F395221

General Info

Members Datasets Scaffolds Average Seq Length
300 162 600 282

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100023940|Ga0070667_1000239403
Length 304
Sequence MPPRLDLRGRGGNKRRHMRWPSFRRGRHDAAETPDSPPKEDAWSLTRFILTLAVLAWALRSFIIAPFSIPSGSMIPTLYIGDYLVVAKWPYGYSRYSFPFAFPSFNGRVFEHAPKRGDVVVFRHPSEDADLIKRVIGVAGDTVEVRGGRLILNGHAVRREEMPPYSMPISANSPCKVVPPATPFVAAIRNQPYCLYPSYRETLPGGPSYTVLDQVDGGPADDFGPVKVPAGHLFLMGDNRDDSLDSRFGAAEGGIGMVPMENLIGRATFTFWSTDGGASYWKPWTWFTALRPDRIGNGYTGDAE

Samples

Sample ID Description Type Environment
1 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
133 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
134 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
135 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
136 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
144 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
148 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
156 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 2.33
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070667_100023940 3300005367 Bacteria 5070
2 JGI24740J21852_10004066 3300001979 Bacteria 6329
3 JGI24739J22299_10025010 3300001989 Bacteria 2101
4 JGI24737J22298_10012932 3300001990 Bacteria 2720
5 JGI24735J21928_10005650 3300002067 Bacteria 4137
6 Ga0070676_10012545 3300005328 Bacteria 4630
7 Ga0070670_100046772 3300005331 Bacteria 3722
8 Ga0070670_100068946 3300005331 Bacteria 3036
9 Ga0070670_100443904 3300005331 Bacteria 1149
10 Ga0068869_100185330 3300005334 Bacteria 1633
11 Ga0068869_100232007 3300005334 Bacteria 1467
12 Ga0070666_10050204 3300005335 Bacteria 2805
13 Ga0070680_100001739 3300005336 Bacteria 15996
14 Ga0070680_100006630 3300005336 Bacteria 8804
15 Ga0070680_100158658 3300005336 Bacteria 1900
16 Ga0070682_100007921 3300005337 Bacteria 5978
17 Ga0070660_100081146 3300005339 Bacteria 2546
18 Ga0070660_100130893 3300005339 Bacteria 2008
19 Ga0070661_100018421 3300005344 Bacteria 4963
20 Ga0070661_100029985 3300005344 Bacteria 3928
21 Ga0070661_100033078 3300005344 Bacteria 3745
22 Ga0070661_100181835 3300005344 Bacteria 1600
23 Ga0070692_10003730 3300005345 Bacteria 6253
24 Ga0070668_100126705 3300005347 Bacteria 2046
25 Ga0070668_100193564 3300005347 Bacteria 1666
26 Ga0070669_100024280 3300005353 Bacteria 4347
27 Ga0070675_100029301 3300005354 Bacteria 4439
28 Ga0070675_100132359 3300005354 Bacteria 2126
29 Ga0070671_100019457 3300005355 Bacteria 5526
30 Ga0070671_100370722 3300005355 Bacteria 1223
31 Ga0070674_100342090 3300005356 Bacteria 1205
32 Ga0070659_100004185 3300005366 Bacteria 10295
33 Ga0070659_100031522 3300005366 Bacteria 4107
34 Ga0070659_100076798 3300005366 Bacteria 2663
35 Ga0070667_100003776 3300005367 Bacteria 12872
36 Ga0070667_100021216 3300005367 Bacteria 5397
37 Ga0070714_100005785 3300005435 Bacteria 9481
38 Ga0070713_100009377 3300005436 Bacteria 7003
39 Ga0070694_100009908 3300005444 Bacteria 5855
40 Ga0070663_100009909 3300005455 Bacteria 5920
41 Ga0070663_100030078 3300005455 Bacteria 3718
42 Ga0070662_100012344 3300005457 Bacteria 5664
43 Ga0070681_10250053 3300005458 Bacteria 1686
44 Ga0070681_10339040 3300005458 Bacteria 1413
45 Ga0068867_100048072 3300005459 Bacteria 3138
46 Ga0070706_100104211 3300005467 Bacteria 2638
47 Ga0070679_100053370 3300005530 Bacteria 4024
48 Ga0068853_100173866 3300005539 Bacteria 1950
49 Ga0068853_100217289 3300005539 Bacteria 1744
50 Ga0070672_100013761 3300005543 Bacteria 5721
51 Ga0070695_100020281 3300005545 Bacteria 4057
52 Ga0070695_100155164 3300005545 Bacteria 1601
53 Ga0070693_100024424 3300005547 Bacteria 3241
54 Ga0070693_100158811 3300005547 Bacteria 1438
55 Ga0070665_100121024 3300005548 Bacteria 2619
56 Ga0068855_100157813 3300005563 Bacteria 2577
57 Ga0070664_100003720 3300005564 Bacteria 12293
58 Ga0070664_100014167 3300005564 Bacteria 6503
59 Ga0070664_100382802 3300005564 Bacteria 1284
60 Ga0070664_100656680 3300005564 Bacteria 975
61 Ga0068857_100190132 3300005577 Bacteria 1870
62 Ga0068857_100197016 3300005577 Bacteria 1835
63 Ga0068854_100011279 3300005578 Bacteria 5811
64 Ga0068854_100054442 3300005578 Bacteria 2877
65 Ga0068854_100081074 3300005578 Bacteria 2396
66 Ga0068856_100017156 3300005614 Bacteria 7016
67 Ga0068856_100058872 3300005614 Bacteria 3794
68 Ga0068852_100018528 3300005616 Bacteria 5487
69 Ga0068852_100022826 3300005616 Bacteria 5025
70 Ga0068852_100047315 3300005616 Bacteria 3669
71 Ga0068852_100086881 3300005616 Bacteria 2789
72 Ga0068859_100001691 3300005617 Bacteria 22476
73 Ga0068859_100104162 3300005617 Bacteria 2896
74 Ga0068859_100110842 3300005617 Bacteria 2806
75 Ga0068859_100249056 3300005617 Bacteria 1867
76 Ga0068864_100005164 3300005618 Bacteria 10697
77 Ga0068864_100209798 3300005618 Bacteria 1793
78 Ga0068861_100051423 3300005719 Bacteria 3128
79 Ga0068851_10032478 3300005834 Bacteria 2597
80 Ga0068863_100006852 3300005841 Bacteria 11169
81 Ga0068863_100119929 3300005841 Bacteria 2507
82 Ga0068863_100154923 3300005841 Bacteria 2193
83 Ga0068858_100000874 3300005842 Bacteria 31179
84 Ga0068858_100009525 3300005842 Bacteria 9266
85 Ga0068858_100155077 3300005842 Bacteria 2154
86 Ga0068860_100006212 3300005843 Bacteria 12010
87 Ga0068860_100006399 3300005843 Bacteria 11822
88 Ga0068860_100019107 3300005843 Bacteria 6654
89 Ga0068860_100050945 3300005843 Bacteria 3941
90 Ga0068860_100237269 3300005843 Bacteria 1773
91 Ga0068862_100003744 3300005844 Bacteria 12971
92 Ga0068862_100020846 3300005844 Bacteria 5475
93 Ga0068862_100221938 3300005844 Bacteria 1712
94 Ga0068862_100998155 3300005844 Bacteria 828
95 Ga0070717_10062431 3300006028 Bacteria 3089
96 Ga0075364_10246887 3300006051 Bacteria 1213
97 Ga0070712_100420692 3300006175 Bacteria 1107
98 Ga0075428_100540785 3300006844 Bacteria 1245
99 Ga0075433_10025955 3300006852 Bacteria 4956
100 Ga0075429_100049261 3300006880 Bacteria 3663
101 Ga0097620_100001691 3300006931 Bacteria 22476
102 Ga0097620_100104173 3300006931 Bacteria 2896
103 Ga0097620_100110845 3300006931 Bacteria 2806
104 Ga0097620_100249062 3300006931 Bacteria 1867
105 Ga0105240_10031233 3300009093 Bacteria 6911
106 Ga0105240_10162334 3300009093 Bacteria 2653
107 Ga0105245_10408826 3300009098 Bacteria 1358
108 Ga0105243_10016909 3300009148 Bacteria 5515
109 Ga0105241_10095791 3300009174 Bacteria 2350
110 Ga0105248_10000413 3300009177 Bacteria 49136
111 Ga0105248_10820288 3300009177 Bacteria 1050
112 Ga0105238_10033883 3300009551 Bacteria 5197
113 Ga0105249_10015864 3300009553 Bacteria 6676
114 Ga0105249_10278794 3300009553 Bacteria 1668
115 Ga0105246_10111074 3300011119 Bacteria 2014
116 Ga0157373_10027963 3300013100 Bacteria 4068
117 Ga0157373_10040433 3300013100 Bacteria 3337
118 Ga0157373_10062515 3300013100 Bacteria 2637
119 Ga0157371_10028663 3300013102 Bacteria 4030
120 Ga0157371_10278538 3300013102 Bacteria 1208
121 Ga0157370_10007112 3300013104 Bacteria 12214
122 Ga0157370_10048353 3300013104 Bacteria 4075
123 Ga0157370_10113744 3300013104 Bacteria 2529
124 Ga0157369_10171542 3300013105 Bacteria 2285
125 Ga0157369_10182562 3300013105 Bacteria 2207
126 Ga0163162_10024681 3300013306 Bacteria 5937
127 Ga0163162_10027028 3300013306 Bacteria 5674
128 Ga0157372_10062706 3300013307 Bacteria 4166
129 Ga0157372_10155460 3300013307 Bacteria 2641
130 Ga0157372_10187139 3300013307 Bacteria 2398
131 Ga0157372_10476651 3300013307 Bacteria 1455
132 Ga0157372_10484581 3300013307 Bacteria 1442
133 Ga0157375_10078045 3300013308 Bacteria 3344
134 Ga0157375_10092919 3300013308 Bacteria 3082
135 Ga0163163_10004628 3300014325 Bacteria 11753
136 Ga0157380_10146349 3300014326 Bacteria 2036
137 Ga0157379_10006729 3300014968 Bacteria 9931
138 Ga0157379_10168418 3300014968 Bacteria 1978
139 Ga0157379_10595311 3300014968 Bacteria 1032
140 Ga0163161_10256307 3300017792 Bacteria 1365
141 Ga0206353_10252202 3300020082 Bacteria 3588
142 Ga0213871_10050337 3300021441 Bacteria 1140
143 Ga0207688_10231934 3300025901 Bacteria 1114
144 Ga0207680_10040121 3300025903 Bacteria 2722
145 Ga0207647_10009611 3300025904 Bacteria 6867
146 Ga0207645_10005085 3300025907 Bacteria 9628
147 Ga0207645_10014638 3300025907 Bacteria 5240
148 Ga0207645_10018461 3300025907 Bacteria 4587
149 Ga0207705_10003282 3300025909 Bacteria 12322
150 Ga0207705_10007155 3300025909 Bacteria 8226
151 Ga0207705_10032943 3300025909 Bacteria 3703
152 Ga0207705_10034071 3300025909 Bacteria 3640
153 Ga0207705_10074334 3300025909 Bacteria 2467
154 Ga0207705_10111213 3300025909 Bacteria 2024
155 Ga0207707_10042451 3300025912 Bacteria 3969
156 Ga0207707_10421743 3300025912 Bacteria 1144
157 Ga0207695_10042205 3300025913 Bacteria 4875
158 Ga0207695_10161170 3300025913 Bacteria 2174
159 Ga0207660_10005689 3300025917 Bacteria 8089
160 Ga0207660_10026869 3300025917 Bacteria 3923
161 Ga0207657_10002328 3300025919 Bacteria 20592
162 Ga0207657_10005214 3300025919 Bacteria 13615
163 Ga0207657_10023231 3300025919 Bacteria 5779
164 Ga0207657_10161814 3300025919 Bacteria 1817
165 Ga0207649_10279340 3300025920 Bacteria 1213
166 Ga0207649_10357904 3300025920 Bacteria 1082
167 Ga0207649_10477994 3300025920 Bacteria 944
168 Ga0207652_10010639 3300025921 Bacteria 7408
169 Ga0207652_10018615 3300025921 Bacteria 5698
170 Ga0207652_10108166 3300025921 Bacteria 2463
171 Ga0207694_10087872 3300025924 Bacteria 2450
172 Ga0207659_10159399 3300025926 Bacteria 1770
173 Ga0207687_10176734 3300025927 Bacteria 1651
174 Ga0207664_10076706 3300025929 Bacteria 2706
175 Ga0207644_10016794 3300025931 Bacteria 4929
176 Ga0207644_10020665 3300025931 Bacteria 4480
177 Ga0207644_10216154 3300025931 Bacteria 1517
178 Ga0207690_10004216 3300025932 Bacteria 8496
179 Ga0207690_10013021 3300025932 Bacteria 4989
180 Ga0207690_10044491 3300025932 Bacteria 2927
181 Ga0207706_10008069 3300025933 Bacteria 9718
182 Ga0207706_10016261 3300025933 Bacteria 6720
183 Ga0207706_10037990 3300025933 Bacteria 4272
184 Ga0207704_10048985 3300025938 Bacteria 2538
185 Ga0207665_10049746 3300025939 Bacteria 2817
186 Ga0207691_10032027 3300025940 Bacteria 4905
187 Ga0207711_10000218 3300025941 Bacteria 61467
188 Ga0207711_10003641 3300025941 Bacteria 13326
189 Ga0207711_10005377 3300025941 Bacteria 10836
190 Ga0207689_10030619 3300025942 Bacteria 4484
191 Ga0207661_10032293 3300025944 Bacteria 4054
192 Ga0207679_10035745 3300025945 Bacteria 3518
193 Ga0207679_10159664 3300025945 Bacteria 1844
194 Ga0207667_10032951 3300025949 Bacteria 5576
195 Ga0207667_10071516 3300025949 Bacteria 3606
196 Ga0207667_10156459 3300025949 Bacteria 2345
197 Ga0207651_10153239 3300025960 Bacteria 1797
198 Ga0207712_10002447 3300025961 Bacteria 11986
199 Ga0207668_10090505 3300025972 Bacteria 2246
200 Ga0207668_10551899 3300025972 Bacteria 998
201 Ga0207640_10065132 3300025981 Bacteria 2430
202 Ga0207640_10148877 3300025981 Bacteria 1717
203 Ga0207640_10269918 3300025981 Bacteria 1330
204 Ga0207658_10004040 3300025986 Bacteria 10259
205 Ga0207658_10019818 3300025986 Bacteria 4654
206 Ga0207658_10024453 3300025986 Bacteria 4227
207 Ga0207658_10094401 3300025986 Bacteria 2328
208 Ga0207703_10006195 3300026035 Bacteria 9572
209 Ga0207703_10012760 3300026035 Bacteria 6551
210 Ga0207639_10010077 3300026041 Bacteria 6535
211 Ga0207639_10061982 3300026041 Bacteria 2890
212 Ga0207639_10121561 3300026041 Bacteria 2146
213 Ga0207678_10001094 3300026067 Bacteria 24866
214 Ga0207678_10002439 3300026067 Bacteria 16899
215 Ga0207678_10003727 3300026067 Bacteria 13709
216 Ga0207702_10026464 3300026078 Bacteria 4815
217 Ga0207702_10079925 3300026078 Bacteria 2835
218 Ga0207702_10081095 3300026078 Bacteria 2817
219 Ga0207641_10000573 3300026088 Bacteria 40695
220 Ga0207641_10161002 3300026088 Bacteria 2040
221 Ga0207641_10207463 3300026088 Bacteria 1810
222 Ga0207648_10042915 3300026089 Bacteria 3971
223 Ga0207674_10000814 3300026116 Bacteria 40536
224 Ga0207674_10003121 3300026116 Bacteria 20439
225 Ga0207674_10566674 3300026116 Bacteria 1097
226 Ga0207675_100072686 3300026118 Bacteria 3217
227 Ga0207698_10020568 3300026142 Bacteria 4545
228 Ga0207698_10275138 3300026142 Bacteria 1554
229 Ga0268266_10043908 3300028379 Bacteria 3820
230 Ga0268265_10002174 3300028380 Bacteria 15167
231 Ga0268265_10004672 3300028380 Bacteria 9464
232 Ga0268265_10413281 3300028380 Bacteria 1250
233 Ga0268265_10445114 3300028380 Bacteria 1208
234 Ga0268264_10001863 3300028381 Bacteria 19178
235 Ga0268264_10190340 3300028381 Bacteria 1870
236 Ga0307513_10292168 3300031456 Bacteria 1401
237 Ga0307410_10107830 3300031852 Bacteria 2010
238 Ga0307407_10067290 3300031903 Bacteria 2116
239 Ga0307412_10038234 3300031911 Bacteria 3089
240 Ga0307409_100708697 3300031995 Bacteria 1006
241 Ga0307411_10018343 3300032005 Bacteria 4011
242 Ga0307415_100078705 3300032126 Bacteria 2346
243 Ga0395899_0022063 3300037312 Bacteria 4828
244 Ga0395899_0066219 3300037312 Bacteria 2653
245 Ga0395899_0191599 3300037312 Bacteria 1430
246 Ga0395899_0279473 3300037312 Bacteria 1136
247 Ga0395900_0002613 3300037418 Bacteria 19679
248 Ga0395900_0201869 3300037418 Bacteria 2011
249 Ga0395900_0206775 3300037418 Bacteria 1984
250 Ga0395900_0214702 3300037418 Bacteria 1942
251 Ga0395905_0004032 3300037471 Bacteria 15414
252 Ga0395905_0005012 3300037471 Bacteria 13639
253 Ga0395905_0037582 3300037471 Bacteria 4545
254 Ga0395905_0130689 3300037471 Bacteria 2361
255 Ga0395905_0140897 3300037471 Bacteria 2268
256 Ga0395905_0307476 3300037471 Bacteria 1473
257 Ga0395905_0307483 3300037471 Bacteria 1473
258 Ga0395905_0384215 3300037471 Bacteria 1298
259 Ga0395905_0567142 3300037471 Bacteria 1036
260 Ga0395901_0091728 3300038443 Bacteria 3180
261 Ga0395901_0143234 3300038443 Bacteria 2512
262 Ga0436360_0999397 3300039438 Bacteria 1747
263 Ga0450914_000086 3300042118 Bacteria 2759
264 Ga0450917_001391 3300042120 Bacteria 1732
265 Ga0450890_004036 3300042127 Bacteria 1930
266 Ga0450905_000739 3300042142 Bacteria 4006
267 Ga0450889_000012 3300042144 Bacteria 15871
268 Ga0439464_0001756 3300042439 Bacteria 5209
269 Ga0466972_0023876 3300044658 Bacteria 3038
270 Ga0466963_0006397 3300044694 Bacteria 6966
271 Ga0466963_0042387 3300044694 Bacteria 2989
272 Ga0466963_0092479 3300044694 Bacteria 2061
273 Ga0466964_0018650 3300044706 Bacteria 2664
274 Ga0466957_0025292 3300044842 Bacteria 3518
275 Ga0466967_0048117 3300045976 Bacteria 3722
276 Ga0466967_0085854 3300045976 Bacteria 2850
277 Ga0466967_0134076 3300045976 Bacteria 2302
278 Ga0466967_0701352 3300045976 Bacteria 1002
279 Ga0495620_0073300 3300046515 Bacteria 1396
280 Ga0495642_0080241 3300046528 Bacteria 1373
281 Ga0495597_0170458 3300046542 Bacteria 884
282 Ga0495668_0057893 3300046616 Bacteria 2139
283 Ga0495669_0000551 3300046684 Bacteria 16685
284 Ga0495669_0000672 3300046684 Bacteria 14889
285 Ga0495669_0024008 3300046684 Bacteria 2656
286 Ga0496100_0050813 3300048903 Bacteria 2688
287 Ga0496101_0173433 3300048904 Bacteria 1658
288 Ga0496106_0015217 3300048909 Bacteria 5693
289 Ga0496107_0043495 3300048910 Bacteria 3227
290 Ga0496109_0130190 3300048912 Bacteria 2348
291 Ga0496112_0020340 3300048915 Bacteria 6290
292 Ga0496113_0188410 3300048916 Bacteria 1637
293 Ga0501067_0065892 3300049583 Bacteria 2005
294 Ga0501068_0117471 3300049584 Bacteria 1657
295 nmdc:mga00v17_225605_c1 3300050491 Bacteria 1213
296 nmdc:mga09592_105562_c1 3300050508 Bacteria 2415
297 nmdc:mga08y16_55804_c1 3300050511 Bacteria 4128
298 nmdc:mga0rr50_62657_c1 3300050513 Bacteria 2806
299 nmdc:mga0a205_2308_c1 3300050515 Bacteria 16838
300 Ga0500587_002395 3300053739 Bacteria 2666
301 Ga0070667_100023940
302 JGI24740J21852_10004066
303 JGI24739J22299_10025010
304 JGI24737J22298_10012932
305 JGI24735J21928_10005650
306 Ga0070676_10012545
307 Ga0070670_100046772
308 Ga0070670_100068946
309 Ga0070670_100443904
310 Ga0068869_100185330
311 Ga0068869_100232007
312 Ga0070666_10050204
313 Ga0070680_100001739
314 Ga0070680_100006630
315 Ga0070680_100158658
316 Ga0070682_100007921
317 Ga0070660_100081146
318 Ga0070660_100130893
319 Ga0070661_100018421
320 Ga0070661_100029985
321 Ga0070661_100033078
322 Ga0070661_100181835
323 Ga0070692_10003730
324 Ga0070668_100126705
325 Ga0070668_100193564
326 Ga0070669_100024280
327 Ga0070675_100029301
328 Ga0070675_100132359
329 Ga0070671_100019457
330 Ga0070671_100370722
331 Ga0070674_100342090
332 Ga0070659_100004185
333 Ga0070659_100031522
334 Ga0070659_100076798
335 Ga0070667_100003776
336 Ga0070667_100021216
337 Ga0070714_100005785
338 Ga0070713_100009377
339 Ga0070694_100009908
340 Ga0070663_100009909
341 Ga0070663_100030078
342 Ga0070662_100012344
343 Ga0070681_10250053
344 Ga0070681_10339040
345 Ga0068867_100048072
346 Ga0070706_100104211
347 Ga0070679_100053370
348 Ga0068853_100173866
349 Ga0068853_100217289
350 Ga0070672_100013761
351 Ga0070695_100020281
352 Ga0070695_100155164
353 Ga0070693_100024424
354 Ga0070693_100158811
355 Ga0070665_100121024
356 Ga0068855_100157813
357 Ga0070664_100003720
358 Ga0070664_100014167
359 Ga0070664_100382802
360 Ga0070664_100656680
361 Ga0068857_100190132
362 Ga0068857_100197016
363 Ga0068854_100011279
364 Ga0068854_100054442
365 Ga0068854_100081074
366 Ga0068856_100017156
367 Ga0068856_100058872
368 Ga0068852_100018528
369 Ga0068852_100022826
370 Ga0068852_100047315
371 Ga0068852_100086881
372 Ga0068859_100001691
373 Ga0068859_100104162
374 Ga0068859_100110842
375 Ga0068859_100249056
376 Ga0068864_100005164
377 Ga0068864_100209798
378 Ga0068861_100051423
379 Ga0068851_10032478
380 Ga0068863_100006852
381 Ga0068863_100119929
382 Ga0068863_100154923
383 Ga0068858_100000874
384 Ga0068858_100009525
385 Ga0068858_100155077
386 Ga0068860_100006212
387 Ga0068860_100006399
388 Ga0068860_100019107
389 Ga0068860_100050945
390 Ga0068860_100237269
391 Ga0068862_100003744
392 Ga0068862_100020846
393 Ga0068862_100221938
394 Ga0068862_100998155
395 Ga0070717_10062431
396 Ga0075364_10246887
397 Ga0070712_100420692
398 Ga0075428_100540785
399 Ga0075433_10025955
400 Ga0075429_100049261
401 Ga0097620_100001691
402 Ga0097620_100104173
403 Ga0097620_100110845
404 Ga0097620_100249062
405 Ga0105240_10031233
406 Ga0105240_10162334
407 Ga0105245_10408826
408 Ga0105243_10016909
409 Ga0105241_10095791
410 Ga0105248_10000413
411 Ga0105248_10820288
412 Ga0105238_10033883
413 Ga0105249_10015864
414 Ga0105249_10278794
415 Ga0105246_10111074
416 Ga0157373_10027963
417 Ga0157373_10040433
418 Ga0157373_10062515
419 Ga0157371_10028663
420 Ga0157371_10278538
421 Ga0157370_10007112
422 Ga0157370_10048353
423 Ga0157370_10113744
424 Ga0157369_10171542
425 Ga0157369_10182562
426 Ga0163162_10024681
427 Ga0163162_10027028
428 Ga0157372_10062706
429 Ga0157372_10155460
430 Ga0157372_10187139
431 Ga0157372_10476651
432 Ga0157372_10484581
433 Ga0157375_10078045
434 Ga0157375_10092919
435 Ga0163163_10004628
436 Ga0157380_10146349
437 Ga0157379_10006729
438 Ga0157379_10168418
439 Ga0157379_10595311
440 Ga0163161_10256307
441 Ga0206353_10252202
442 Ga0213871_10050337
443 Ga0207688_10231934
444 Ga0207680_10040121
445 Ga0207647_10009611
446 Ga0207645_10005085
447 Ga0207645_10014638
448 Ga0207645_10018461
449 Ga0207705_10003282
450 Ga0207705_10007155
451 Ga0207705_10032943
452 Ga0207705_10034071
453 Ga0207705_10074334
454 Ga0207705_10111213
455 Ga0207707_10042451
456 Ga0207707_10421743
457 Ga0207695_10042205
458 Ga0207695_10161170
459 Ga0207660_10005689
460 Ga0207660_10026869
461 Ga0207657_10002328
462 Ga0207657_10005214
463 Ga0207657_10023231
464 Ga0207657_10161814
465 Ga0207649_10279340
466 Ga0207649_10357904
467 Ga0207649_10477994
468 Ga0207652_10010639
469 Ga0207652_10018615
470 Ga0207652_10108166
471 Ga0207694_10087872
472 Ga0207659_10159399
473 Ga0207687_10176734
474 Ga0207664_10076706
475 Ga0207644_10016794
476 Ga0207644_10020665
477 Ga0207644_10216154
478 Ga0207690_10004216
479 Ga0207690_10013021
480 Ga0207690_10044491
481 Ga0207706_10008069
482 Ga0207706_10016261
483 Ga0207706_10037990
484 Ga0207704_10048985
485 Ga0207665_10049746
486 Ga0207691_10032027
487 Ga0207711_10000218
488 Ga0207711_10003641
489 Ga0207711_10005377
490 Ga0207689_10030619
491 Ga0207661_10032293
492 Ga0207679_10035745
493 Ga0207679_10159664
494 Ga0207667_10032951
495 Ga0207667_10071516
496 Ga0207667_10156459
497 Ga0207651_10153239
498 Ga0207712_10002447
499 Ga0207668_10090505
500 Ga0207668_10551899
501 Ga0207640_10065132
502 Ga0207640_10148877
503 Ga0207640_10269918
504 Ga0207658_10004040
505 Ga0207658_10019818
506 Ga0207658_10024453
507 Ga0207658_10094401
508 Ga0207703_10006195
509 Ga0207703_10012760
510 Ga0207639_10010077
511 Ga0207639_10061982
512 Ga0207639_10121561
513 Ga0207678_10001094
514 Ga0207678_10002439
515 Ga0207678_10003727
516 Ga0207702_10026464
517 Ga0207702_10079925
518 Ga0207702_10081095
519 Ga0207641_10000573
520 Ga0207641_10161002
521 Ga0207641_10207463
522 Ga0207648_10042915
523 Ga0207674_10000814
524 Ga0207674_10003121
525 Ga0207674_10566674
526 Ga0207675_100072686
527 Ga0207698_10020568
528 Ga0207698_10275138
529 Ga0268266_10043908
530 Ga0268265_10002174
531 Ga0268265_10004672
532 Ga0268265_10413281
533 Ga0268265_10445114
534 Ga0268264_10001863
535 Ga0268264_10190340
536 Ga0307513_10292168
537 Ga0307410_10107830
538 Ga0307407_10067290
539 Ga0307412_10038234
540 Ga0307409_100708697
541 Ga0307411_10018343
542 Ga0307415_100078705
543 Ga0395899_0022063
544 Ga0395899_0066219
545 Ga0395899_0191599
546 Ga0395899_0279473
547 Ga0395900_0002613
548 Ga0395900_0201869
549 Ga0395900_0206775
550 Ga0395900_0214702
551 Ga0395905_0004032
552 Ga0395905_0005012
553 Ga0395905_0037582
554 Ga0395905_0130689
555 Ga0395905_0140897
556 Ga0395905_0307476
557 Ga0395905_0307483
558 Ga0395905_0384215
559 Ga0395905_0567142
560 Ga0395901_0091728
561 Ga0395901_0143234
562 Ga0436360_0999397
563 Ga0450914_000086
564 Ga0450917_001391
565 Ga0450890_004036
566 Ga0450905_000739
567 Ga0450889_000012
568 Ga0439464_0001756
569 Ga0466972_0023876
570 Ga0466963_0006397
571 Ga0466963_0042387
572 Ga0466963_0092479
573 Ga0466964_0018650
574 Ga0466957_0025292
575 Ga0466967_0048117
576 Ga0466967_0085854
577 Ga0466967_0134076
578 Ga0466967_0701352
579 Ga0495620_0073300
580 Ga0495642_0080241
581 Ga0495597_0170458
582 Ga0495668_0057893
583 Ga0495669_0000551
584 Ga0495669_0000672
585 Ga0495669_0024008
586 Ga0496100_0050813
587 Ga0496101_0173433
588 Ga0496106_0015217
589 Ga0496107_0043495
590 Ga0496109_0130190
591 Ga0496112_0020340
592 Ga0496113_0188410
593 Ga0501067_0065892
594 Ga0501068_0117471
595 nmdc:mga00v17_225605_c1
596 nmdc:mga09592_105562_c1
597 nmdc:mga08y16_55804_c1
598 nmdc:mga0rr50_62657_c1
599 nmdc:mga0a205_2308_c1
600 Ga0500587_002395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

42

272

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7689 39 250
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7484 39 250
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.745 39 246
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6819 39 246
3s04-assembly3.cif.gz_A crystal structure of escherichia coli type i signal peptidase in complex with an arylomycin lipoglycopeptide antibiotic 0.6643 39 273
ID Description Score Start End Superfamily
af_Q96LU5_28_157_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8145 39 249 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7969 36 246 2.10.109.10
af_Q7XS59_25_161_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7942 37 250 2.10.109.10
1kn9D01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7862 39 272 2.10.109.10
1kn9D01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7732 39 272 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A2N7SIG0-F1-model_v4 deleted 0.9039 11 135
AF-A0A530BR28-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9008 9 135 GO:0004252
GO:0006465
GO:0016020
AF-A0A7Y1T696-F1-model_v4 deleted 0.8965 22 273
AF-A0A1Q9A0W6-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8887 21 131 GO:0004252
GO:0006465
GO:0016020
AF-A0A258LA82-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8886 20 239 GO:0004252
GO:0006465
GO:0016020

Map