F395300

General Info

Members Datasets Scaffolds Average Seq Length
300 233 273 408

Family's Representative Sequence

Representative Sequence 3300006195|Ga0075366_10021704|Ga0075366_100217042
Length 454
Sequence VAQLNSGSGAVPVCSRFTRRSGRLVATSMGVNRMSAQPVELIAAALFGAALLHTFTAKQLERLARRFPRHAGLLHLLGEVEVVFGFWAIVLILVMALTTGGPQALEYAESRNYAEPLFVFVVMVIAGSRPVLETVRGIVNLAVRLLPLPAPIAAAWLGLAAVPLLGSLITEPAAMTIAALMLAPLVFRPDLPEAPKYFALGVLFVNVSIGGTLTSYAAPPVLMVAATWNWDSAYMLSTFGWKAALAVLLNASVAAFVLRKHLAATPQPVEANVLLAPRVPLPIALVHLMLLIGVVLLAHHPVAFLGLFLLFLGFAQAYERYQDPLLIKEGLLVGFFLAGLVVLGGLQRWWLQPIVSALEPLALFFTALGLTAVTDNAALTYLGSLIAGMSTESKYMLVAGAVAGGGLTVIANAPNPAGLALLKRGFADESVGAGGLFLGALGPTVVAAVALLLL

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221594 Achromobacter sp. Root170 Isolate Unclassified
4 2643221609 Acidovorax sp. Root217 Isolate Unclassified
5 2643221611 Acidovorax sp. Root219 Isolate Unclassified
6 2643221638 Duganella sp. Root336D2 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 2643221664 Massilia sp. Root418 Isolate Unclassified
11 2738541297 Duganella sp. GV083 Isolate Unclassified
12 2738543012 Acidovorax sp. CF301 Isolate Unclassified
13 2738543018 Massilia sp. GV045 Isolate Unclassified
14 2738543030 Massilia sp. GV097 Isolate Unclassified
15 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
16 2816332133 Acidovorax radicis 2721A Isolate Unclassified
17 2842677519 Variovorax sp. R-72495 Isolate Unclassified
18 2842733646 Variovorax sp. R-72446 Isolate Unclassified
19 2842747753 Variovorax sp. R-72060 Isolate Unclassified
20 2855730933 Achromobacter sp. HZ28 Isolate Nodule
21 2855767633 Achromobacter sp. HZ34 Isolate Nodule
22 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
23 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
24 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
25 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
26 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
27 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
28 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
34 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
35 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
38 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
43 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
44 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
101 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
102 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
141 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
144 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
145 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
146 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
163 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
166 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
167 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
168 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
169 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
188 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
199 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
200 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
219 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
220 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
221 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
222 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
226 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
229 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
230 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
231 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
232 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
233 8048746797 Alcaligenes endophyticus DSM 100498 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91
Metatranscriptomes 0
Isolates 9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.67
Nodule 2.33
Rhizoplane 2
Rhizosphere 59.67
Stem 0
Stem Tuber 0
Unclassified 13.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10002922 3300001989 Bacteria 6551
2 JGI25155J39150_1000031 3300002704 Bacteria 106418
3 JGI25156J39149_1000040 3300002705 Bacteria 106617
4 JGI25154J39366_1000060 3300002738 Bacteria 106617
5 JGI25157J39369_1000058 3300002741 Bacteria 106617
6 JGI25152J39213_1000053 3300002773 Bacteria 77432
7 JGI25150J39212_1000482 3300002774 Bacteria 16876
8 JGI25159J45721_1006126 3300002987 Bacteria 3647
9 JGI25151J46595_10000670 3300003187 Bacteria 28986
10 rootH1_10004597 3300003323 Bacteria 17616
11 JGI25161J50226_1000290 3300003374 Bacteria 28301
12 Ga0055533_1000201 3300003756 Bacteria 47550
13 Ga0055526_1001726 3300003771 Bacteria 15207
14 Ga0055537_1000011 3300003773 Bacteria 137556
15 Ga0055524_1000287 3300003775 Bacteria 48964
16 Ga0055524_1000932 3300003775 Bacteria 18779
17 Ga0055534_1000020 3300003784 Bacteria 137562
18 Ga0055528_1001048 3300003790 Bacteria 18232
19 Ga0055530_10000764 3300003791 Bacteria 26787
20 Ga0055530_10001161 3300003791 Bacteria 20415
21 Ga0055530_10010841 3300003791 Bacteria 3326
22 Ga0055540_1000357 3300003792 Bacteria 38830
23 Ga0055540_1008062 3300003792 Bacteria 3850
24 Ga0055531_10001448 3300003794 Bacteria 17513
25 Ga0055531_10022283 3300003794 Bacteria 2419
26 Ga0055543_1000390 3300004625 Bacteria 28339
27 Ga0065165_1002110 3300005262 Bacteria 18178
28 Ga0065165_1026824 3300005262 Bacteria 1889
29 Ga0070670_100029438 3300005331 Bacteria 4728
30 Ga0070670_100176776 3300005331 Bacteria 1852
31 Ga0070680_100023229 3300005336 Bacteria 4944
32 Ga0070661_100000791 3300005344 Bacteria 22707
33 Ga0070669_100172101 3300005353 Bacteria 1689
34 Ga0070671_100033142 3300005355 Bacteria 4271
35 Ga0070673_100039450 3300005364 Bacteria 3614
36 Ga0070659_100000178 3300005366 Bacteria 48934
37 Ga0070667_100014259 3300005367 Bacteria 6563
38 Ga0070714_100022994 3300005435 Bacteria 5115
39 Ga0070700_100178128 3300005441 Bacteria 1477
40 Ga0070662_100001333 3300005457 Bacteria 15172
41 Ga0068867_100011351 3300005459 Bacteria 6285
42 Ga0068867_100031373 3300005459 Bacteria 3836
43 Ga0070679_100015742 3300005530 Bacteria 7274
44 Ga0070697_100109933 3300005536 Bacteria 2296
45 Ga0068853_100202961 3300005539 Bacteria 1805
46 Ga0070672_100017733 3300005543 Bacteria 5131
47 Ga0070672_100031011 3300005543 Bacteria 4021
48 Ga0070672_100033756 3300005543 Bacteria 3878
49 Ga0070672_100160220 3300005543 Bacteria 1866
50 Ga0070693_100062836 3300005547 Bacteria 2162
51 Ga0070664_100000524 3300005564 Bacteria 29185
52 Ga0068856_100238862 3300005614 Bacteria 1832
53 Ga0068852_100198063 3300005616 Bacteria 1899
54 Ga0068861_100003259 3300005719 Bacteria 10735
55 Ga0068863_100023696 3300005841 Bacteria 5857
56 Ga0068862_100036261 3300005844 Bacteria 4180
57 Ga0075363_100015091 3300006048 Bacteria 3789
58 Ga0075363_100057271 3300006048 Bacteria 2091
59 Ga0075364_10002289 3300006051 Bacteria 10733
60 Ga0075362_10076823 3300006177 Bacteria 1533
61 Ga0075367_10080987 3300006178 Bacteria 1964
62 Ga0075369_10019141 3300006186 Bacteria 2793
63 Ga0075366_10021704 3300006195 Bacteria 3733
64 Ga0075366_10024849 3300006195 Bacteria 3494
65 Ga0075370_10015862 3300006353 Bacteria 4043
66 Ga0075370_10061769 3300006353 Bacteria 2134
67 Ga0079104_1000019 3300006946 Bacteria 269313
68 Ga0099826_10000928 3300006948 Bacteria 16166
69 Ga0099826_10024815 3300006948 Bacteria 4450
70 Ga0111539_10075818 3300009094 Bacteria 3961
71 Ga0105243_10001150 3300009148 Bacteria 23986
72 Ga0105243_10226871 3300009148 Bacteria 1655
73 Ga0105243_10251486 3300009148 Bacteria 1578
74 Ga0105242_10000304 3300009176 Bacteria 39272
75 Ga0105248_10007772 3300009177 Bacteria 11767
76 Ga0105249_10121746 3300009553 Bacteria 2480
77 Ga0157373_10065318 3300013100 Bacteria 2575
78 Ga0157373_10092155 3300013100 Bacteria 2134
79 Ga0157371_10119601 3300013102 Bacteria 1872
80 Ga0157370_10013957 3300013104 Bacteria 8249
81 Ga0157378_10039841 3300013297 Bacteria 4167
82 Ga0163162_10008891 3300013306 Bacteria 9769
83 Ga0157375_10009599 3300013308 Bacteria 8501
84 Ga0157375_10111765 3300013308 Bacteria 2831
85 Ga0157375_10152539 3300013308 Bacteria 2447
86 Ga0182008_10000372 3300014497 Bacteria 34742
87 Ga0157379_10079097 3300014968 Bacteria 2944
88 Ga0157379_10172691 3300014968 Bacteria 1951
89 Ga0157376_10025058 3300014969 Bacteria 4694
90 Ga0163161_10067724 3300017792 Bacteria 2607
91 Ga0213872_10000394 3300021361 Bacteria 36299
92 Ga0209435_100019 3300025206 Bacteria 260989
93 Ga0209436_100342 3300025208 Bacteria 21095
94 Ga0209674_100017 3300025226 Bacteria 689087
95 Ga0207425_1000001 3300025245 Bacteria 2525432
96 Ga0209646_1000038 3300025246 Bacteria 353982
97 Ga0209026_1000048 3300025250 Bacteria 257264
98 Ga0209759_1000038 3300025256 Bacteria 257264
99 Ga0209129_1000001 3300025258 Bacteria 1452436
100 Ga0209565_1000058 3300025263 Bacteria 194126
101 Ga0209565_1001497 3300025263 Bacteria 10200
102 Ga0209673_1000053 3300025273 Bacteria 279449
103 Ga0209130_1000371 3300025284 Bacteria 50978
104 Ga0209675_1000010 3300025291 Bacteria 541927
105 Ga0209675_1001313 3300025291 Bacteria 14749
106 Ga0209676_1007911 3300025292 Bacteria 4871
107 Ga0209025_1000049 3300025294 Bacteria 333459
108 Ga0209025_1000055 3300025294 Bacteria 316748
109 Ga0209564_1000175 3300025295 Bacteria 153109
110 Ga0209564_1012281 3300025295 Bacteria 3748
111 Ga0209758_1000230 3300025297 Bacteria 119426
112 Ga0209050_1000339 3300025298 Bacteria 92915
113 Ga0209050_1000703 3300025298 Bacteria 49694
114 Ga0209256_1000024 3300025299 Bacteria 448909
115 Ga0209256_1001093 3300025299 Bacteria 31188
116 Ga0209256_1016509 3300025299 Bacteria 2511
117 Ga0209051_1000063 3300025303 Bacteria 249739
118 Ga0209051_1000272 3300025303 Bacteria 86518
119 Ga0209051_1017328 3300025303 Bacteria 3223
120 Ga0209051_1037965 3300025303 Bacteria 1759
121 Ga0209257_1000055 3300025304 Bacteria 415534
122 Ga0209257_1000118 3300025304 Bacteria 225963
123 Ga0207649_10002485 3300025920 Bacteria 10301
124 Ga0207652_10061226 3300025921 Bacteria 3250
125 Ga0207681_10014399 3300025923 Bacteria 4914
126 Ga0207650_10125151 3300025925 Bacteria 2006
127 Ga0207664_10060699 3300025929 Bacteria 3014
128 Ga0207644_10039199 3300025931 Bacteria 3343
129 Ga0207690_10000359 3300025932 Bacteria 30319
130 Ga0207706_10001163 3300025933 Bacteria 26674
131 Ga0207686_10001386 3300025934 Bacteria 13763
132 Ga0207709_10000211 3300025935 Bacteria 75562
133 Ga0207669_10103306 3300025937 Bacteria 1890
134 Ga0207691_10029433 3300025940 Bacteria 5138
135 Ga0207691_10034032 3300025940 Bacteria 4742
136 Ga0207691_10043878 3300025940 Bacteria 4119
137 Ga0207691_10190816 3300025940 Bacteria 1787
138 Ga0207711_10178140 3300025941 Bacteria 1932
139 Ga0207679_10000220 3300025945 Bacteria 45059
140 Ga0207651_10069695 3300025960 Bacteria 2484
141 Ga0207703_10187838 3300026035 Bacteria 1828
142 Ga0207639_10049614 3300026041 Bacteria 3183
143 Ga0207678_10121560 3300026067 Bacteria 2228
144 Ga0207708_10229050 3300026075 Bacteria 1491
145 Ga0207702_10098766 3300026078 Bacteria 2572
146 Ga0207702_10229461 3300026078 Bacteria 1734
147 Ga0207641_10018639 3300026088 Bacteria 5689
148 Ga0207648_10018384 3300026089 Bacteria 6332
149 Ga0207676_10154735 3300026095 Bacteria 1979
150 Ga0207675_100018927 3300026118 Bacteria 6428
151 Ga0207683_10163807 3300026121 Bacteria 2011
152 Ga0207698_10207516 3300026142 Bacteria 1760
153 Ga0207698_10210044 3300026142 Bacteria 1751
154 Ga0209281_1000149 3300027111 Bacteria 167880
155 Ga0209282_1000400 3300027666 Bacteria 21187
156 Ga0307515_10000020 3300028794 Bacteria 411735
157 Ga0307515_10000553 3300028794 Bacteria 88277
158 Ga0307515_10048280 3300028794 Bacteria 6440
159 Ga0316177_1078105 3300030731 Bacteria 3547
160 Ga0314311_1046748 3300030733 Bacteria 1806
161 Ga0316178_1162865 3300030735 Bacteria 2447
162 Ga0316181_1011952 3300030744 Bacteria 1975
163 Ga0265327_10000425 3300031251 Bacteria 77143
164 Ga0307408_100000087 3300031548 Bacteria 101616
165 Ga0307408_100002421 3300031548 Bacteria 13124
166 Ga0307408_100003631 3300031548 Bacteria 10516
167 Ga0307408_100119186 3300031548 Bacteria 2041
168 Ga0307514_10001949 3300031649 Bacteria 22562
169 Ga0307405_10004049 3300031731 Bacteria 6883
170 Ga0307405_10092277 3300031731 Bacteria 2008
171 Ga0307406_10000764 3300031901 Bacteria 18043
172 Ga0307406_10030831 3300031901 Bacteria 3260
173 Ga0307412_10009900 3300031911 Bacteria 5481
174 Ga0307412_10132778 3300031911 Bacteria 1811
175 Ga0307409_100000401 3300031995 Bacteria 18450
176 Ga0307416_100034832 3300032002 Bacteria 3837
177 Ga0307416_100194536 3300032002 Bacteria 1917
178 Ga0307411_10043118 3300032005 Bacteria 2885
179 Ga0373937_0014352 3300036401 Bacteria 6993
180 Ga0395899_0001612 3300037312 Bacteria 18854
181 Ga0395900_0017279 3300037418 Bacteria 7363
182 Ga0395900_0023380 3300037418 Bacteria 6327
183 Ga0395905_0006792 3300037471 Bacteria 11467
184 Ga0395905_0008204 3300037471 Bacteria 10315
185 Ga0395905_0055568 3300037471 Bacteria 3705
186 Ga0395905_0060639 3300037471 Bacteria 3537
187 Ga0395905_0138402 3300037471 Bacteria 2290
188 Ga0395905_0219094 3300037471 Bacteria 1781
189 Ga0395901_0034432 3300038443 Bacteria 5231
190 Ga0436361_0059018 3300039447 Bacteria 7988
191 Ga0436361_0580549 3300039447 Bacteria 3846
192 Ga0439436_0021711 3300041404 Bacteria 1905
193 Ga0439465_0016639 3300041413 Bacteria 2294
194 Ga0439432_015135 3300042006 Bacteria 2606
195 Ga0439449_0035414 3300042007 Bacteria 1858
196 Ga0439449_0038439 3300042007 Bacteria 1779
197 Ga0450911_000162 3300042115 Bacteria 26666
198 Ga0450919_001627 3300042121 Bacteria 2940
199 Ga0450919_001911 3300042121 Bacteria 2706
200 Ga0450890_002642 3300042127 Bacteria 2439
201 Ga0450898_002447 3300042134 Bacteria 2586
202 Ga0439434_0012239 3300042435 Bacteria 2539
203 Ga0450918_000003 3300042531 Bacteria 58967
204 Ga0466969_0000093 3300044656 Bacteria 46242
205 Ga0466969_0007175 3300044656 Bacteria 5928
206 Ga0466972_0078168 3300044658 Bacteria 1576
207 Ga0466966_0021793 3300044684 Bacteria 4206
208 Ga0466966_0023712 3300044684 Bacteria 4015
209 Ga0453684_0011131 3300044712 Bacteria 15174
210 Ga0453684_0089007 3300044712 Bacteria 3820
211 Ga0466970_0051575 3300044765 Bacteria 2196
212 Ga0466959_0003312 3300045049 Bacteria 10515
213 Ga0451576_0002280 3300045051 Bacteria 29279
214 Ga0451576_0114463 3300045051 Bacteria 2808
215 Ga0495617_001820 3300046452 Bacteria 9074
216 Ga0495617_025729 3300046452 Bacteria 1983
217 Ga0495592_0008831 3300046454 Bacteria 7570
218 Ga0495629_0108087 3300046459 Bacteria 1940
219 Ga0495653_0030149 3300046463 Bacteria 4323
220 Ga0495650_0064657 3300046471 Bacteria 1454
221 Ga0495664_0004710 3300046477 Bacteria 7461
222 Ga0495584_0001902 3300046491 Bacteria 12031
223 Ga0495585_0016761 3300046492 Bacteria 4244
224 Ga0495607_0012117 3300046501 Bacteria 5703
225 Ga0495606_0014188 3300046507 Bacteria 6236
226 Ga0495618_0011134 3300046514 Bacteria 5451
227 Ga0495652_0045045 3300046529 Bacteria 3796
228 Ga0495665_0005434 3300046531 Bacteria 6865
229 Ga0495640_0037964 3300046533 Bacteria 3393
230 Ga0495621_0016364 3300046539 Bacteria 2379
231 Ga0495597_0000190 3300046542 Bacteria 55842
232 Ga0495634_0015072 3300046642 Bacteria 5557
233 Ga0495625_0000329 3300046660 Bacteria 72358
234 Ga0495625_0134531 3300046660 Bacteria 1672
235 Ga0495623_0005656 3300046679 Bacteria 8159
236 Ga0495646_0004421 3300046680 Bacteria 8851
237 Ga0495658_0162487 3300046683 Bacteria 1378
238 Ga0495660_0000860 3300046810 Bacteria 22420
239 Ga0495581_0006214 3300047315 Bacteria 6928
240 Ga0495636_0001417 3300047318 Bacteria 9065
241 Ga0495676_0037710 3300047321 Bacteria 4019
242 Ga0495686_0000225 3300047472 Bacteria 104121
243 Ga0495593_0014322 3300047673 Bacteria 4508
244 Ga0495602_0091493 3300048088 Bacteria 2522
245 Ga0495614_0002846 3300048089 Bacteria 7701
246 Ga0496104_0100494 3300048907 Bacteria 2769
247 Ga0496108_0002972 3300048911 Bacteria 13625
248 Ga0496109_0055744 3300048912 Bacteria 3606
249 Ga0496114_0002147 3300048917 Bacteria 14999
250 Ga0496114_0043246 3300048917 Bacteria 3735
251 Ga0496122_0000238 3300048925 Bacteria 123588
252 Ga0496124_0178322 3300048927 Bacteria 1638
253 Ga0496125_0007022 3300048928 Bacteria 12047
254 Ga0496125_0015060 3300048928 Bacteria 7506
255 Ga0496125_0029381 3300048928 Bacteria 4940
256 Ga0501032_0006214 3300049569 Bacteria 8787
257 Ga0501034_0072836 3300049571 Bacteria 3444
258 Ga0501043_0002679 3300049579 Bacteria 14939
259 Ga0501073_0190665 3300049589 Bacteria 1419
260 Ga0501198_000078 3300049649 Bacteria 24049
261 Ga0501222_000069 3300049662 Bacteria 30020
262 Ga0501227_008686 3300049665 Bacteria 2179
263 Ga0501262_000046 3300049759 Bacteria 15811
264 Ga0501035_0240268 3300049822 Bacteria 1541
265 nmdc:mga03n38_17294_c1 3300050490 Bacteria 2821
266 nmdc:mga03n38_84030_c1 3300050490 Bacteria 1502
267 nmdc:mga0k408_19420_c1 3300050493 Bacteria 3799
268 nmdc:mga0k408_32841_c1 3300050493 Bacteria 2965
269 nmdc:mga0sz30_7183_c1 3300050516 Bacteria 3546
270 Ga0500651_0005431 3300053093 Bacteria 7279
271 Ga0500562_008165 3300053108 Bacteria 2641
272 Ga0500590_003525 3300053148 Bacteria 7235
273 Ga0500600_0023913 3300053149 Bacteria 3647

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0001612 Ga0395899_0001612_11555_12925 335
2 3300006048 Ga0075363_100015091 Ga0075363_1000150912 362
3 3300006051 Ga0075364_10002289 Ga0075364_100022899 362
4 3300006177 Ga0075362_10076823 Ga0075362_100768232 362
5 3300006195 Ga0075366_10024849 Ga0075366_100248492 362
6 3300005331 Ga0070670_100176776 Ga0070670_1001767763 364
7 3300005459 Ga0068867_100031373 Ga0068867_1000313732 364
8 3300005543 Ga0070672_100160220 Ga0070672_1001602201 364
9 3300025925 Ga0207650_10125151 Ga0207650_101251513 364
10 3300025940 Ga0207691_10190816 Ga0207691_101908163 364
11 3300026095 Ga0207676_10154735 Ga0207676_101547352 364
12 3300013102 Ga0157371_10119601 Ga0157371_101196012 366
13 3300026078 Ga0207702_10098766 Ga0207702_100987662 370
14 3300006946 Ga0079104_1000019 Ga0079104_1000019175 371
15 3300027111 Ga0209281_1000149 Ga0209281_1000149119 371
16 3300028794 Ga0307515_10048280 Ga0307515_100482803 372
17 3300048911 Ga0496108_0002972 Ga0496108_0002972_8315_9571 373
18 3300013308 Ga0157375_10152539 Ga0157375_101525392 374
19 3300048912 Ga0496109_0055744 Ga0496109_0055744_1877_3133 374
20 3300048917 Ga0496114_0002147 Ga0496114_0002147_1569_2825 374
21 3300003775 Ga0055524_1000287 Ga0055524_10002878 375
22 3300005262 Ga0065165_1026824 Ga0065165_10268242 375
23 3300006948 Ga0099826_10024815 Ga0099826_100248152 375
24 3300013100 Ga0157373_10092155 Ga0157373_100921552 375
25 3300025299 Ga0209256_1000024 Ga0209256_1000024149 375
26 3300006353 Ga0075370_10061769 Ga0075370_100617692 378
27 3300003323 rootH1_10004597 rootH1_1000459717 380
28 3300037471 Ga0395905_0055568 Ga0395905_0055568_406_1662 381
29 3300036401 Ga0373937_0014352 Ga0373937_0014352_2847_4118 383
30 3300053108 Ga0500562_008165 Ga0500562_008165_451_1707 385
31 3300005435 Ga0070714_100022994 Ga0070714_1000229943 387
32 3300013104 Ga0157370_10013957 Ga0157370_100139578 387
33 3300025929 Ga0207664_10060699 Ga0207664_100606992 387
34 3300003792 Ga0055540_1008062 Ga0055540_10080621 388
35 3300003794 Ga0055531_10001448 Ga0055531_1000144810 388
36 3300021361 Ga0213872_10000394 Ga0213872_1000039422 388
37 3300025303 Ga0209051_1000272 Ga0209051_100027250 388
38 3300025304 Ga0209257_1000055 Ga0209257_1000055349 388
39 3300039447 Ga0436361_0059018 Ga0436361_0059018_5846_7096 388
40 3300044656 Ga0466969_0007175 Ga0466969_0007175_171_1427 390
41 3300044684 Ga0466966_0021793 Ga0466966_0021793_447_1703 390
42 3300045049 Ga0466959_0003312 Ga0466959_0003312_921_2177 390
43 3300050490 nmdc:mga03n38_84030_c1 nmdc:mga03n38_84030_c1_180_1445 390
44 3300049589 Ga0501073_0190665 Ga0501073_0190665_30_1271 391
45 3300005344 Ga0070661_100000791 Ga0070661_10000079117 392
46 3300005366 Ga0070659_100000178 Ga0070659_1000001786 392
47 3300005367 Ga0070667_100014259 Ga0070667_1000142595 392
48 3300005539 Ga0068853_100202961 Ga0068853_1002029612 392
49 3300005543 Ga0070672_100017733 Ga0070672_1000177331 392
50 3300005564 Ga0070664_100000524 Ga0070664_10000052416 392
51 3300005616 Ga0068852_100198063 Ga0068852_1001980632 392
52 3300014968 Ga0157379_10172691 Ga0157379_101726912 392
53 3300025920 Ga0207649_10002485 Ga0207649_100024855 392
54 3300025932 Ga0207690_10000359 Ga0207690_100003596 392
55 3300025940 Ga0207691_10029433 Ga0207691_100294335 392
56 3300025941 Ga0207711_10178140 Ga0207711_101781402 392
57 3300025945 Ga0207679_10000220 Ga0207679_1000022029 392
58 3300026035 Ga0207703_10187838 Ga0207703_101878382 392
59 3300026041 Ga0207639_10049614 Ga0207639_100496142 392
60 3300026067 Ga0207678_10121560 Ga0207678_101215602 392
61 3300026142 Ga0207698_10207516 Ga0207698_102075162 392
62 3300002704 JGI25155J39150_1000031 JGI25155J39150_100003181 394
63 3300002705 JGI25156J39149_1000040 JGI25156J39149_100004036 394
64 3300002738 JGI25154J39366_1000060 JGI25154J39366_100006082 394
65 3300002741 JGI25157J39369_1000058 JGI25157J39369_100005882 394
66 3300025206 Ga0209435_100019 Ga0209435_10001982 394
67 3300025246 Ga0209646_1000038 Ga0209646_100003883 394
68 3300025250 Ga0209026_1000048 Ga0209026_100004882 394
69 3300025256 Ga0209759_1000038 Ga0209759_1000038162 394
70 3300049569 Ga0501032_0006214 Ga0501032_0006214_6097_7353 394
71 3300049822 Ga0501035_0240268 Ga0501035_0240268_320_1531 398
72 3300005331 Ga0070670_100029438 Ga0070670_1000294382 399
73 3300003756 Ga0055533_1000201 Ga0055533_100020151 400
74 3300025226 Ga0209674_100017 Ga0209674_100017566 400
75 3300046454 Ga0495592_0008831 Ga0495592_0008831_5571_6833 400
76 3300046459 Ga0495629_0108087 Ga0495629_0108087_35_1297 400
77 3300046463 Ga0495653_0030149 Ga0495653_0030149_1179_2441 400
78 3300046477 Ga0495664_0004710 Ga0495664_0004710_764_2026 400
79 3300046514 Ga0495618_0011134 Ga0495618_0011134_229_1491 400
80 3300046529 Ga0495652_0045045 Ga0495652_0045045_1779_3041 400
81 3300046531 Ga0495665_0005434 Ga0495665_0005434_5568_6830 400
82 3300046533 Ga0495640_0037964 Ga0495640_0037964_557_1819 400
83 3300046642 Ga0495634_0015072 Ga0495634_0015072_2722_3984 400
84 3300046679 Ga0495623_0005656 Ga0495623_0005656_6620_7882 400
85 3300046680 Ga0495646_0004421 Ga0495646_0004421_6620_7882 400
86 3300047315 Ga0495581_0006214 Ga0495581_0006214_4499_5761 400
87 3300047321 Ga0495676_0037710 Ga0495676_0037710_1461_2723 400
88 3300047673 Ga0495593_0014322 Ga0495593_0014322_289_1551 400
89 3300048088 Ga0495602_0091493 Ga0495602_0091493_544_1806 400
90 3300048089 Ga0495614_0002846 Ga0495614_0002846_5223_6485 400
91 3300037471 Ga0395905_0138402 Ga0395905_0138402_547_1827 401
92 3300044712 Ga0453684_0011131 Ga0453684_0011131_11763_13034 401
93 3300046660 Ga0495625_0000329 Ga0495625_0000329_13259_14521 401
94 3300048927 Ga0496124_0178322 Ga0496124_0178322_269_1540 401
95 3300002773 JGI25152J39213_1000053 JGI25152J39213_100005317 402
96 3300002774 JGI25150J39212_1000482 JGI25150J39212_100048211 402
97 3300003775 Ga0055524_1000932 Ga0055524_10009326 402
98 3300005547 Ga0070693_100062836 Ga0070693_1000628361 402
99 3300025245 Ga0207425_1000001 Ga0207425_10000011940 402
100 3300025258 Ga0209129_1000001 Ga0209129_10000011117 402
101 3300025297 Ga0209758_1000230 Ga0209758_100023099 402
102 3300025299 Ga0209256_1001093 Ga0209256_10010936 402
103 3300025303 Ga0209051_1017328 Ga0209051_10173283 402
104 3300006178 Ga0075367_10080987 Ga0075367_100809872 404
105 3300042127 Ga0450890_002642 Ga0450890_002642_38_1252 404
106 3300049579 Ga0501043_0002679 Ga0501043_0002679_333_1586 404
107 3300053093 Ga0500651_0005431 Ga0500651_0005431_2021_3283 404
108 iso_pu_bacteria 2643221638 2644213906 404
109 3300005355 Ga0070671_100033142 Ga0070671_1000331422 405
110 3300005364 Ga0070673_100039450 Ga0070673_1000394503 405
111 3300005543 Ga0070672_100033756 Ga0070672_1000337563 405
112 3300005841 Ga0068863_100023696 Ga0068863_1000236964 405
113 3300009177 Ga0105248_10007772 Ga0105248_100077727 405
114 3300013308 Ga0157375_10009599 Ga0157375_100095996 405
115 3300025937 Ga0207669_10103306 Ga0207669_101033062 405
116 3300025940 Ga0207691_10034032 Ga0207691_100340322 405
117 3300025960 Ga0207651_10069695 Ga0207651_100696952 405
118 3300026088 Ga0207641_10018639 Ga0207641_100186394 405
119 3300026121 Ga0207683_10163807 Ga0207683_101638072 405
120 3300030731 Ga0316177_1078105 Ga0316177_10781052 405
121 3300030733 Ga0314311_1046748 Ga0314311_10467481 405
122 3300030735 Ga0316178_1162865 Ga0316178_11628652 405
123 3300030744 Ga0316181_1011952 Ga0316181_10119522 405
124 3300031731 Ga0307405_10092277 Ga0307405_100922772 405
125 3300046683 Ga0495658_0162487 Ga0495658_0162487_141_1367 405
126 iso_pu_bacteria 2643221554 2643789095 405
127 3300031911 Ga0307412_10009900 Ga0307412_100099005 406
128 3300046507 Ga0495606_0014188 Ga0495606_0014188_2727_3980 406
129 3300009094 Ga0111539_10075818 Ga0111539_100758183 407
130 3300045051 Ga0451576_0114463 Ga0451576_0114463_809_2056 407
131 3300049665 Ga0501227_008686 Ga0501227_008686_635_1870 407
132 3300002987 JGI25159J45721_1006126 JGI25159J45721_10061263 408
133 3300003374 JGI25161J50226_1000290 JGI25161J50226_100029012 408
134 3300003771 Ga0055526_1001726 Ga0055526_10017268 408
135 3300003773 Ga0055537_1000011 Ga0055537_100001143 408
136 3300003784 Ga0055534_1000020 Ga0055534_100002092 408
137 3300003790 Ga0055528_1001048 Ga0055528_10010485 408
138 3300003791 Ga0055530_10010841 Ga0055530_100108413 408
139 3300004625 Ga0055543_1000390 Ga0055543_100039018 408
140 3300005262 Ga0065165_1002110 Ga0065165_10021103 408
141 3300006948 Ga0099826_10000928 Ga0099826_1000092810 408
142 3300025208 Ga0209436_100342 Ga0209436_1003425 408
143 3300025263 Ga0209565_1000058 Ga0209565_1000058131 408
144 3300025263 Ga0209565_1001497 Ga0209565_10014979 408
145 3300025273 Ga0209673_1000053 Ga0209673_1000053207 408
146 3300025284 Ga0209130_1000371 Ga0209130_100037137 408
147 3300025291 Ga0209675_1000010 Ga0209675_1000010488 408
148 3300025291 Ga0209675_1001313 Ga0209675_10013139 408
149 3300025295 Ga0209564_1000175 Ga0209564_100017526 408
150 3300025295 Ga0209564_1012281 Ga0209564_10122815 408
151 3300025298 Ga0209050_1000339 Ga0209050_100033940 408
152 3300025299 Ga0209256_1016509 Ga0209256_10165091 408
153 3300027666 Ga0209282_1000400 Ga0209282_10004005 408
154 3300028794 Ga0307515_10000553 Ga0307515_1000055329 408
155 3300031548 Ga0307408_100003631 Ga0307408_1000036315 408
156 3300031649 Ga0307514_10001949 Ga0307514_100019498 408
157 iso_pu_bacteria 2881412998 2881417506 408
158 3300005614 Ga0068856_100238862 Ga0068856_1002388621 409
159 3300006048 Ga0075363_100057271 Ga0075363_1000572712 409
160 3300006353 Ga0075370_10015862 Ga0075370_100158622 409
161 3300013100 Ga0157373_10065318 Ga0157373_100653181 409
162 3300026078 Ga0207702_10229461 Ga0207702_102294611 409
163 3300026142 Ga0207698_10210044 Ga0207698_102100442 409
164 3300050490 nmdc:mga03n38_17294_c1 nmdc:mga03n38_17294_c1_797_2056 409
165 3300050493 nmdc:mga0k408_32841_c1 nmdc:mga0k408_32841_c1_383_1645 409
166 iso_pu_bacteria 2643221645 2644254024 410
167 iso_pu_bacteria 2643221664 2644356794 410
168 3300005353 Ga0070669_100172101 Ga0070669_1001721011 411
169 3300005441 Ga0070700_100178128 Ga0070700_1001781281 411
170 3300005459 Ga0068867_100011351 Ga0068867_1000113514 411
171 3300005543 Ga0070672_100031011 Ga0070672_1000310112 411
172 3300005719 Ga0068861_100003259 Ga0068861_1000032596 411
173 3300005844 Ga0068862_100036261 Ga0068862_1000362612 411
174 3300009148 Ga0105243_10226871 Ga0105243_102268711 411
175 3300009148 Ga0105243_10251486 Ga0105243_102514862 411
176 3300009553 Ga0105249_10121746 Ga0105249_101217462 411
177 3300013297 Ga0157378_10039841 Ga0157378_100398412 411
178 3300013306 Ga0163162_10008891 Ga0163162_100088917 411
179 3300013308 Ga0157375_10111765 Ga0157375_101117651 411
180 3300014968 Ga0157379_10079097 Ga0157379_100790972 411
181 3300017792 Ga0163161_10067724 Ga0163161_100677242 411
182 3300025923 Ga0207681_10014399 Ga0207681_100143992 411
183 3300025940 Ga0207691_10043878 Ga0207691_100438782 411
184 3300026075 Ga0207708_10229050 Ga0207708_102290501 411
185 3300026089 Ga0207648_10018384 Ga0207648_100183844 411
186 3300026118 Ga0207675_100018927 Ga0207675_1000189273 411
187 3300046452 Ga0495617_001820 Ga0495617_001820_5431_6672 411
188 3300046452 Ga0495617_025729 Ga0495617_025729_27_1268 411
189 3300046491 Ga0495584_0001902 Ga0495584_0001902_3701_4942 411
190 3300046492 Ga0495585_0016761 Ga0495585_0016761_736_1977 411
191 3300046501 Ga0495607_0012117 Ga0495607_0012117_2609_3850 411
192 3300046539 Ga0495621_0016364 Ga0495621_0016364_853_2112 411
193 3300049759 Ga0501262_000046 Ga0501262_000046_14389_15642 411
194 iso_pu_bacteria 2643221644 2644243261 411
195 iso_pu_bacteria 2855730933 2855736722 411
196 iso_pu_bacteria 2855767633 2855773659 411
197 3300003187 JGI25151J46595_10000670 JGI25151J46595_100006702 412
198 3300025294 Ga0209025_1000055 Ga0209025_100005542 412
199 3300042134 Ga0450898_002447 Ga0450898_002447_17_1288 412
200 iso_pu_bacteria 2738543018 2739277051 412
201 iso_pu_bacteria 2738543030 2739346008 412
202 iso_pu_bacteria 642555113 642623295 412
203 3300049571 Ga0501034_0072836 Ga0501034_0072836_1236_2519 413
204 iso_pu_bacteria 2599185292 2599902057 413
205 iso_pu_bacteria 2842677519 2842679458 413
206 iso_pu_bacteria 8002392321 8002396000 413
207 3300039447 Ga0436361_0580549 Ga0436361_0580549_1040_2290 414
208 3300044656 Ga0466969_0000093 Ga0466969_0000093_27998_29248 414
209 3300044684 Ga0466966_0023712 Ga0466966_0023712_175_1425 414
210 3300044765 Ga0466970_0051575 Ga0466970_0051575_206_1456 414
211 3300046810 Ga0495660_0000860 Ga0495660_0000860_17775_19025 414
212 iso_pu_bacteria 2643221609 2644058719 414
213 iso_pu_bacteria 2643221611 2644072081 414
214 iso_pu_bacteria 2738543012 2739245276 414
215 iso_pu_bacteria 2816332133 2816471605 414
216 iso_pu_bacteria 8048746797 8048747522 414
217 3300005536 Ga0070697_100109933 Ga0070697_1001099331 415
218 3300014969 Ga0157376_10025058 Ga0157376_100250583 415
219 3300025292 Ga0209676_1007911 Ga0209676_10079114 415
220 3300037418 Ga0395900_0023380 Ga0395900_0023380_857_2113 415
221 3300038443 Ga0395901_0034432 Ga0395901_0034432_740_1996 415
222 3300042007 Ga0439449_0035414 Ga0439449_0035414_394_1647 415
223 3300042121 Ga0450919_001911 Ga0450919_001911_1236_2489 415
224 3300042435 Ga0439434_0012239 Ga0439434_0012239_982_2235 415
225 3300042531 Ga0450918_000003 Ga0450918_000003_3858_5111 415
226 3300048917 Ga0496114_0043246 Ga0496114_0043246_898_2154 415
227 iso_pu_bacteria 2842733646 2842738068 415
228 iso_pu_bacteria 2842747753 2842749297 415
229 iso_pu_bacteria 2939631187 2939635012 415
230 3300003791 Ga0055530_10000764 Ga0055530_100007649 416
231 3300003791 Ga0055530_10001161 Ga0055530_100011616 416
232 3300003792 Ga0055540_1000357 Ga0055540_100035718 416
233 3300003794 Ga0055531_10022283 Ga0055531_100222833 416
234 3300009176 Ga0105242_10000304 Ga0105242_1000030433 416
235 3300025298 Ga0209050_1000703 Ga0209050_100070321 416
236 3300025303 Ga0209051_1000063 Ga0209051_100006394 416
237 3300025304 Ga0209257_1000118 Ga0209257_1000118113 416
238 3300025934 Ga0207686_10001386 Ga0207686_100013865 416
239 3300048907 Ga0496104_0100494 Ga0496104_0100494_787_2043 416
240 3300053149 Ga0500600_0023913 Ga0500600_0023913_1104_2369 416
241 3300025303 Ga0209051_1037965 Ga0209051_10379652 417
242 3300028794 Ga0307515_10000020 Ga0307515_10000020307 417
243 3300037418 Ga0395900_0017279 Ga0395900_0017279_1308_2567 417
244 3300046471 Ga0495650_0064657 Ga0495650_0064657_157_1428 417
245 3300047318 Ga0495636_0001417 Ga0495636_0001417_3167_4423 417
246 3300047472 Ga0495686_0000225 Ga0495686_0000225_31108_32382 417
247 iso_pu_bacteria 2643221644 2644248589 417
248 iso_pu_bacteria 2738541297 2738824959 417
249 3300005457 Ga0070662_100001333 Ga0070662_1000013334 418
250 3300009148 Ga0105243_10001150 Ga0105243_1000115011 418
251 3300025931 Ga0207644_10039199 Ga0207644_100391994 418
252 3300025933 Ga0207706_10001163 Ga0207706_100011635 418
253 3300025935 Ga0207709_10000211 Ga0207709_1000021164 418
254 3300031251 Ga0265327_10000425 Ga0265327_1000042536 418
255 3300031548 Ga0307408_100000087 Ga0307408_10000008743 418
256 3300053148 Ga0500590_003525 Ga0500590_003525_927_2243 418
257 iso_pu_bacteria 2643221594 2643978291 418
258 iso_pu_bacteria 2643221660 2644338473 418
259 iso_pu_bacteria 2808606395 2809031396 418
260 3300001989 JGI24739J22299_10002922 JGI24739J22299_100029225 419
261 3300005336 Ga0070680_100023229 Ga0070680_1000232295 419
262 3300005530 Ga0070679_100015742 Ga0070679_1000157421 419
263 3300006186 Ga0075369_10019141 Ga0075369_100191411 419
264 3300006195 Ga0075366_10021704 Ga0075366_100217042 419
265 3300014497 Ga0182008_10000372 Ga0182008_1000037235 419
266 3300025294 Ga0209025_1000049 Ga0209025_1000049146 419
267 3300025921 Ga0207652_10061226 Ga0207652_100612262 419
268 3300031548 Ga0307408_100002421 Ga0307408_1000024212 419
269 3300031548 Ga0307408_100119186 Ga0307408_1001191862 419
270 3300031731 Ga0307405_10004049 Ga0307405_100040497 419
271 3300031901 Ga0307406_10000764 Ga0307406_100007649 419
272 3300031901 Ga0307406_10030831 Ga0307406_100308312 419
273 3300031911 Ga0307412_10132778 Ga0307412_101327782 419
274 3300031995 Ga0307409_100000401 Ga0307409_10000040117 419
275 3300032002 Ga0307416_100034832 Ga0307416_1000348322 419
276 3300032002 Ga0307416_100194536 Ga0307416_1001945361 419
277 3300032005 Ga0307411_10043118 Ga0307411_100431184 419
278 3300037471 Ga0395905_0006792 Ga0395905_0006792_6080_7354 419
279 3300037471 Ga0395905_0008204 Ga0395905_0008204_5460_6725 419
280 3300037471 Ga0395905_0060639 Ga0395905_0060639_2110_3387 419
281 3300037471 Ga0395905_0219094 Ga0395905_0219094_360_1646 419
282 3300041404 Ga0439436_0021711 Ga0439436_0021711_614_1873 419
283 3300041413 Ga0439465_0016639 Ga0439465_0016639_295_1554 419
284 3300042006 Ga0439432_015135 Ga0439432_015135_468_1730 419
285 3300042007 Ga0439449_0038439 Ga0439449_0038439_35_1297 419
286 3300042115 Ga0450911_000162 Ga0450911_000162_21139_22401 419
287 3300042121 Ga0450919_001627 Ga0450919_001627_1394_2662 419
288 3300044658 Ga0466972_0078168 Ga0466972_0078168_146_1408 419
289 3300044712 Ga0453684_0089007 Ga0453684_0089007_1365_2636 419
290 3300045051 Ga0451576_0002280 Ga0451576_0002280_11914_13185 419
291 3300046542 Ga0495597_0000190 Ga0495597_0000190_18735_19997 419
292 3300046660 Ga0495625_0134531 Ga0495625_0134531_138_1418 419
293 3300048925 Ga0496122_0000238 Ga0496122_0000238_98242_99504 419
294 3300048928 Ga0496125_0007022 Ga0496125_0007022_617_1879 419
295 3300048928 Ga0496125_0015060 Ga0496125_0015060_2838_4100 419
296 3300048928 Ga0496125_0029381 Ga0496125_0029381_2079_3341 419
297 3300049649 Ga0501198_000078 Ga0501198_000078_9485_10744 419
298 3300049662 Ga0501222_000069 Ga0501222_000069_15542_16801 419
299 3300050493 nmdc:mga0k408_19420_c1 nmdc:mga0k408_19420_c1_1637_2917 419
300 3300050516 nmdc:mga0sz30_7183_c1 nmdc:mga0sz30_7183_c1_768_2048 419

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07399

Na_H_antiport_3

Putative Na+/H+ antiporter

38

454

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uld-assembly2.cif.gz_C structure and function of the divalent anion/na+ symporter from vibrio cholerae and a humanized variant 0.5985 10 417
5uld-assembly2.cif.gz_C structure and function of the divalent anion/na+ symporter from vibrio cholerae and a humanized variant 0.5859 10 417
6ol0-assembly2.cif.gz_B structure of vcindy bound to malate 0.5711 15 416
7qha-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.5568 52 418
6ol0-assembly2.cif.gz_B structure of vcindy bound to malate 0.5522 15 416
ID Description Score Start End Superfamily
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6757 15 417 1.20.1530.20
af_I6YCG9_3_406_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.6673 15 417 1.20.1530.20
af_Q6P0S3_121_241_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.3306 308 416 1.20.58.390
af_Q2FW83_8_253_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3272 48 321 1.20.1250.20
af_Q2FW83_8_253_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.309 48 321 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4R8KWH5-F1-model_v4 Putative Na+/H+ antiporter 0.9473 5 418 GO:0016020
AF-A0A258W7F4-F1-model_v4 Na+/H+ antiporter 0.9466 5 418 GO:0016020
AF-A0A0M7KSC1-F1-model_v4 Protein of uncharacterized function (DUF1504) 0.9384 143 418 GO:0016020
AF-A0A3D0W6X4-F1-model_v4 Sodium:proton antiporter 0.9377 2 416 GO:0016020
AF-A0A2W5QCX8-F1-model_v4 Na+/H+ antiporter 0.9372 35 409 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.68 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map