F395244

General Info

Members Datasets Scaffolds Average Seq Length
300 168 600 171

Family's Representative Sequence

Representative Sequence 3300005457|Ga0070662_100948969|Ga0070662_1009489691
Length 209
Sequence VPPGRWVNLVVPSGRAEFHYGLIERDCKRGAAFRYSGRMTAAERPEAWLRGPVDGFEPLLMPVVHALVQVQEDLAGLLGSVPDEQVWLRPGGAASIGFHVRHTGGALDRLFTYARGESLSPAQKAFLQNEGVAGDPAATLQDLTAQTFDTVQRALDQLRGTSAAMLLEPRRVGRAGLPATVIGLLFHAAEHSTRHAGQAITTARILRGG

Samples

Sample ID Description Type Environment
1 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
129 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
132 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
133 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
134 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
138 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
161 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
162 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
163 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
164 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
165 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
166 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.33
Rhizosphere 98.67
Stem 0
Stem Tuber 0
Unclassified 16.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070662_100948969 3300005457 Unclassified 735
2 MBSR1b_contig_10201530 2162886012 Unclassified 994
3 JGI24735J21928_10019229 3300002067 Bacteria 2101
4 JGI25406J46586_10019839 3300003203 Bacteria 2731
5 Ga0058860_10534129 3300004801 Unclassified 692
6 Ga0065715_10003112 3300005293 Unclassified 4249
7 Ga0065715_10010571 3300005293 Bacteria 3690
8 Ga0065707_10205592 3300005295 Unclassified 1290
9 Ga0070676_10003865 3300005328 Bacteria 7868
10 Ga0070676_10058391 3300005328 Bacteria 2286
11 Ga0070676_10112249 3300005328 Bacteria 1699
12 Ga0070690_100015943 3300005330 Unclassified 4491
13 Ga0070690_100056150 3300005330 Bacteria 2524
14 Ga0070690_100407320 3300005330 Bacteria 1000
15 Ga0070670_100239447 3300005331 Bacteria 1580
16 Ga0070670_100360135 3300005331 Bacteria 1279
17 Ga0070677_10004861 3300005333 Bacteria 4411
18 Ga0070677_10007586 3300005333 Bacteria 3626
19 Ga0070677_10194627 3300005333 Bacteria 974
20 Ga0068869_100053017 3300005334 Unclassified 2947
21 Ga0068869_100169992 3300005334 Bacteria 1702
22 Ga0068869_100172771 3300005334 Unclassified 1689
23 Ga0070666_10050073 3300005335 Bacteria 2809
24 Ga0070666_10185936 3300005335 Bacteria 1459
25 Ga0068868_100036779 3300005338 Bacteria 3792
26 Ga0070660_100612218 3300005339 Bacteria 911
27 Ga0070689_100046306 3300005340 Bacteria 3351
28 Ga0070687_100004401 3300005343 Bacteria 5611
29 Ga0070661_100004936 3300005344 Bacteria 9184
30 Ga0070692_10377037 3300005345 Bacteria 889
31 Ga0070669_100007924 3300005353 Bacteria 7590
32 Ga0070669_100068714 3300005353 Bacteria 2616
33 Ga0070669_100294564 3300005353 Bacteria 1304
34 Ga0070675_100027103 3300005354 Bacteria 4602
35 Ga0070675_100151716 3300005354 Bacteria 1987
36 Ga0070675_100353155 3300005354 Bacteria 1304
37 Ga0070674_100018029 3300005356 Bacteria 4454
38 Ga0070674_100023049 3300005356 Bacteria 4023
39 Ga0070674_100315464 3300005356 Bacteria 1251
40 Ga0070673_100445254 3300005364 Bacteria 1164
41 Ga0070688_100007655 3300005365 Bacteria 5833
42 Ga0070659_100268893 3300005366 Bacteria 1416
43 Ga0070659_100367804 3300005366 Bacteria 1209
44 Ga0070667_100027615 3300005367 Bacteria 4722
45 Ga0070705_100463928 3300005440 Bacteria 953
46 Ga0070700_100114527 3300005441 Bacteria 1798
47 Ga0070678_100066049 3300005456 Bacteria 2688
48 Ga0070678_100171230 3300005456 Bacteria 1769
49 Ga0070678_100182492 3300005456 Bacteria 1719
50 Ga0070662_100013937 3300005457 Bacteria 5356
51 Ga0070662_100172229 3300005457 Bacteria 1700
52 Ga0068867_100004670 3300005459 Bacteria 9638
53 Ga0068867_100467923 3300005459 Bacteria 1077
54 Ga0070685_10035252 3300005466 Bacteria 2822
55 Ga0070685_10335524 3300005466 Bacteria 1029
56 Ga0070699_100013997 3300005518 Bacteria 6901
57 Ga0068853_100219924 3300005539 Bacteria 1734
58 Ga0070672_100180628 3300005543 Bacteria 1758
59 Ga0070672_100227322 3300005543 Bacteria 1566
60 Ga0070672_101588797 3300005543 Bacteria 587
61 Ga0070686_100120354 3300005544 Bacteria 1801
62 Ga0070665_100045696 3300005548 Bacteria 4398
63 Ga0070664_100011260 3300005564 Bacteria 7255
64 Ga0070664_100318520 3300005564 Bacteria 1409
65 Ga0068857_101161251 3300005577 Bacteria 747
66 Ga0068854_100078511 3300005578 Unclassified 2432
67 Ga0070702_100701455 3300005615 Bacteria 771
68 Ga0068859_100004504 3300005617 Bacteria 14217
69 Ga0068859_100080826 3300005617 Bacteria 3292
70 Ga0068859_100450517 3300005617 Unclassified 1383
71 Ga0068859_101615366 3300005617 Unclassified 716
72 Ga0068864_100115075 3300005618 Bacteria 2399
73 Ga0068866_10062937 3300005718 Bacteria 1932
74 Ga0068861_100135866 3300005719 Bacteria 2001
75 Ga0068861_100346511 3300005719 Bacteria 1301
76 Ga0068870_10004211 3300005840 Bacteria 6180
77 Ga0068870_10113864 3300005840 Bacteria 1548
78 Ga0068870_10143322 3300005840 Unclassified 1400
79 Ga0068870_10594289 3300005840 Bacteria 751
80 Ga0068863_100005508 3300005841 Bacteria 12451
81 Ga0068858_100579346 3300005842 Bacteria 1087
82 Ga0068860_100065445 3300005843 Bacteria 3452
83 Ga0068862_100002381 3300005844 Bacteria 16728
84 Ga0068862_100015884 3300005844 Bacteria 6257
85 Ga0081539_10000190 3300005985 Bacteria 142511
86 Ga0081539_10136886 3300005985 Unclassified 1195
87 Ga0068871_100038465 3300006358 Bacteria 3822
88 Ga0068871_100974223 3300006358 Bacteria 789
89 Ga0068871_101690632 3300006358 Bacteria 600
90 Ga0075428_100015826 3300006844 Bacteria 8350
91 Ga0075428_100403372 3300006844 Bacteria 1465
92 Ga0075430_100003935 3300006846 Bacteria 12531
93 Ga0075430_100005720 3300006846 Bacteria 10487
94 Ga0075430_100118254 3300006846 Unclassified 2209
95 Ga0075430_100133571 3300006846 Unclassified 2068
96 Ga0075430_100820927 3300006846 Bacteria 766
97 Ga0075431_100000921 3300006847 Bacteria 25923
98 Ga0075431_100238675 3300006847 Bacteria 1850
99 Ga0075433_10000581 3300006852 Bacteria 24193
100 Ga0075433_10000829 3300006852 Bacteria 21615
101 Ga0075433_10126892 3300006852 Bacteria 2266
102 Ga0075434_100006555 3300006871 Bacteria 10676
103 Ga0075434_100318854 3300006871 Bacteria 1575
104 Ga0075429_100013524 3300006880 Bacteria 7081
105 Ga0075429_100017215 3300006880 Bacteria 6251
106 Ga0075429_100036510 3300006880 Bacteria 4274
107 Ga0075429_100135941 3300006880 Bacteria 2151
108 Ga0075429_100473625 3300006880 Bacteria 1097
109 Ga0075429_100753180 3300006880 Bacteria 853
110 Ga0068865_100146692 3300006881 Bacteria 1785
111 Ga0097620_100004504 3300006931 Bacteria 14217
112 Ga0097620_100080826 3300006931 Bacteria 3292
113 Ga0097620_100450453 3300006931 Unclassified 1383
114 Ga0097620_101615347 3300006931 Unclassified 716
115 Ga0075435_100010755 3300007076 Bacteria 6702
116 Ga0105240_10730745 3300009093 Unclassified 1078
117 Ga0111539_10000958 3300009094 Bacteria 37856
118 Ga0111539_10009650 3300009094 Bacteria 12183
119 Ga0111539_10020591 3300009094 Bacteria 8123
120 Ga0111539_10438389 3300009094 Bacteria 1521
121 Ga0114129_10029926 3300009147 Bacteria 7711
122 Ga0114129_10065696 3300009147 Bacteria 5062
123 Ga0114129_11128813 3300009147 Unclassified 980
124 Ga0105243_11301189 3300009148 Bacteria 744
125 Ga0105249_10008919 3300009553 Bacteria 8760
126 Ga0105249_10780478 3300009553 Bacteria 1019
127 Ga0105249_10790653 3300009553 Bacteria 1012
128 Ga0105249_11921442 3300009553 Unclassified 664
129 Ga0105239_10000036 3300010375 Bacteria 212090
130 Ga0157371_10007802 3300013102 Bacteria 8600
131 Ga0157370_10087416 3300013104 Bacteria 2928
132 Ga0157369_10445188 3300013105 Bacteria 1342
133 Ga0163162_10013757 3300013306 Bacteria 7902
134 Ga0163162_11322428 3300013306 Unclassified 819
135 Ga0157372_11658848 3300013307 Bacteria 736
136 Ga0157375_12223292 3300013308 Unclassified 653
137 Ga0163163_10157588 3300014325 Bacteria 2315
138 Ga0157380_10019011 3300014326 Bacteria 5113
139 Ga0157380_10027139 3300014326 Bacteria 4352
140 Ga0157380_10143262 3300014326 Bacteria 2056
141 Ga0157380_11647717 3300014326 Unclassified 698
142 Ga0157377_10435529 3300014745 Bacteria 901
143 Ga0157376_10093843 3300014969 Bacteria 2606
144 Ga0163161_10047300 3300017792 Bacteria 3107
145 Ga0163161_10231296 3300017792 Bacteria 1435
146 Ga0207697_10000739 3300025315 Bacteria 18490
147 Ga0207682_10006121 3300025893 Bacteria 4862
148 Ga0207682_10045333 3300025893 Bacteria 1804
149 Ga0207682_10150775 3300025893 Bacteria 1048
150 Ga0207642_10051447 3300025899 Bacteria 1864
151 Ga0207688_10000747 3300025901 Bacteria 16149
152 Ga0207680_10037379 3300025903 Bacteria 2802
153 Ga0207645_10001797 3300025907 Bacteria 17315
154 Ga0207645_10068337 3300025907 Bacteria 2272
155 Ga0207645_10424577 3300025907 Bacteria 896
156 Ga0207643_10022047 3300025908 Bacteria 3505
157 Ga0207662_10012003 3300025918 Bacteria 4818
158 Ga0207681_10030122 3300025923 Unclassified 3534
159 Ga0207681_10407548 3300025923 Bacteria 1099
160 Ga0207681_10736473 3300025923 Bacteria 821
161 Ga0207650_10080724 3300025925 Bacteria 2466
162 Ga0207650_10729246 3300025925 Bacteria 838
163 Ga0207659_10016919 3300025926 Unclassified 4755
164 Ga0207659_10026973 3300025926 Bacteria 3883
165 Ga0207659_10269520 3300025926 Bacteria 1388
166 Ga0207690_10400897 3300025932 Bacteria 1094
167 Ga0207706_10004451 3300025933 Bacteria 13166
168 Ga0207706_10009200 3300025933 Bacteria 9077
169 Ga0207706_10141361 3300025933 Bacteria 2118
170 Ga0207706_10597972 3300025933 Unclassified 948
171 Ga0207670_10076484 3300025936 Bacteria 2329
172 Ga0207669_10096394 3300025937 Bacteria 1941
173 Ga0207669_10630465 3300025937 Bacteria 874
174 Ga0207704_10085749 3300025938 Bacteria 2051
175 Ga0207704_10125744 3300025938 Bacteria 1765
176 Ga0207691_10002019 3300025940 Bacteria 19878
177 Ga0207691_10006892 3300025940 Bacteria 10961
178 Ga0207691_10370013 3300025940 Bacteria 1224
179 Ga0207689_10001643 3300025942 Bacteria 21180
180 Ga0207689_10476093 3300025942 Bacteria 1045
181 Ga0207679_10029519 3300025945 Bacteria 3819
182 Ga0207679_10106376 3300025945 Bacteria 2205
183 Ga0207651_10009143 3300025960 Bacteria 5398
184 Ga0207651_10628005 3300025960 Bacteria 941
185 Ga0207712_10005456 3300025961 Bacteria 8028
186 Ga0207712_10870981 3300025961 Bacteria 795
187 Ga0207668_10214683 3300025972 Bacteria 1541
188 Ga0207668_10243229 3300025972 Bacteria 1457
189 Ga0207640_10149132 3300025981 Bacteria 1716
190 Ga0207658_10379011 3300025986 Bacteria 1238
191 Ga0207677_10016668 3300026023 Bacteria 4359
192 Ga0207677_10712321 3300026023 Bacteria 892
193 Ga0207639_10189737 3300026041 Bacteria 1755
194 Ga0207678_10079752 3300026067 Bacteria 2803
195 Ga0207708_10005412 3300026075 Bacteria 9405
196 Ga0207708_10019572 3300026075 Bacteria 5103
197 Ga0207708_10342224 3300026075 Bacteria 1225
198 Ga0207641_10011724 3300026088 Bacteria 7199
199 Ga0207648_10051451 3300026089 Bacteria 3600
200 Ga0207648_10139642 3300026089 Bacteria 2135
201 Ga0207676_10203071 3300026095 Bacteria 1753
202 Ga0207676_10205297 3300026095 Bacteria 1744
203 Ga0207674_10127268 3300026116 Bacteria 2512
204 Ga0207674_10296031 3300026116 Unclassified 1567
205 Ga0207674_10391961 3300026116 Bacteria 1342
206 Ga0207675_100212604 3300026118 Bacteria 1861
207 Ga0207675_100329105 3300026118 Unclassified 1493
208 Ga0207675_100539073 3300026118 Unclassified 1165
209 Ga0207675_100898664 3300026118 Unclassified 902
210 Ga0207683_10072139 3300026121 Bacteria 3054
211 Ga0207683_10175180 3300026121 Bacteria 1944
212 Ga0207683_10210540 3300026121 Bacteria 1769
213 Ga0207683_10334586 3300026121 Bacteria 1388
214 Ga0209971_1052741 3300027682 Unclassified 983
215 Ga0209998_10020761 3300027717 Bacteria 1406
216 Ga0207428_10003766 3300027907 Bacteria 14559
217 Ga0207428_10050658 3300027907 Bacteria 3322
218 Ga0268266_10226792 3300028379 Bacteria 1719
219 Ga0268266_10443743 3300028379 Unclassified 1233
220 Ga0268265_10013204 3300028380 Bacteria 5612
221 Ga0268265_10136888 3300028380 Bacteria 2044
222 Ga0268265_10169997 3300028380 Bacteria 1862
223 Ga0268265_10886505 3300028380 Bacteria 875
224 Ga0268264_10085493 3300028381 Bacteria 2707
225 Ga0307513_10099519 3300031456 Bacteria 2935
226 Ga0307408_100291440 3300031548 Unclassified 1363
227 Ga0307405_10459774 3300031731 Bacteria 1011
228 Ga0307413_10276531 3300031824 Unclassified 1260
229 Ga0307410_10109565 3300031852 Bacteria 1996
230 Ga0307410_11305541 3300031852 Unclassified 635
231 Ga0307416_100021941 3300032002 Bacteria 4598
232 Ga0307411_10027131 3300032005 Bacteria 3460
233 Ga0307411_10433366 3300032005 Unclassified 1095
234 Ga0307415_100098871 3300032126 Bacteria 2134
235 Ga0373949_0011296 3300035090 Bacteria 1965
236 Ga0373942_0069026 3300035207 Bacteria 1028
237 Ga0439453_0069851 3300041408 Bacteria 741
238 Ga0451845_0665578 3300041501 Unclassified 702
239 Ga0439434_0089171 3300042435 Unclassified 985
240 Ga0439435_0087623 3300042436 Bacteria 942
241 Ga0439464_0053524 3300042439 Unclassified 1171
242 Ga0439460_0048886 3300042461 Unclassified 1263
243 Ga0451576_0145755 3300045051 Bacteria 2468
244 Ga0495621_0096544 3300046539 Bacteria 1120
245 Ga0495621_0354543 3300046539 Unclassified 616
246 Ga0495633_0426727 3300046558 Unclassified 599
247 Ga0495625_0109747 3300046660 Bacteria 1887
248 Ga0495661_0023213 3300046665 Bacteria 4027
249 Ga0496114_1544411 3300048917 Bacteria 552
250 Ga0501036_0272834 3300049572 Unclassified 1416
251 Ga0501038_0534512 3300049574 Bacteria 893
252 Ga0501039_0158096 3300049575 Bacteria 1781
253 Ga0501040_0296850 3300049576 Bacteria 1155
254 Ga0501040_0425677 3300049576 Unclassified 954
255 Ga0501041_0011479 3300049577 Bacteria 5237
256 Ga0501042_0022390 3300049578 Bacteria 4415
257 Ga0501042_0036612 3300049578 Bacteria 3481
258 Ga0501043_0297573 3300049579 Bacteria 1234
259 Ga0501046_0052213 3300049580 Bacteria 3222
260 Ga0501048_0294552 3300049582 Unclassified 1154
261 Ga0501068_0440421 3300049584 Bacteria 842
262 Ga0501072_0024864 3300049588 Bacteria 4663
263 Ga0501074_0025161 3300049590 Bacteria 4325
264 Ga0501075_0009212 3300049591 Bacteria 6903
265 Ga0501075_0046909 3300049591 Bacteria 3246
266 Ga0501076_0032162 3300049592 Bacteria 4094
267 Ga0501076_0211614 3300049592 Unclassified 1584
268 Ga0501077_0192719 3300049593 Bacteria 1295
269 Ga0501079_0110045 3300049741 Bacteria 2140
270 Ga0501081_0044497 3300049743 Bacteria 3047
271 Ga0501045_0018310 3300049824 Bacteria 4981
272 nmdc:mga05p37_1013699_c1 3300050507 Unclassified 880
273 nmdc:mga05p37_133192_c1 3300050507 Bacteria 3049
274 nmdc:mga05p37_166194_c1 3300050507 Bacteria 2693
275 nmdc:mga09592_25944_c1 3300050508 Bacteria 4853
276 nmdc:mga09592_6242_c1 3300050508 Bacteria 9705
277 nmdc:mga09592_705472_c1 3300050508 Bacteria 858
278 nmdc:mga09592_7149_c1 3300050508 Bacteria 9072
279 nmdc:mga09592_72872_c1 3300050508 Bacteria 2918
280 nmdc:mga0qj67_435_c1 3300050509 Bacteria 28521
281 nmdc:mga0qj67_5273_c1 3300050509 Bacteria 9429
282 nmdc:mga0qj67_572920_c1 3300050509 Bacteria 904
283 nmdc:mga0qj67_6426_c1 3300050509 Bacteria 8638
284 nmdc:mga06r32_1137_c1 3300050510 Bacteria 23887
285 nmdc:mga06r32_185022_c1 3300050510 Bacteria 2070
286 nmdc:mga06r32_29508_c1 3300050510 Bacteria 5142
287 nmdc:mga08y16_130108_c1 3300050511 Bacteria 2618
288 nmdc:mga08y16_286888_c1 3300050511 Bacteria 1697
289 nmdc:mga08y16_34736_c1 3300050511 Bacteria 5298
290 nmdc:mga08y16_40790_c1 3300050511 Bacteria 4864
291 nmdc:mga08y16_715_c1 3300050511 Bacteria 31535
292 nmdc:mga0n895_136_c1 3300050512 Bacteria 44076
293 nmdc:mga0n895_251641_c1 3300050512 Bacteria 1793
294 nmdc:mga0rr50_24718_c1 3300050513 Bacteria 4166
295 nmdc:mga0a205_362_c1 3300050515 Bacteria 34201
296 nmdc:mga0a205_43808_c1 3300050515 Bacteria 4313
297 Ga0495655_0055692 3300053083 Unclassified 1062
298 Ga0501082_0511713 3300060353 Unclassified 1049
299 Ga0501082_0601140 3300060353 Bacteria 962
300 Ga0530510_0250773 3300061734 Bacteria 1319
301 Ga0070662_100948969
302 MBSR1b_contig_10201530
303 JGI24735J21928_10019229
304 JGI25406J46586_10019839
305 Ga0058860_10534129
306 Ga0065715_10003112
307 Ga0065715_10010571
308 Ga0065707_10205592
309 Ga0070676_10003865
310 Ga0070676_10058391
311 Ga0070676_10112249
312 Ga0070690_100015943
313 Ga0070690_100056150
314 Ga0070690_100407320
315 Ga0070670_100239447
316 Ga0070670_100360135
317 Ga0070677_10004861
318 Ga0070677_10007586
319 Ga0070677_10194627
320 Ga0068869_100053017
321 Ga0068869_100169992
322 Ga0068869_100172771
323 Ga0070666_10050073
324 Ga0070666_10185936
325 Ga0068868_100036779
326 Ga0070660_100612218
327 Ga0070689_100046306
328 Ga0070687_100004401
329 Ga0070661_100004936
330 Ga0070692_10377037
331 Ga0070669_100007924
332 Ga0070669_100068714
333 Ga0070669_100294564
334 Ga0070675_100027103
335 Ga0070675_100151716
336 Ga0070675_100353155
337 Ga0070674_100018029
338 Ga0070674_100023049
339 Ga0070674_100315464
340 Ga0070673_100445254
341 Ga0070688_100007655
342 Ga0070659_100268893
343 Ga0070659_100367804
344 Ga0070667_100027615
345 Ga0070705_100463928
346 Ga0070700_100114527
347 Ga0070678_100066049
348 Ga0070678_100171230
349 Ga0070678_100182492
350 Ga0070662_100013937
351 Ga0070662_100172229
352 Ga0068867_100004670
353 Ga0068867_100467923
354 Ga0070685_10035252
355 Ga0070685_10335524
356 Ga0070699_100013997
357 Ga0068853_100219924
358 Ga0070672_100180628
359 Ga0070672_100227322
360 Ga0070672_101588797
361 Ga0070686_100120354
362 Ga0070665_100045696
363 Ga0070664_100011260
364 Ga0070664_100318520
365 Ga0068857_101161251
366 Ga0068854_100078511
367 Ga0070702_100701455
368 Ga0068859_100004504
369 Ga0068859_100080826
370 Ga0068859_100450517
371 Ga0068859_101615366
372 Ga0068864_100115075
373 Ga0068866_10062937
374 Ga0068861_100135866
375 Ga0068861_100346511
376 Ga0068870_10004211
377 Ga0068870_10113864
378 Ga0068870_10143322
379 Ga0068870_10594289
380 Ga0068863_100005508
381 Ga0068858_100579346
382 Ga0068860_100065445
383 Ga0068862_100002381
384 Ga0068862_100015884
385 Ga0081539_10000190
386 Ga0081539_10136886
387 Ga0068871_100038465
388 Ga0068871_100974223
389 Ga0068871_101690632
390 Ga0075428_100015826
391 Ga0075428_100403372
392 Ga0075430_100003935
393 Ga0075430_100005720
394 Ga0075430_100118254
395 Ga0075430_100133571
396 Ga0075430_100820927
397 Ga0075431_100000921
398 Ga0075431_100238675
399 Ga0075433_10000581
400 Ga0075433_10000829
401 Ga0075433_10126892
402 Ga0075434_100006555
403 Ga0075434_100318854
404 Ga0075429_100013524
405 Ga0075429_100017215
406 Ga0075429_100036510
407 Ga0075429_100135941
408 Ga0075429_100473625
409 Ga0075429_100753180
410 Ga0068865_100146692
411 Ga0097620_100004504
412 Ga0097620_100080826
413 Ga0097620_100450453
414 Ga0097620_101615347
415 Ga0075435_100010755
416 Ga0105240_10730745
417 Ga0111539_10000958
418 Ga0111539_10009650
419 Ga0111539_10020591
420 Ga0111539_10438389
421 Ga0114129_10029926
422 Ga0114129_10065696
423 Ga0114129_11128813
424 Ga0105243_11301189
425 Ga0105249_10008919
426 Ga0105249_10780478
427 Ga0105249_10790653
428 Ga0105249_11921442
429 Ga0105239_10000036
430 Ga0157371_10007802
431 Ga0157370_10087416
432 Ga0157369_10445188
433 Ga0163162_10013757
434 Ga0163162_11322428
435 Ga0157372_11658848
436 Ga0157375_12223292
437 Ga0163163_10157588
438 Ga0157380_10019011
439 Ga0157380_10027139
440 Ga0157380_10143262
441 Ga0157380_11647717
442 Ga0157377_10435529
443 Ga0157376_10093843
444 Ga0163161_10047300
445 Ga0163161_10231296
446 Ga0207697_10000739
447 Ga0207682_10006121
448 Ga0207682_10045333
449 Ga0207682_10150775
450 Ga0207642_10051447
451 Ga0207688_10000747
452 Ga0207680_10037379
453 Ga0207645_10001797
454 Ga0207645_10068337
455 Ga0207645_10424577
456 Ga0207643_10022047
457 Ga0207662_10012003
458 Ga0207681_10030122
459 Ga0207681_10407548
460 Ga0207681_10736473
461 Ga0207650_10080724
462 Ga0207650_10729246
463 Ga0207659_10016919
464 Ga0207659_10026973
465 Ga0207659_10269520
466 Ga0207690_10400897
467 Ga0207706_10004451
468 Ga0207706_10009200
469 Ga0207706_10141361
470 Ga0207706_10597972
471 Ga0207670_10076484
472 Ga0207669_10096394
473 Ga0207669_10630465
474 Ga0207704_10085749
475 Ga0207704_10125744
476 Ga0207691_10002019
477 Ga0207691_10006892
478 Ga0207691_10370013
479 Ga0207689_10001643
480 Ga0207689_10476093
481 Ga0207679_10029519
482 Ga0207679_10106376
483 Ga0207651_10009143
484 Ga0207651_10628005
485 Ga0207712_10005456
486 Ga0207712_10870981
487 Ga0207668_10214683
488 Ga0207668_10243229
489 Ga0207640_10149132
490 Ga0207658_10379011
491 Ga0207677_10016668
492 Ga0207677_10712321
493 Ga0207639_10189737
494 Ga0207678_10079752
495 Ga0207708_10005412
496 Ga0207708_10019572
497 Ga0207708_10342224
498 Ga0207641_10011724
499 Ga0207648_10051451
500 Ga0207648_10139642
501 Ga0207676_10203071
502 Ga0207676_10205297
503 Ga0207674_10127268
504 Ga0207674_10296031
505 Ga0207674_10391961
506 Ga0207675_100212604
507 Ga0207675_100329105
508 Ga0207675_100539073
509 Ga0207675_100898664
510 Ga0207683_10072139
511 Ga0207683_10175180
512 Ga0207683_10210540
513 Ga0207683_10334586
514 Ga0209971_1052741
515 Ga0209998_10020761
516 Ga0207428_10003766
517 Ga0207428_10050658
518 Ga0268266_10226792
519 Ga0268266_10443743
520 Ga0268265_10013204
521 Ga0268265_10136888
522 Ga0268265_10169997
523 Ga0268265_10886505
524 Ga0268264_10085493
525 Ga0307513_10099519
526 Ga0307408_100291440
527 Ga0307405_10459774
528 Ga0307413_10276531
529 Ga0307410_10109565
530 Ga0307410_11305541
531 Ga0307416_100021941
532 Ga0307411_10027131
533 Ga0307411_10433366
534 Ga0307415_100098871
535 Ga0373949_0011296
536 Ga0373942_0069026
537 Ga0439453_0069851
538 Ga0451845_0665578
539 Ga0439434_0089171
540 Ga0439435_0087623
541 Ga0439464_0053524
542 Ga0439460_0048886
543 Ga0451576_0145755
544 Ga0495621_0096544
545 Ga0495621_0354543
546 Ga0495633_0426727
547 Ga0495625_0109747
548 Ga0495661_0023213
549 Ga0496114_1544411
550 Ga0501036_0272834
551 Ga0501038_0534512
552 Ga0501039_0158096
553 Ga0501040_0296850
554 Ga0501040_0425677
555 Ga0501041_0011479
556 Ga0501042_0022390
557 Ga0501042_0036612
558 Ga0501043_0297573
559 Ga0501046_0052213
560 Ga0501048_0294552
561 Ga0501068_0440421
562 Ga0501072_0024864
563 Ga0501074_0025161
564 Ga0501075_0009212
565 Ga0501075_0046909
566 Ga0501076_0032162
567 Ga0501076_0211614
568 Ga0501077_0192719
569 Ga0501079_0110045
570 Ga0501081_0044497
571 Ga0501045_0018310
572 nmdc:mga05p37_1013699_c1
573 nmdc:mga05p37_133192_c1
574 nmdc:mga05p37_166194_c1
575 nmdc:mga09592_25944_c1
576 nmdc:mga09592_6242_c1
577 nmdc:mga09592_705472_c1
578 nmdc:mga09592_7149_c1
579 nmdc:mga09592_72872_c1
580 nmdc:mga0qj67_435_c1
581 nmdc:mga0qj67_5273_c1
582 nmdc:mga0qj67_572920_c1
583 nmdc:mga0qj67_6426_c1
584 nmdc:mga06r32_1137_c1
585 nmdc:mga06r32_185022_c1
586 nmdc:mga06r32_29508_c1
587 nmdc:mga08y16_130108_c1
588 nmdc:mga08y16_286888_c1
589 nmdc:mga08y16_34736_c1
590 nmdc:mga08y16_40790_c1
591 nmdc:mga08y16_715_c1
592 nmdc:mga0n895_136_c1
593 nmdc:mga0n895_251641_c1
594 nmdc:mga0rr50_24718_c1
595 nmdc:mga0a205_362_c1
596 nmdc:mga0a205_43808_c1
597 Ga0495655_0055692
598 Ga0501082_0511713
599 Ga0501082_0601140
600 Ga0530510_0250773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

66

199

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8386 21 161
8f5v-assembly1.cif.gz_B crystal structure of mycobacterium tuberculosis mycothiol s-transferase enzyme in complex with mycothiol and zn2+ 0.8166 25 167
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.8153 25 167
2p1a-assembly1.cif.gz_A crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.8124 21 164
2ou6-assembly1.cif.gz_A-2 crystal structure of a putative metalloenzyme of the duf664 family (dr_1065) from deinococcus radiodurans at 1.80 a resolution 0.8021 15 168
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.804 25 167 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7941 19 169 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7789 19 169 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7771 24 166 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7513 24 166 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A271JE96-F1-model_v4 Metal-dependent hydrolase 0.981 6 169 GO:0016787
AF-A0A1E4A219-F1-model_v4 Metal-dependent hydrolase 0.9805 6 169 GO:0016787
AF-A0A7X7PIH7-F1-model_v4 DinB family protein 0.9772 4 173
AF-A0A1N6FVR1-F1-model_v4 DinB family protein 0.977 7 168
AF-A0A143PEB2-F1-model_v4 DinB superfamily protein 0.9741 3 170

Map