
32 Ga0070678_100046299 3300005456 Unclassified 3118
33 Ga0070662_100004947 3300005457 Bacteria 8466
34 Ga0070662_100334255 3300005457 Bacteria 1238
35 Ga0068867_100115693 3300005459 Bacteria 2066
36 Ga0070685_10004317 3300005466 Bacteria 7174
37 Ga0070706_100001262 3300005467 Bacteria 27056
38 Ga0070706_100087829 3300005467 Bacteria 2883
39 Ga0070706_100452801 3300005467 Unclassified 1194
40 Ga0070707_100006919 3300005468 Bacteria 10509
41 Ga0070707_100008020 3300005468 Bacteria 9811
42 Ga0070707_100105315 3300005468 Bacteria 2735
43 Ga0070707_100304428 3300005468 Bacteria 1549
44 Ga0070707_100319160 3300005468 Bacteria 1510
45 Ga0070707_100351767 3300005468 Bacteria 1431
46 Ga0070698_100015094 3300005471 Bacteria 8166
47 Ga0070698_100072604 3300005471 Bacteria 3449
48 Ga0070698_100297117 3300005471 Unclassified 1546
49 Ga0070699_100260605 3300005518 Bacteria 1551
50 Ga0070699_100405856 3300005518 Bacteria 1232
51 Ga0070699_100555110 3300005518 Bacteria 1046
52 Ga0070697_100000830 3300005536 Bacteria 23180
53 Ga0070697_100044071 3300005536 Bacteria 3613
54 Ga0070697_100052904 3300005536 Unclassified 3300
55 Ga0070697_100090808 3300005536 Bacteria 2524
56 Ga0070697_100231594 3300005536 Unclassified 1576
57 Ga0070672_100016430 3300005543 Bacteria 5300
58 Ga0070672_100456072 3300005543 Bacteria 1102
59 Ga0070686_100003370 3300005544 Bacteria 8754
60 Ga0070686_100018073 3300005544 Bacteria 4132
61 Ga0070695_100173997 3300005545 Bacteria 1521
62 Ga0070696_100023179 3300005546 Bacteria 4219
63 Ga0070696_100072917 3300005546 Bacteria 2418
64 Ga0070696_100085515 3300005546 Bacteria 2239
65 Ga0070696_100293537 3300005546 Bacteria 1243
66 Ga0070704_100020891 3300005549 Bacteria 4233
67 Ga0070704_100091941 3300005549 Bacteria 2264
68 Ga0070664_100002107 3300005564 Bacteria 15905
69 Ga0068866_10073598 3300005718 Bacteria 1813
70 Ga0068861_100045682 3300005719 Bacteria 3299
71 Ga0068861_100151342 3300005719 Unclassified 1904
72 Ga0068870_10012781 3300005840 Unclassified 3931
73 Ga0068863_100001352 3300005841 Bacteria 24403
74 Ga0068863_100002174 3300005841 Bacteria 19429
75 Ga0068858_100153542 3300005842 Bacteria 2166
76 Ga0068860_100081881 3300005843 Bacteria 3069
77 Ga0068860_100315182 3300005843 Bacteria 1534
78 Ga0068862_100023627 3300005844 Bacteria 5153
79 Ga0068862_100164413 3300005844 Bacteria 1983
80 Ga0081539_10002905 3300005985 Bacteria 22664
81 Ga0070717_10518815 3300006028 Unclassified 1078
82 Ga0070715_10090912 3300006163 Bacteria 1404
83 Ga0070716_100057058 3300006173 Bacteria 2242
84 Ga0070716_100274318 3300006173 Bacteria 1160
85 Ga0070712_100087478 3300006175 Bacteria 2273
86 Ga0075428_100005071 3300006844 Bacteria 14641
87 Ga0075428_100102646 3300006844 Bacteria 3118
88 Ga0075428_100227576 3300006844 Bacteria 2013
89 Ga0075428_100581433 3300006844 Bacteria 1197
90 Ga0075430_100016294 3300006846 Bacteria 6330
91 Ga0075430_100042394 3300006846 Bacteria 3848
92 Ga0075430_100112342 3300006846 Bacteria 2271
93 Ga0075430_100320746 3300006846 Bacteria 1281
94 Ga0075431_100001350 3300006847 Bacteria 22456
95 Ga0075431_100072036 3300006847 Bacteria 3566
96 Ga0075431_100078526 3300006847 Bacteria 3407
97 Ga0075433_10008642 3300006852 Bacteria 8126
98 Ga0075433_10012715 3300006852 Bacteria 6811
99 Ga0075433_10052180 3300006852 Bacteria 3563
100 Ga0075433_10065032 3300006852 Bacteria 3198
101 Ga0075433_10094883 3300006852 Bacteria 2640
102 Ga0075433_10154495 3300006852 Bacteria 2042
103 Ga0075433_10189487 3300006852 Bacteria 1830
104 Ga0075433_10198177 3300006852 Bacteria 1786
105 Ga0075433_10273230 3300006852 Bacteria 1498
106 Ga0075434_100005024 3300006871 Bacteria 12007
107 Ga0075434_100088341 3300006871 Bacteria 3100
108 Ga0075434_100142197 3300006871 Bacteria 2419
109 Ga0075434_100217053 3300006871 Bacteria 1933
110 Ga0075434_100224254 3300006871 Bacteria 1899
111 Ga0075434_100370844 3300006871 Bacteria 1452
112 Ga0075434_100390955 3300006871 Unclassified 1412
113 Ga0075434_100430482 3300006871 Bacteria 1340
114 Ga0075429_100016159 3300006880 Bacteria 6467
115 Ga0075429_100030188 3300006880 Bacteria 4709
116 Ga0075429_100030490 3300006880 Bacteria 4685
117 Ga0075429_100154603 3300006880 Unclassified 2008
118 Ga0075429_100231575 3300006880 Bacteria 1618
119 Ga0075436_100089604 3300006914 Bacteria 2138
120 Ga0075436_100130733 3300006914 Bacteria 1760
121 Ga0075436_100205875 3300006914 Unclassified 1394
122 Ga0075436_100323155 3300006914 Unclassified 1109
123 Ga0075435_100000564 3300007076 Bacteria 22781
124 Ga0075435_100029165 3300007076 Bacteria 4329
125 Ga0075435_100042224 3300007076 Bacteria 3648
126 Ga0075435_100062328 3300007076 Bacteria 3026
127 Ga0075435_100291521 3300007076 Bacteria 1394
128 Ga0099794_10126630 3300007265 Unclassified 1288
129 Ga0099795_10063393 3300007788 Bacteria 1377
130 Ga0111539_10013802 3300009094 Bacteria 10095
131 Ga0111539_10016201 3300009094 Bacteria 9249
132 Ga0111539_10075849 3300009094 Bacteria 3960
133 Ga0111539_10410278 3300009094 Bacteria 1578
134 Ga0111539_10490019 3300009094 Bacteria 1432
135 Ga0105245_10023545 3300009098 Bacteria 5406
136 Ga0105245_10072273 3300009098 Unclassified 3133
137 Ga0114129_10018197 3300009147 Bacteria 10003
138 Ga0114129_10029056 3300009147 Bacteria 7831
139 Ga0114129_10033895 3300009147 Bacteria 7213
140 Ga0114129_10075338 3300009147 Bacteria 4699
141 Ga0114129_10172328 3300009147 Bacteria 2949
142 Ga0114129_10173336 3300009147 Bacteria 2939
143 Ga0114129_10280266 3300009147 Bacteria 2227
144 Ga0114129_10301068 3300009147 Bacteria 2137
145 Ga0114129_11146533 3300009147 Unclassified 971
146 Ga0114129_11156290 3300009147 Bacteria 966
147 Ga0105241_10043904 3300009174 Bacteria 3386
148 Ga0105242_10007086 3300009176 Bacteria 8660
149 Ga0105237_10304258 3300009545 Bacteria 1597
150 Ga0105249_10185127 3300009553 Bacteria 2029
151 Ga0099796_10004371 3300010159 Bacteria 3411
152 Ga0105239_10061793 3300010375 Bacteria 4111
153 Ga0105239_10133947 3300010375 Bacteria 2758
154 Ga0105246_10279797 3300011119 Bacteria 1338
155 Ga0157378_10013122 3300013297 Bacteria 7250
156 Ga0157378_10042976 3300013297 Bacteria 4012
157 Ga0157378_10056056 3300013297 Bacteria 3511
158 Ga0157378_10070438 3300013297 Unclassified 3140
159 Ga0157378_10321296 3300013297 Bacteria 1504
160 Ga0163162_10045408 3300013306 Bacteria 4401
161 Ga0157375_10009845 3300013308 Bacteria 8406
162 Ga0157375_10144900 3300013308 Bacteria 2505
163 Ga0157375_10423655 3300013308 Bacteria 1497
164 Ga0157375_10597814 3300013308 Bacteria 1263
165 Ga0157380_10005867 3300014326 Bacteria 8592
166 Ga0157377_10005867 3300014745 Bacteria 5810
167 Ga0157379_10021691 3300014968 Bacteria 5688
168 Ga0157379_10083863 3300014968 Bacteria 2856
169 Ga0207697_10015115 3300025315 Bacteria 3192
170 Ga0207653_10010072 3300025885 Bacteria 2949
171 Ga0207692_10066389 3300025898 Bacteria 1886
172 Ga0207680_10003972 3300025903 Bacteria 6983
173 Ga0207685_10003434 3300025905 Unclassified 3852
174 Ga0207699_10244524 3300025906 Unclassified 1234
175 Ga0207645_10000887 3300025907 Bacteria 24833
176 Ga0207643_10019400 3300025908 Bacteria 3725
177 Ga0207684_10002037 3300025910 Bacteria 20810
178 Ga0207684_10164950 3300025910 Unclassified 1908
179 Ga0207684_10185731 3300025910 Bacteria 1793
180 Ga0207654_10150658 3300025911 Bacteria 1493
181 Ga0207671_10179314 3300025914 Bacteria 1648
182 Ga0207693_10009201 3300025915 Bacteria 8065
183 Ga0207693_10069876 3300025915 Unclassified 2748
184 Ga0207693_10138451 3300025915 Unclassified 1914
185 Ga0207663_10008568 3300025916 Bacteria 5358
186 Ga0207663_10033078 3300025916 Bacteria 3077
187 Ga0207660_10260517 3300025917 Bacteria 1371
188 Ga0207662_10046935 3300025918 Bacteria 2557
189 Ga0207646_10001135 3300025922 Bacteria 33987
190 Ga0207646_10050103 3300025922 Bacteria 3737
191 Ga0207646_10050964 3300025922 Bacteria 3704
192 Ga0207646_10098578 3300025922 Bacteria 2619
193 Ga0207646_10296994 3300025922 Bacteria 1459
194 Ga0207646_10349701 3300025922 Unclassified 1336
195 Ga0207646_10515616 3300025922 Unclassified 1076
196 Ga0207681_10064006 3300025923 Bacteria 2538
197 Ga0207681_10410719 3300025923 Bacteria 1095
198 Ga0207681_10479452 3300025923 Bacteria 1016
199 Ga0207659_10003351 3300025926 Bacteria 9610
200 Ga0207659_10241173 3300025926 Bacteria 1462
201 Ga0207687_10037598 3300025927 Bacteria 3304
202 Ga0207687_10117417 3300025927 Bacteria 1984
203 Ga0207644_10000120 3300025931 Bacteria 57828
204 Ga0207644_10118462 3300025931 Bacteria 2012
205 Ga0207706_10004453 3300025933 Bacteria 13164
206 Ga0207706_10308957 3300025933 Bacteria 1377
207 Ga0207686_10059202 3300025934 Unclassified 2419
208 Ga0207670_10230242 3300025936 Archaea 1423
209 Ga0207704_10101192 3300025938 Bacteria 1921
210 Ga0207665_10009327 3300025939 Bacteria 6440
211 Ga0207691_10000809 3300025940 Bacteria 31148
212 Ga0207711_10230802 3300025941 Bacteria 1695
213 Ga0207689_10004818 3300025942 Bacteria 12167
214 Ga0207689_10037810 3300025942 Bacteria 4000
215 Ga0207689_10108872 3300025942 Bacteria 2277
216 Ga0207679_10004099 3300025945 Bacteria 9041
217 Ga0207651_10001229 3300025960 Bacteria 11500
218 Ga0207651_10399394 3300025960 Bacteria 1169
219 Ga0207712_10084143 3300025961 Bacteria 2324
220 Ga0207712_10445557 3300025961 Bacteria 1097
221 Ga0207658_10086817 3300025986 Bacteria 2414
222 Ga0207708_10063875 3300026075 Bacteria 2813
223 Ga0207702_10694772 3300026078 Unclassified 1002
224 Ga0207641_10001341 3300026088 Bacteria 24380
225 Ga0207641_10005166 3300026088 Bacteria 11161
226 Ga0207641_10169856 3300026088 Unclassified 1989
227 Ga0207648_10239725 3300026089 Bacteria 1614
228 Ga0207675_100031777 3300026118 Bacteria 4918
229 Ga0207683_10066892 3300026121 Unclassified 3169
230 Ga0209588_1002429 3300027671 Bacteria 5049
231 Ga0207428_10005930 3300027907 Bacteria 11311
232 Ga0207428_10010032 3300027907 Bacteria 8477
233 Ga0207428_10183792 3300027907 Bacteria 1578
234 Ga0268265_10015657 3300028380 Bacteria 5193
235 Ga0268265_10036909 3300028380 Bacteria 3583
236 Ga0268264_10103742 3300028381 Bacteria 2477
237 Ga0268264_10113191 3300028381 Bacteria 2380
238 Ga0268264_10193149 3300028381 Bacteria 1857
239 Ga0395900_0637135 3300037418 Unclassified 1004
240 Ga0395901_0858810 3300038443 Bacteria 892
241 Ga0439464_0001573 3300042439 Bacteria 5422
242 Ga0451576_0506538 3300045051 Bacteria 1268
243 Ga0496100_0469382 3300048903 Unclassified 967
244 Ga0496101_0241049 3300048904 Bacteria 1407
245 Ga0496102_0088535 3300048905 Bacteria 2862
246 Ga0496103_0078820 3300048906 Bacteria 2069
247 Ga0496104_0031607 3300048907 Bacteria 4924
248 Ga0496104_0363404 3300048907 Unclassified 1360
249 Ga0496105_0384310 3300048908 Bacteria 1117
250 Ga0496106_0013201 3300048909 Bacteria 6095
251 Ga0496106_0224547 3300048909 Bacteria 1498
252 Ga0496107_0015250 3300048910 Bacteria 5386
253 Ga0496110_0509868 3300048913 Bacteria 1095
254 nmdc:mga05p37_17663_c1 3300050507 Bacteria 8608
255 nmdc:mga05p37_295966_c1 3300050507 Bacteria 1925
256 nmdc:mga05p37_39620_c1 3300050507 Bacteria 5786
257 nmdc:mga05p37_53350_c1 3300050507 Bacteria 4972
258 nmdc:mga05p37_5594_c1 3300050507 Bacteria 14776
259 nmdc:mga05p37_57774_c1 3300050507 Bacteria 4778
260 nmdc:mga05p37_6028_c1 3300050507 Bacteria 14276
261 nmdc:mga05p37_7197_c1 3300050507 Bacteria 13125
262 nmdc:mga09592_145820_c1 3300050508 Bacteria 2041
263 nmdc:mga09592_147883_c1 3300050508 Bacteria 2026
264 nmdc:mga09592_17098_c1 3300050508 Bacteria 5938
265 nmdc:mga09592_240745_c1 3300050508 Unclassified 1568
266 nmdc:mga09592_29838_c1 3300050508 Bacteria 4536
267 nmdc:mga09592_336063_c1 3300050508 Unclassified 1308
268 nmdc:mga0qj67_105376_c1 3300050509 Bacteria 2275
269 nmdc:mga0qj67_163195_c1 3300050509 Bacteria 1809
270 nmdc:mga0qj67_7194_c1 3300050509 Bacteria 8215
271 nmdc:mga06r32_37073_c1 3300050510 Bacteria 4612
272 nmdc:mga06r32_579_c1 3300050510 Bacteria 31881
273 nmdc:mga06r32_644223_c1 3300050510 Bacteria 1028
274 nmdc:mga08y16_155471_c1 3300050511 Unclassified 2377
275 nmdc:mga08y16_229134_c1 3300050511 Bacteria 1922
276 nmdc:mga08y16_59751_c1 3300050511 Unclassified 3982
277 nmdc:mga08y16_88344_c1 3300050511 Bacteria 3230
278 nmdc:mga0n895_122943_c1 3300050512 Bacteria 2617
279 nmdc:mga0n895_164228_c1 3300050512 Bacteria 2252
280 nmdc:mga0n895_208711_c1 3300050512 Bacteria 1984
281 nmdc:mga0n895_313590_c1 3300050512 Bacteria 1589
282 nmdc:mga0n895_519273_c1 3300050512 Bacteria 1199
283 nmdc:mga0n895_590234_c1 3300050512 Bacteria 1114
284 nmdc:mga0n895_908256_c1 3300050512 Bacteria 866
285 nmdc:mga0n895_91282_c1 3300050512 Bacteria 3048
286 nmdc:mga0n895_920949_c1 3300050512 Unclassified 859
287 nmdc:mga0rr50_194167_c1 3300050513 Bacteria 1665
288 nmdc:mga0rr50_2192_c1 3300050513 Bacteria 10945
289 nmdc:mga0rr50_78005_c1 3300050513 Unclassified 2547
290 nmdc:mga08x19_206862_c1 3300050514 Bacteria 1346
291 nmdc:mga08x19_28790_c1 3300050514 Bacteria 3482
292 nmdc:mga08x19_6319_c1 3300050514 Bacteria 7013
293 nmdc:mga08x19_85689_c1 3300050514 Bacteria 2073
294 nmdc:mga0a205_11800_c1 3300050515 Bacteria 8063
295 nmdc:mga0a205_140581_c1 3300050515 Bacteria 2314
296 nmdc:mga0a205_250787_c1 3300050515 Bacteria 1649
297 nmdc:mga0a205_2671_c1 3300050515 Bacteria 15772
298 nmdc:mga0a205_373748_c1 3300050515 Bacteria 1291
299 nmdc:mga0a205_63791_c1 3300050515 Bacteria 3558
300 nmdc:mga0a205_7461_c1 3300050515 Bacteria 9902
301 Ga0114129_10000975
302 JGI25406J46586_10013201
303 Ga0065715_10002261
304 Ga0065715_10092729
305 Ga0070676_10001459
306 Ga0070690_100004466
307 Ga0068869_100002719
308 Ga0070666_10002341
309 Ga0070660_100190948
310 Ga0070689_100010795
311 Ga0070687_100034112
312 Ga0070669_100005974
313 Ga0070669_100564501
314 Ga0070675_100128822
315 Ga0070671_100000183
316 Ga0070673_100001552
317 Ga0070688_100003562
318 Ga0070659_100250428
319 Ga0070667_100049228
320 Ga0070667_100203175
321 Ga0070703_10033213
322 Ga0070703_10113927
323 Ga0070709_10030063
324 Ga0070711_100016472
325 Ga0070705_100109142
326 Ga0070700_100045028
327 Ga0070694_100093226
328 Ga0070694_100119293
329 Ga0070694_100489624
330 Ga0070708_100089499
331 Ga0070708_100163101
332 Ga0070678_100046299
333 Ga0070662_100004947
334 Ga0070662_100334255
335 Ga0068867_100115693
336 Ga0070685_10004317
337 Ga0070706_100001262
338 Ga0070706_100087829
339 Ga0070706_100452801
340 Ga0070707_100006919
341 Ga0070707_100008020
342 Ga0070707_100105315
343 Ga0070707_100304428
344 Ga0070707_100319160
345 Ga0070707_100351767
346 Ga0070698_100015094
347 Ga0070698_100072604
348 Ga0070698_100297117
349 Ga0070699_100260605
350 Ga0070699_100405856
351 Ga0070699_100555110
352 Ga0070697_100000830
353 Ga0070697_100044071
354 Ga0070697_100052904
355 Ga0070697_100090808
356 Ga0070697_100231594
357 Ga0070672_100016430
358 Ga0070672_100456072
359 Ga0070686_100003370
360 Ga0070686_100018073
361 Ga0070695_100173997
362 Ga0070696_100023179
363 Ga0070696_100072917
364 Ga0070696_100085515
365 Ga0070696_100293537
366 Ga0070704_100020891
367 Ga0070704_100091941
368 Ga0070664_100002107
369 Ga0068866_10073598
370 Ga0068861_100045682
371 Ga0068861_100151342
372 Ga0068870_10012781
373 Ga0068863_100001352
374 Ga0068863_100002174
375 Ga0068858_100153542
376 Ga0068860_100081881
377 Ga0068860_100315182
378 Ga0068862_100023627
379 Ga0068862_100164413
380 Ga0081539_10002905
381 Ga0070717_10518815
382 Ga0070715_10090912
383 Ga0070716_100057058
384 Ga0070716_100274318
385 Ga0070712_100087478
386 Ga0075428_100005071
387 Ga0075428_100102646
388 Ga0075428_100227576
389 Ga0075428_100581433
390 Ga0075430_100016294
391 Ga0075430_100042394
392 Ga0075430_100112342
393 Ga0075430_100320746
394 Ga0075431_100001350
395 Ga0075431_100072036
396 Ga0075431_100078526
397 Ga0075433_10008642
398 Ga0075433_10012715
399 Ga0075433_10052180
400 Ga0075433_10065032
401 Ga0075433_10094883
402 Ga0075433_10154495
403 Ga0075433_10189487
404 Ga0075433_10198177
405 Ga0075433_10273230
406 Ga0075434_100005024
407 Ga0075434_100088341
408 Ga0075434_100142197
409 Ga0075434_100217053
410 Ga0075434_100224254
411 Ga0075434_100370844
412 Ga0075434_100390955
413 Ga0075434_100430482
414 Ga0075429_100016159
415 Ga0075429_100030188
416 Ga0075429_100030490
417 Ga0075429_100154603
418 Ga0075429_100231575
419 Ga0075436_100089604
420 Ga0075436_100130733
421 Ga0075436_100205875
422 Ga0075436_100323155
423 Ga0075435_100000564
424 Ga0075435_100029165
425 Ga0075435_100042224
426 Ga0075435_100062328
427 Ga0075435_100291521
428 Ga0099794_10126630
429 Ga0099795_10063393
430 Ga0111539_10013802
431 Ga0111539_10016201
432 Ga0111539_10075849
433 Ga0111539_10410278
434 Ga0111539_10490019
435 Ga0105245_10023545
436 Ga0105245_10072273
437 Ga0114129_10018197
438 Ga0114129_10029056
439 Ga0114129_10033895
440 Ga0114129_10075338
441 Ga0114129_10172328
442 Ga0114129_10173336
443 Ga0114129_10280266
444 Ga0114129_10301068
445 Ga0114129_11146533
446 Ga0114129_11156290
447 Ga0105241_10043904
448 Ga0105242_10007086
449 Ga0105237_10304258
450 Ga0105249_10185127
451 Ga0099796_10004371
452 Ga0105239_10061793
453 Ga0105239_10133947
454 Ga0105246_10279797
455 Ga0157378_10013122
456 Ga0157378_10042976
457 Ga0157378_10056056
458 Ga0157378_10070438
459 Ga0157378_10321296
460 Ga0163162_10045408
461 Ga0157375_10009845
462 Ga0157375_10144900
463 Ga0157375_10423655
464 Ga0157375_10597814
465 Ga0157380_10005867
466 Ga0157377_10005867
467 Ga0157379_10021691
468 Ga0157379_10083863
469 Ga0207697_10015115
470 Ga0207653_10010072
471 Ga0207692_10066389
472 Ga0207680_10003972
473 Ga0207685_10003434
474 Ga0207699_10244524
475 Ga0207645_10000887
476 Ga0207643_10019400
477 Ga0207684_10002037
478 Ga0207684_10164950
479 Ga0207684_10185731
480 Ga0207654_10150658
481 Ga0207671_10179314
482 Ga0207693_10009201
483 Ga0207693_10069876
484 Ga0207693_10138451
485 Ga0207663_10008568
486 Ga0207663_10033078
487 Ga0207660_10260517
488 Ga0207662_10046935
489 Ga0207646_10001135
490 Ga0207646_10050103
491 Ga0207646_10050964
492 Ga0207646_10098578
493 Ga0207646_10296994
494 Ga0207646_10349701
495 Ga0207646_10515616
496 Ga0207681_10064006
497 Ga0207681_10410719
498 Ga0207681_10479452
499 Ga0207659_10003351
500 Ga0207659_10241173
501 Ga0207687_10037598
502 Ga0207687_10117417
503 Ga0207644_10000120
504 Ga0207644_10118462
505 Ga0207706_10004453
506 Ga0207706_10308957
507 Ga0207686_10059202
508 Ga0207670_10230242
509 Ga0207704_10101192
510 Ga0207665_10009327
511 Ga0207691_10000809
512 Ga0207711_10230802
513 Ga0207689_10004818
514 Ga0207689_10037810
515 Ga0207689_10108872
516 Ga0207679_10004099
517 Ga0207651_10001229
518 Ga0207651_10399394
519 Ga0207712_10084143
520 Ga0207712_10445557
521 Ga0207658_10086817
522 Ga0207708_10063875
523 Ga0207702_10694772
524 Ga0207641_10001341
525 Ga0207641_10005166
526 Ga0207641_10169856
527 Ga0207648_10239725
528 Ga0207675_100031777
529 Ga0207683_10066892
530 Ga0209588_1002429
531 Ga0207428_10005930
532 Ga0207428_10010032
533 Ga0207428_10183792
534 Ga0268265_10015657
535 Ga0268265_10036909
536 Ga0268264_10103742
537 Ga0268264_10113191
538 Ga0268264_10193149
539 Ga0395900_0637135
540 Ga0395901_0858810
541 Ga0439464_0001573
542 Ga0451576_0506538
543 Ga0496100_0469382
544 Ga0496101_0241049
545 Ga0496102_0088535
546 Ga0496103_0078820
547 Ga0496104_0031607
548 Ga0496104_0363404
549 Ga0496105_0384310
550 Ga0496106_0013201
551 Ga0496106_0224547
552 Ga0496107_0015250
553 Ga0496110_0509868
554 nmdc:mga05p37_17663_c1
555 nmdc:mga05p37_295966_c1
556 nmdc:mga05p37_39620_c1
557 nmdc:mga05p37_53350_c1
558 nmdc:mga05p37_5594_c1
559 nmdc:mga05p37_57774_c1
560 nmdc:mga05p37_6028_c1
561 nmdc:mga05p37_7197_c1
562 nmdc:mga09592_145820_c1
563 nmdc:mga09592_147883_c1
564 nmdc:mga09592_17098_c1
565 nmdc:mga09592_240745_c1
566 nmdc:mga09592_29838_c1
567 nmdc:mga09592_336063_c1
568 nmdc:mga0qj67_105376_c1
569 nmdc:mga0qj67_163195_c1
570 nmdc:mga0qj67_7194_c1
571 nmdc:mga06r32_37073_c1
572 nmdc:mga06r32_579_c1
573 nmdc:mga06r32_644223_c1
574 nmdc:mga08y16_155471_c1
575 nmdc:mga08y16_229134_c1
576 nmdc:mga08y16_59751_c1
577 nmdc:mga08y16_88344_c1
578 nmdc:mga0n895_122943_c1
579 nmdc:mga0n895_164228_c1
580 nmdc:mga0n895_208711_c1
581 nmdc:mga0n895_313590_c1
582 nmdc:mga0n895_519273_c1
583 nmdc:mga0n895_590234_c1
584 nmdc:mga0n895_908256_c1
585 nmdc:mga0n895_91282_c1
586 nmdc:mga0n895_920949_c1
587 nmdc:mga0rr50_194167_c1
588 nmdc:mga0rr50_2192_c1
589 nmdc:mga0rr50_78005_c1
590 nmdc:mga08x19_206862_c1
591 nmdc:mga08x19_28790_c1
592 nmdc:mga08x19_6319_c1
593 nmdc:mga08x19_85689_c1
594 nmdc:mga0a205_11800_c1
595 nmdc:mga0a205_140581_c1
596 nmdc:mga0a205_250787_c1
597 nmdc:mga0a205_2671_c1
598 nmdc:mga0a205_373748_c1
599 nmdc:mga0a205_63791_c1
600 nmdc:mga0a205_7461_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8adb-assembly1.cif.gz_A viral tegument-like dubs 0.3907 1 54
2ef2-assembly1.cif.gz_A crystal structure of an artificial metalloprotein:rh(phebox-ph)/apo-a71g myoglobin 0.333 108 239
5f3o-assembly1.cif.gz_A crystal structure of ehrnaseiii229 from entamoeba histolytica complexed with mn2+ 0.3249 99 241
7spe-assembly1.cif.gz_A crystal structure of sperm whale myoglobin variant smb5(o2bey) 0.3209 108 239
1mnj-assembly2.cif.gz_B interactions among residues cd3, e7, e10 and e11 in myoglobins: attempts to simulate the o2 and co binding properties of aplysia myoglobin 0.3142 108 239
ID Description Score Start End Superfamily
6hu9o01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6936 4 52 1.10.287.70
6hu9o01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.465 4 52 1.10.287.70
af_A0A0R0FSX5_802_901_1.25.40.90 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.4296 6 52 1.25.40.90
af_E7F5U7_8_131_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3555 97 239 1.20.140.150
5ksjC00 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.3415 99 238 1.10.490.10
ID Description Score Start End GO Terms
AF-A0A2H5YA69-F1-model_v4 DUF1440 domain-containing protein 0.8766 96 240 GO:0016020
AF-A0A3M1ELG9-F1-model_v4 DUF1440 domain-containing protein 0.8722 84 248 GO:0016020
AF-A0A3D0CS71-F1-model_v4 DUF1440 domain-containing protein 0.8328 75 246 GO:0016020
AF-A0A2V9VT77-F1-model_v4 DUF1440 domain-containing protein 0.8315 89 273 GO:0016020
AF-A0A353ET53-F1-model_v4 DUF1440 domain-containing protein 0.8266 98 239 GO:0016020

Map