F395332

General Info

Members Datasets Scaffolds Average Seq Length
300 212 600 116

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_12348478|Ga0105245_123484781
Length 127
Sequence MSVVEQYARAHIVTDADQVEEERTAVPVVLRYDPDSDPRSVRVGLPDRHEWTFSRTLLEQGLRAPTGTGEVRVWPCGRVQAIVEFHSAHGVSVVQFESKTLLRFLRRTYTATAAKASATSRQQTVSH

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
18 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
19 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
24 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
27 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
28 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
30 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
31 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
36 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
37 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
40 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
41 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
42 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
43 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
44 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
45 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
46 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
47 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
48 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
49 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
50 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
53 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
54 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
55 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
56 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
57 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
58 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
59 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
60 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
61 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
62 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
63 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
64 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
65 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
66 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
67 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
70 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
71 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
72 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
73 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
74 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
75 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
76 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
77 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
78 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
79 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
92 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
93 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
94 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
95 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
96 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
120 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
121 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
122 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
123 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
124 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
129 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
130 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
131 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
132 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
155 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
156 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
157 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
160 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
161 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
162 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
163 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
164 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
165 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
166 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
167 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
168 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
169 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
170 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
171 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
172 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
173 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
175 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
176 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
177 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
178 2643221647 Streptomyces sp. Root369 Isolate Unclassified
179 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
180 2643221714 Streptomyces sp. Root264 Isolate Unclassified
181 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
182 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
183 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
184 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
185 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
186 2808606448 Streptomyces sp. 193411 Isolate Unclassified
187 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
188 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
189 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
190 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
191 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
192 2867428634 Streptomyces sp. RP5T Isolate Unclassified
193 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
194 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
195 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
196 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
197 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
198 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
199 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
200 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
201 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
202 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
203 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
204 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
205 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
206 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
207 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
208 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
209 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
210 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
211 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
212 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86
Metatranscriptomes 1.33
Isolates 12.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 0.67
Rhizoplane 0.33
Rhizosphere 71.67
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_12348478 3300009098 Bacteria 587
2 JGI24739J22299_10028908 3300001989 Bacteria 1931
3 rootH1_10007500 3300003316 Bacteria 12200
4 rootH1_10012041 3300003316 Bacteria 3750
5 rootH2_10026346 3300003320 Bacteria 1849
6 rootL2_10059349 3300003322 Bacteria 2619
7 rootL2_10083911 3300003322 Bacteria 2277
8 rootH1_10005128 3300003323 Bacteria 8259
9 rootH1_10065511 3300003323 Bacteria 1867
10 Ga0006562J51391_1072228 3300003578 Bacteria 6280
11 Ga0070665_100406473 3300005548 Bacteria 1370
12 Ga0070664_101072103 3300005564 Bacteria 758
13 Ga0068856_100220474 3300005614 Bacteria 1912
14 Ga0081455_10027431 3300005937 Bacteria 5219
15 Ga0075365_10430901 3300006038 Bacteria 931
16 Ga0075368_10005106 3300006042 Bacteria 4496
17 Ga0075363_100003825 3300006048 Bacteria 6488
18 Ga0075367_10008717 3300006178 Bacteria 5268
19 Ga0075367_10159770 3300006178 Bacteria 1401
20 Ga0075370_10154153 3300006353 Bacteria 1347
21 Ga0099826_10212275 3300006948 Bacteria 1050
22 Ga0105244_10409542 3300009036 Bacteria 624
23 Ga0105250_10108712 3300009092 Bacteria 1134
24 Ga0105245_11942991 3300009098 Bacteria 642
25 Ga0105243_10060956 3300009148 Bacteria 3015
26 Ga0105243_10578519 3300009148 Bacteria 1078
27 Ga0105246_10000444 3300011119 Bacteria 22194
28 Ga0157372_10127961 3300013307 Bacteria 2921
29 Ga0182008_10002535 3300014497 Bacteria 11384
30 Ga0182008_10910846 3300014497 Bacteria 518
31 Ga0182006_1037421 3300015261 Bacteria 1923
32 Ga0182007_10001267 3300015262 Bacteria 13721
33 Ga0182005_1006491 3300015265 Bacteria 3567
34 Ga0183367_1005 3300015688 Bacteria 652063
35 Ga0224712_10320591 3300022467 Bacteria 728
36 Ga0224712_10636819 3300022467 Bacteria 522
37 Ga0209758_1003261 3300025297 Bacteria 15048
38 Ga0207426_1014674 3300025302 Bacteria 2863
39 Ga0207709_10297059 3300025935 Bacteria 1200
40 Ga0207709_10306706 3300025935 Bacteria 1183
41 Ga0207679_10830027 3300025945 Bacteria 844
42 Ga0207702_10127775 3300026078 Bacteria 2284
43 Ga0209371_1010748 3300027312 Bacteria 2781
44 Ga0209282_1289388 3300027666 Bacteria 702
45 Ga0209813_10000932 3300027866 Bacteria 6562
46 Ga0307517_10004807 3300028786 Bacteria 20607
47 Ga0307515_10000054 3300028794 Bacteria 265489
48 Ga0268256_1010372 3300030500 Bacteria 3024
49 Ga0307511_10000467 3300030521 Bacteria 43772
50 Ga0307511_10016574 3300030521 Bacteria 7097
51 Ga0307511_10087144 3300030521 Bacteria 2145
52 Ga0307512_10049561 3300030522 Bacteria 3385
53 Ga0307512_10167646 3300030522 Bacteria 1268
54 Ga0307513_10089771 3300031456 Bacteria 3136
55 Ga0307509_10005903 3300031507 Bacteria 16757
56 Ga0307509_10008190 3300031507 Bacteria 13384
57 Ga0307408_101461715 3300031548 Bacteria 645
58 Ga0307508_10041359 3300031616 Bacteria 4136
59 Ga0307508_10049681 3300031616 Bacteria 3735
60 Ga0307508_10391873 3300031616 Bacteria 980
61 Ga0307514_10012153 3300031649 Bacteria 7166
62 Ga0307516_10001443 3300031730 Bacteria 32830
63 Ga0307516_10154877 3300031730 Bacteria 2048
64 Ga0307405_11692866 3300031731 Bacteria 560
65 Ga0307518_10063572 3300031838 Bacteria 2679
66 Ga0307518_10069080 3300031838 Bacteria 2560
67 Ga0307518_10408389 3300031838 Bacteria 753
68 Ga0307410_10349530 3300031852 Bacteria 1181
69 Ga0307409_100182561 3300031995 Bacteria 1859
70 Ga0307507_10080068 3300033179 Bacteria 2882
71 Ga0307507_10250727 3300033179 Bacteria 1144
72 Ga0307507_10324863 3300033179 Bacteria 923
73 Ga0307510_10009244 3300033180 Bacteria 11745
74 Ga0307510_10021100 3300033180 Bacteria 7598
75 Ga0307510_10053296 3300033180 Bacteria 4254
76 Ga0307510_10142894 3300033180 Bacteria 2032
77 Ga0395900_0571010 3300037418 Bacteria 1074
78 Ga0395898_0002257 3300037466 Bacteria 23382
79 Ga0395898_0007359 3300037466 Bacteria 11686
80 Ga0395898_0416548 3300037466 Bacteria 1280
81 Ga0395901_0262138 3300038443 Bacteria 1799
82 Ga0439436_0003918 3300041404 Bacteria 4563
83 Ga0439439_0002645 3300041406 Bacteria 3838
84 Ga0451797_0835310 3300041453 Bacteria 746
85 Ga0451837_0403506 3300041494 Bacteria 2695
86 Ga0451841_1402772 3300041498 Bacteria 638
87 Ga0451845_0404758 3300041501 Bacteria 792
88 Ga0451849_0438835 3300041505 Bacteria 676
89 Ga0451853_1272148 3300041512 Bacteria 7080
90 Ga0451853_2614108 3300041512 Bacteria 546
91 Ga0439433_0001200 3300041999 Bacteria 5332
92 Ga0439442_011815 3300042002 Bacteria 1782
93 Ga0439448_0047838 3300042005 Bacteria 1395
94 Ga0439449_0007846 3300042007 Bacteria 4053
95 Ga0439449_0024697 3300042007 Bacteria 2246
96 Ga0439449_0201405 3300042007 Bacteria 745
97 Ga0439450_168858 3300042008 Bacteria 578
98 Ga0439455_0000958 3300042012 Bacteria 4501
99 Ga0439457_000647 3300042014 Bacteria 10310
100 Ga0439462_0005247 3300042015 Bacteria 3190
101 Ga0450902_015373 3300042137 Bacteria 1241
102 Ga0450903_000066 3300042138 Bacteria 21042
103 Ga0450903_004536 3300042138 Bacteria 2363
104 Ga0439458_0000271 3300042157 Bacteria 12713
105 Ga0439458_0002309 3300042157 Bacteria 4684
106 Ga0439458_0096302 3300042157 Bacteria 765
107 Ga0466969_0053084 3300044656 Bacteria 1990
108 Ga0466969_0253337 3300044656 Bacteria 798
109 Ga0466972_0078210 3300044658 Bacteria 1575
110 Ga0466972_0113124 3300044658 Bacteria 1282
111 Ga0466965_0094007 3300044683 Bacteria 1527
112 Ga0466965_0205793 3300044683 Bacteria 1045
113 Ga0466965_0227993 3300044683 Bacteria 994
114 Ga0466965_0507380 3300044683 Bacteria 677
115 Ga0466966_0058681 3300044684 Bacteria 2432
116 Ga0466966_0108611 3300044684 Bacteria 1711
117 Ga0466966_0203380 3300044684 Bacteria 1198
118 Ga0466966_0341120 3300044684 Bacteria 900
119 Ga0466961_0027560 3300044693 Bacteria 3654
120 Ga0466961_0096195 3300044693 Bacteria 1867
121 Ga0466961_0115290 3300044693 Bacteria 1689
122 Ga0466961_0343164 3300044693 Bacteria 909
123 Ga0466963_0005753 3300044694 Bacteria 7289
124 Ga0466963_0040567 3300044694 Bacteria 3051
125 Ga0466963_0217202 3300044694 Bacteria 1338
126 Ga0466964_0315818 3300044706 Bacteria 792
127 Ga0466964_0357039 3300044706 Bacteria 752
128 Ga0466971_0435784 3300044719 Bacteria 642
129 Ga0466968_0670720 3300044735 Bacteria 528
130 Ga0466970_0002883 3300044765 Bacteria 8325
131 Ga0466970_0008362 3300044765 Bacteria 5206
132 Ga0466970_0068547 3300044765 Bacteria 1906
133 Ga0466957_0010662 3300044842 Bacteria 5282
134 Ga0466957_0022771 3300044842 Bacteria 3699
135 Ga0466960_0001348 3300044901 Bacteria 8933
136 Ga0466959_0004797 3300045049 Bacteria 9125
137 Ga0466959_0195438 3300045049 Bacteria 1410
138 Ga0466958_0031694 3300045836 Bacteria 3142
139 Ga0466958_1134430 3300045836 Bacteria 510
140 Ga0466967_0210387 3300045976 Bacteria 1844
141 Ga0495592_0004815 3300046454 Bacteria 9924
142 Ga0495603_0491485 3300046455 Bacteria 703
143 Ga0495629_0026900 3300046459 Bacteria 4085
144 Ga0495629_0083840 3300046459 Bacteria 2224
145 Ga0495638_0003378 3300046460 Bacteria 12584
146 Ga0495651_0019095 3300046462 Bacteria 5312
147 Ga0495582_0058430 3300046473 Bacteria 2127
148 Ga0495662_0005344 3300046476 Bacteria 6433
149 Ga0495664_0007561 3300046477 Bacteria 6039
150 Ga0495618_0276002 3300046514 Bacteria 1049
151 Ga0495628_0076377 3300046516 Bacteria 2607
152 Ga0495630_0061903 3300046517 Bacteria 2811
153 Ga0495648_0314173 3300046524 Bacteria 729
154 Ga0495666_0120479 3300046526 Bacteria 1229
155 Ga0495652_0025047 3300046529 Bacteria 5280
156 Ga0495640_0059071 3300046533 Bacteria 2614
157 Ga0495587_0063359 3300046536 Bacteria 2162
158 Ga0495609_0424485 3300046538 Bacteria 530
159 Ga0495645_0054164 3300046543 Bacteria 2915
160 Ga0495634_0029141 3300046642 Bacteria 3823
161 Ga0495625_0004168 3300046660 Bacteria 13777
162 Ga0495635_0014699 3300046663 Bacteria 5475
163 Ga0495588_0033196 3300046674 Bacteria 2605
164 Ga0495657_0050410 3300046675 Bacteria 2798
165 Ga0495646_0007893 3300046680 Bacteria 6759
166 Ga0495658_0291841 3300046683 Bacteria 1030
167 Ga0495613_0002838 3300046689 Bacteria 12995
168 Ga0495671_0033041 3300046692 Bacteria 2637
169 Ga0495671_0150969 3300046692 Bacteria 1131
170 Ga0495649_0186606 3300046694 Bacteria 1080
171 Ga0495600_0054028 3300046809 Bacteria 2623
172 Ga0495581_0025150 3300047315 Bacteria 3452
173 Ga0495604_0001899 3300047317 Bacteria 16970
174 Ga0495674_0241054 3300047319 Bacteria 1490
175 Ga0495676_0039267 3300047321 Bacteria 3922
176 Ga0495687_004686 3300047443 Bacteria 9100
177 Ga0495685_002845 3300047447 Bacteria 5462
178 Ga0495685_271867 3300047447 Bacteria 535
179 Ga0495681_0000474 3300047470 Bacteria 30767
180 Ga0495684_0094819 3300047471 Bacteria 2259
181 Ga0495686_0007881 3300047472 Bacteria 7913
182 Ga0495593_0002842 3300047673 Bacteria 10430
183 Ga0495602_0040156 3300048088 Bacteria 4297
184 Ga0495614_0025265 3300048089 Bacteria 2561
185 Ga0495614_0035976 3300048089 Bacteria 2126
186 Ga0501308_075061 3300049128 Bacteria 530
187 Ga0501031_0004140 3300049568 Bacteria 9368
188 Ga0501031_0050187 3300049568 Bacteria 2719
189 Ga0501032_0042432 3300049569 Bacteria 3085
190 Ga0501032_0076484 3300049569 Bacteria 2229
191 Ga0501033_0001491 3300049570 Bacteria 20728
192 Ga0501033_0022795 3300049570 Bacteria 4720
193 Ga0501033_0063115 3300049570 Bacteria 2727
194 Ga0501033_0158081 3300049570 Bacteria 1632
195 Ga0501034_0000800 3300049571 Bacteria 46777
196 Ga0501034_0011945 3300049571 Bacteria 8975
197 Ga0501034_0027215 3300049571 Bacteria 5816
198 Ga0501034_0044281 3300049571 Bacteria 4502
199 Ga0501034_0598384 3300049571 Bacteria 1008
200 Ga0501036_0017674 3300049572 Bacteria 5967
201 Ga0501036_0017989 3300049572 Bacteria 5916
202 Ga0501036_0171810 3300049572 Bacteria 1826
203 Ga0501036_1749808 3300049572 Unclassified 500
204 Ga0501037_0092297 3300049573 Bacteria 2190
205 Ga0501037_0562671 3300049573 Bacteria 768
206 Ga0501038_0000941 3300049574 Bacteria 25968
207 Ga0501038_0068363 3300049574 Bacteria 3020
208 Ga0501038_0239611 3300049574 Bacteria 1440
209 Ga0501038_1084334 3300049574 Bacteria 585
210 Ga0501039_0023710 3300049575 Bacteria 4710
211 Ga0501039_0087147 3300049575 Bacteria 2432
212 Ga0501042_0006923 3300049578 Bacteria 7400
213 Ga0501043_0029449 3300049579 Bacteria 4313
214 Ga0501043_0107153 3300049579 Bacteria 2194
215 Ga0501043_0664657 3300049579 Bacteria 764
216 Ga0501046_0004998 3300049580 Bacteria 11910
217 Ga0501046_0467815 3300049580 Bacteria 905
218 Ga0501047_0036045 3300049581 Bacteria 4779
219 Ga0501047_0091367 3300049581 Bacteria 2922
220 Ga0501048_0009825 3300049582 Bacteria 7173
221 Ga0501048_0069591 3300049582 Bacteria 2486
222 Ga0501048_1153185 3300049582 Bacteria 557
223 Ga0501070_0007592 3300049586 Bacteria 9211
224 Ga0501070_0380224 3300049586 Bacteria 1144
225 Ga0501070_0530786 3300049586 Bacteria 943
226 Ga0501073_0179140 3300049589 Bacteria 1467
227 Ga0501074_0010471 3300049590 Bacteria 6730
228 Ga0501221_167835 3300049704 Bacteria 592
229 Ga0501080_0357828 3300049742 Bacteria 1317
230 Ga0501035_0023182 3300049822 Bacteria 5694
231 Ga0501035_0058147 3300049822 Bacteria 3446
232 Ga0501035_0929282 3300049822 Bacteria 687
233 Ga0501035_0963824 3300049822 Bacteria 672
234 Ga0501035_1171384 3300049822 Bacteria 597
235 Ga0501044_0000401 3300049823 Bacteria 53413
236 Ga0501044_0070091 3300049823 Bacteria 3567
237 Ga0501044_0128512 3300049823 Bacteria 2529
238 Ga0501044_0611055 3300049823 Bacteria 982
239 Ga0501045_0134136 3300049824 Bacteria 1841
240 Ga0501045_0360890 3300049824 Bacteria 1081
241 nmdc:mga03n38_1542_c1 3300050490 Bacteria 6677
242 nmdc:mga0yw44_503276_c1 3300050492 Bacteria 822
243 nmdc:mga06z11_3670_c1 3300050494 Bacteria 5961
244 nmdc:mga04h51_633_c1 3300050495 Bacteria 8256
245 nmdc:mga07m45_150983_c1 3300050496 Bacteria 1347
246 Ga0495612_0039482 3300053078 Bacteria 1920
247 Ga0495655_0043334 3300053083 Bacteria 1160
248 Ga0500644_0066915 3300053088 Bacteria 1283
249 Ga0500640_030713 3300053095 Bacteria 2353
250 Ga0500650_0124234 3300053098 Bacteria 1202
251 Ga0500553_028290 3300053101 Bacteria 2811
252 Ga0500558_111452 3300053106 Bacteria 1073
253 Ga0500560_004990 3300053107 Bacteria 2889
254 Ga0500572_033463 3300053111 Bacteria 1450
255 Ga0500614_104581 3300053123 Bacteria 819
256 Ga0500573_0036712 3300053140 Bacteria 2830
257 Ga0500600_0215070 3300053149 Bacteria 892
258 Ga0500634_0355993 3300053161 Bacteria 557
259 Ga0500636_0254503 3300053177 Bacteria 893
260 Ga0500565_008597 3300053734 Bacteria 998
261 Ga0466962_0014686 3300061719 Bacteria 3775
262 Ga0466962_0114099 3300061719 Bacteria 1301
263 2547407992 2547132111 Bacteria 8013147
264 2585308657 2582581313 Bacteria 10042643
265 2585318770 2582581314 Bacteria 11452267
266 2644264091 2643221647 Bacteria 10741251
267 2644436978 2643221678 Bacteria 9540101
268 2644628725 2643221714 Bacteria 9015452
269 2784588445 2784132148 Bacteria 8627943
270 2785369274 2784746768 Bacteria 10036182
271 2786670412 2786546132 Bacteria 10419719
272 2808841876 2808606359 Bacteria 9866990
273 2808920411 2808606375 Bacteria 9466072
274 2809232041 2808606448 Bacteria 8656184
275 2812358381 2811994879 Bacteria 9313447
276 2812480732 2811994917 Bacteria 7761064
277 2852636878 2852635781 Bacteria 8251373
278 2862285476 2862281513 Bacteria 9621493
279 2862515219 2862507626 Bacteria 9425308
280 2867430405 2867428634 Bacteria 9590268
281 2877681277 2877676314 Bacteria 9512378
282 2912720266 2912715099 Bacteria 9460473
283 2919469680 2919468124 Bacteria 9133025
284 2946067497 2946064051 Bacteria 8957905
285 2946075749 2946072368 Bacteria 8999607
286 2947229501 2947224130 Bacteria 9938529
287 2954007681 2954002825 Bacteria 9173742
288 2954676758 2954673503 Bacteria 9685905
289 2954687408 2954682443 Bacteria 9862841
290 2954697097 2954691527 Bacteria 10720516
291 2954705039 2954701450 Bacteria 10834262
292 2954726347 2954721474 Bacteria 10456478
293 2954735463 2954731030 Bacteria 10243860
294 2954745270 2954740390 Bacteria 10229294
295 2954754318 2954749733 Bacteria 10366972
296 2954764246 2954759201 Bacteria 9358192
297 3006496234 3006493962 Bacteria 8825450
298 8008579002 8008574985 Bacteria 7815457
299 8023628860 8023623736 Bacteria 8593882
300 8056833726 8056829672 Bacteria 9045328
301 Ga0105245_12348478
302 JGI24739J22299_10028908
303 rootH1_10007500
304 rootH1_10012041
305 rootH2_10026346
306 rootL2_10059349
307 rootL2_10083911
308 rootH1_10005128
309 rootH1_10065511
310 Ga0006562J51391_1072228
311 Ga0070665_100406473
312 Ga0070664_101072103
313 Ga0068856_100220474
314 Ga0081455_10027431
315 Ga0075365_10430901
316 Ga0075368_10005106
317 Ga0075363_100003825
318 Ga0075367_10008717
319 Ga0075367_10159770
320 Ga0075370_10154153
321 Ga0099826_10212275
322 Ga0105244_10409542
323 Ga0105250_10108712
324 Ga0105245_11942991
325 Ga0105243_10060956
326 Ga0105243_10578519
327 Ga0105246_10000444
328 Ga0157372_10127961
329 Ga0182008_10002535
330 Ga0182008_10910846
331 Ga0182006_1037421
332 Ga0182007_10001267
333 Ga0182005_1006491
334 Ga0183367_1005
335 Ga0224712_10320591
336 Ga0224712_10636819
337 Ga0209758_1003261
338 Ga0207426_1014674
339 Ga0207709_10297059
340 Ga0207709_10306706
341 Ga0207679_10830027
342 Ga0207702_10127775
343 Ga0209371_1010748
344 Ga0209282_1289388
345 Ga0209813_10000932
346 Ga0307517_10004807
347 Ga0307515_10000054
348 Ga0268256_1010372
349 Ga0307511_10000467
350 Ga0307511_10016574
351 Ga0307511_10087144
352 Ga0307512_10049561
353 Ga0307512_10167646
354 Ga0307513_10089771
355 Ga0307509_10005903
356 Ga0307509_10008190
357 Ga0307408_101461715
358 Ga0307508_10041359
359 Ga0307508_10049681
360 Ga0307508_10391873
361 Ga0307514_10012153
362 Ga0307516_10001443
363 Ga0307516_10154877
364 Ga0307405_11692866
365 Ga0307518_10063572
366 Ga0307518_10069080
367 Ga0307518_10408389
368 Ga0307410_10349530
369 Ga0307409_100182561
370 Ga0307507_10080068
371 Ga0307507_10250727
372 Ga0307507_10324863
373 Ga0307510_10009244
374 Ga0307510_10021100
375 Ga0307510_10053296
376 Ga0307510_10142894
377 Ga0395900_0571010
378 Ga0395898_0002257
379 Ga0395898_0007359
380 Ga0395898_0416548
381 Ga0395901_0262138
382 Ga0439436_0003918
383 Ga0439439_0002645
384 Ga0451797_0835310
385 Ga0451837_0403506
386 Ga0451841_1402772
387 Ga0451845_0404758
388 Ga0451849_0438835
389 Ga0451853_1272148
390 Ga0451853_2614108
391 Ga0439433_0001200
392 Ga0439442_011815
393 Ga0439448_0047838
394 Ga0439449_0007846
395 Ga0439449_0024697
396 Ga0439449_0201405
397 Ga0439450_168858
398 Ga0439455_0000958
399 Ga0439457_000647
400 Ga0439462_0005247
401 Ga0450902_015373
402 Ga0450903_000066
403 Ga0450903_004536
404 Ga0439458_0000271
405 Ga0439458_0002309
406 Ga0439458_0096302
407 Ga0466969_0053084
408 Ga0466969_0253337
409 Ga0466972_0078210
410 Ga0466972_0113124
411 Ga0466965_0094007
412 Ga0466965_0205793
413 Ga0466965_0227993
414 Ga0466965_0507380
415 Ga0466966_0058681
416 Ga0466966_0108611
417 Ga0466966_0203380
418 Ga0466966_0341120
419 Ga0466961_0027560
420 Ga0466961_0096195
421 Ga0466961_0115290
422 Ga0466961_0343164
423 Ga0466963_0005753
424 Ga0466963_0040567
425 Ga0466963_0217202
426 Ga0466964_0315818
427 Ga0466964_0357039
428 Ga0466971_0435784
429 Ga0466968_0670720
430 Ga0466970_0002883
431 Ga0466970_0008362
432 Ga0466970_0068547
433 Ga0466957_0010662
434 Ga0466957_0022771
435 Ga0466960_0001348
436 Ga0466959_0004797
437 Ga0466959_0195438
438 Ga0466958_0031694
439 Ga0466958_1134430
440 Ga0466967_0210387
441 Ga0495592_0004815
442 Ga0495603_0491485
443 Ga0495629_0026900
444 Ga0495629_0083840
445 Ga0495638_0003378
446 Ga0495651_0019095
447 Ga0495582_0058430
448 Ga0495662_0005344
449 Ga0495664_0007561
450 Ga0495618_0276002
451 Ga0495628_0076377
452 Ga0495630_0061903
453 Ga0495648_0314173
454 Ga0495666_0120479
455 Ga0495652_0025047
456 Ga0495640_0059071
457 Ga0495587_0063359
458 Ga0495609_0424485
459 Ga0495645_0054164
460 Ga0495634_0029141
461 Ga0495625_0004168
462 Ga0495635_0014699
463 Ga0495588_0033196
464 Ga0495657_0050410
465 Ga0495646_0007893
466 Ga0495658_0291841
467 Ga0495613_0002838
468 Ga0495671_0033041
469 Ga0495671_0150969
470 Ga0495649_0186606
471 Ga0495600_0054028
472 Ga0495581_0025150
473 Ga0495604_0001899
474 Ga0495674_0241054
475 Ga0495676_0039267
476 Ga0495687_004686
477 Ga0495685_002845
478 Ga0495685_271867
479 Ga0495681_0000474
480 Ga0495684_0094819
481 Ga0495686_0007881
482 Ga0495593_0002842
483 Ga0495602_0040156
484 Ga0495614_0025265
485 Ga0495614_0035976
486 Ga0501308_075061
487 Ga0501031_0004140
488 Ga0501031_0050187
489 Ga0501032_0042432
490 Ga0501032_0076484
491 Ga0501033_0001491
492 Ga0501033_0022795
493 Ga0501033_0063115
494 Ga0501033_0158081
495 Ga0501034_0000800
496 Ga0501034_0011945
497 Ga0501034_0027215
498 Ga0501034_0044281
499 Ga0501034_0598384
500 Ga0501036_0017674
501 Ga0501036_0017989
502 Ga0501036_0171810
503 Ga0501036_1749808
504 Ga0501037_0092297
505 Ga0501037_0562671
506 Ga0501038_0000941
507 Ga0501038_0068363
508 Ga0501038_0239611
509 Ga0501038_1084334
510 Ga0501039_0023710
511 Ga0501039_0087147
512 Ga0501042_0006923
513 Ga0501043_0029449
514 Ga0501043_0107153
515 Ga0501043_0664657
516 Ga0501046_0004998
517 Ga0501046_0467815
518 Ga0501047_0036045
519 Ga0501047_0091367
520 Ga0501048_0009825
521 Ga0501048_0069591
522 Ga0501048_1153185
523 Ga0501070_0007592
524 Ga0501070_0380224
525 Ga0501070_0530786
526 Ga0501073_0179140
527 Ga0501074_0010471
528 Ga0501221_167835
529 Ga0501080_0357828
530 Ga0501035_0023182
531 Ga0501035_0058147
532 Ga0501035_0929282
533 Ga0501035_0963824
534 Ga0501035_1171384
535 Ga0501044_0000401
536 Ga0501044_0070091
537 Ga0501044_0128512
538 Ga0501044_0611055
539 Ga0501045_0134136
540 Ga0501045_0360890
541 nmdc:mga03n38_1542_c1
542 nmdc:mga0yw44_503276_c1
543 nmdc:mga06z11_3670_c1
544 nmdc:mga04h51_633_c1
545 nmdc:mga07m45_150983_c1
546 Ga0495612_0039482
547 Ga0495655_0043334
548 Ga0500644_0066915
549 Ga0500640_030713
550 Ga0500650_0124234
551 Ga0500553_028290
552 Ga0500558_111452
553 Ga0500560_004990
554 Ga0500572_033463
555 Ga0500614_104581
556 Ga0500573_0036712
557 Ga0500600_0215070
558 Ga0500634_0355993
559 Ga0500636_0254503
560 Ga0500565_008597
561 Ga0466962_0014686
562 Ga0466962_0114099
563 2547407992
564 2585308657
565 2585318770
566 2644264091
567 2644436978
568 2644628725
569 2784588445
570 2785369274
571 2786670412
572 2808841876
573 2808920411
574 2809232041
575 2812358381
576 2812480732
577 2852636878
578 2862285476
579 2862515219
580 2867430405
581 2877681277
582 2912720266
583 2919469680
584 2946067497
585 2946075749
586 2947229501
587 2954007681
588 2954676758
589 2954687408
590 2954697097
591 2954705039
592 2954726347
593 2954735463
594 2954745270
595 2954754318
596 2954764246
597 3006496234
598 8008579002
599 8023628860
600 8056833726

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04686

SsgA

Streptomyces sporulation and cell division protein, SsgA

26

116

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y38-assembly1.cif.gz_B crystal structure of c7orf59-hbxip complex 0.8185 67 95
6slc-assembly1.cif.gz_BBB mutations in ssgb correlate to longitudinal cell division during sporulation of streptomyces coelicolor 0.8065 2 112
7ux2-assembly1.cif.gz_G error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7905 67 95
6suj-assembly1.cif.gz_DDD mutations in ssgb correlate to longitudinal cell division during sporulation of streptomyces coelicolor 0.7871 1 109
3cm1-assembly1.cif.gz_B crystal structure of ssga-like sporulation-specific cell division protein (yp_290167.1) from thermobifida fusca yx-er1 at 2.60 a resolution 0.7767 3 114
ID Description Score Start End Superfamily
3frnA01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A; 0.8877 69 95 3.10.129.70
af_Q6IG91_7_107_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.8019 65 95 3.30.450.30
af_Q9VJ18_1_97_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7929 65 95 3.30.450.30
3cm1C00 Mainly Beta;Roll;Transcriptional Co-activator pc4; Chain A;Sporulation-specific cell division protein SsgB 0.7518 2 114 2.30.31.20
af_A4I7C2_7_115_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7494 65 95 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A6G2PUU3-F1-model_v4 SsgA family sporulation/cell division regulator 0.9731 49 111 GO:0000917
GO:0030428
GO:0030435
AF-A0A6B3FHX1-F1-model_v4 SsgA family sporulation/cell division regulator 0.9684 45 110 GO:0000917
GO:0030428
GO:0030435
AF-A0A160P015-F1-model_v4 Cell division protein 0.9644 2 115 GO:0000917
GO:0030428
GO:0030435
AF-A0A6B2T7H5-F1-model_v4 SsgA family sporulation/cell division regulator 0.9625 45 108 GO:0000917
GO:0030428
GO:0030435
AF-A0A022M9N1-F1-model_v4 Cell division protein 0.9624 1 110 GO:0000917
GO:0030428
GO:0030435

Map