F394952

General Info

Members Datasets Scaffolds Average Seq Length
299 197 598 181

Family's Representative Sequence

Representative Sequence 3300042128|Ga0450897_015412|Ga0450897_015412_73_648
Length 191
Sequence VFSSADIRLEQLMDTAATGLTFRDATDGDVDALVALIESAYRGDSSRAGWTTEADILDGQRTDAEGVLQVIKAPDSRLLTVERDGTVVACCQIEHRGSHAYFGMFAVSPAFQGAGLGKVIIAEAERIARETWGAREMHMTVISVRDDLIAWYERRGYRRTGRMTPFPYGDERFGVPLRTDLRFELLVKPLG

Samples

Sample ID Description Type Environment
1 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
15 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
18 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
19 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
20 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
23 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
28 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
29 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
47 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
48 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
49 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
50 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
51 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
54 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
55 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
58 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
59 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
60 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
61 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
62 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
63 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
64 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
65 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
105 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
106 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
107 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
108 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
116 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
117 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
118 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
155 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
156 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
157 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
158 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
159 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
160 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
161 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
162 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
163 2643221714 Streptomyces sp. Root264 Isolate Unclassified
164 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
165 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
166 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
167 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
168 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
169 2808606448 Streptomyces sp. 193411 Isolate Unclassified
170 2855683550 Micromonospora sp. RP3T Isolate Unclassified
171 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
172 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
173 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
174 2862574272 Streptomyces sp. AcE210 Isolate Nodule
175 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
176 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
177 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
178 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
179 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
180 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
181 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
182 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
183 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
184 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
185 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
186 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
187 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
188 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
189 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
190 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
191 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
192 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
193 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
194 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
195 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
196 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
197 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.62
Metatranscriptomes 0
Isolates 13.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 1
Rhizoplane 0.33
Rhizosphere 85.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450897_015412 3300042128 Bacteria 780
2 JGI24739J22299_10045489 3300001989 Bacteria 1440
3 JGI24737J22298_10061366 3300001990 Bacteria 1131
4 JGI24735J21928_10156898 3300002067 Bacteria 657
5 JGI24738J21930_10041160 3300002075 Bacteria 939
6 rootH1_10074698 3300003316 Bacteria 8431
7 rootH1_10043571 3300003323 Bacteria 2652
8 Ga0070663_100154308 3300005455 Bacteria 1763
9 Ga0068853_100161684 3300005539 Bacteria 2021
10 Ga0068853_100515264 3300005539 Bacteria 1130
11 Ga0070665_100423578 3300005548 Bacteria 1340
12 Ga0068855_100044652 3300005563 Bacteria 5244
13 Ga0068855_100363192 3300005563 Bacteria 1593
14 Ga0068854_100230665 3300005578 Bacteria 1469
15 Ga0068854_100265298 3300005578 Bacteria 1376
16 Ga0068856_100228364 3300005614 Bacteria 1877
17 Ga0068852_100010465 3300005616 Bacteria 6935
18 Ga0068851_10193606 3300005834 Bacteria 1131
19 Ga0081455_10068552 3300005937 Bacteria 2952
20 Ga0070715_10504684 3300006163 Bacteria 693
21 Ga0075367_10072188 3300006178 Bacteria 2078
22 Ga0105251_10087491 3300009011 Bacteria 1434
23 Ga0105240_10031074 3300009093 Bacteria 6930
24 Ga0105243_10436043 3300009148 Bacteria 1226
25 Ga0105243_12186592 3300009148 Bacteria 590
26 Ga0105241_10025005 3300009174 Bacteria 4437
27 Ga0105238_10043357 3300009551 Bacteria 4552
28 Ga0105238_11077893 3300009551 Bacteria 826
29 Ga0105239_10358098 3300010375 Bacteria 1648
30 Ga0105239_10817245 3300010375 Bacteria 1068
31 Ga0157369_10041246 3300013105 Bacteria 5039
32 Ga0157374_10129429 3300013296 Bacteria 2442
33 Ga0182008_10001610 3300014497 Bacteria 14983
34 Ga0182007_10005470 3300015262 Bacteria 5576
35 Ga0183367_1003 3300015688 Bacteria 814276
36 Ga0207647_10005022 3300025904 Bacteria 9751
37 Ga0207647_10023187 3300025904 Bacteria 4109
38 Ga0207685_10032907 3300025905 Bacteria 1869
39 Ga0207685_10385911 3300025905 Bacteria 715
40 Ga0207705_10395732 3300025909 Bacteria 1068
41 Ga0207654_10022062 3300025911 Bacteria 3392
42 Ga0207695_10132881 3300025913 Bacteria 2445
43 Ga0207671_10000748 3300025914 Bacteria 41241
44 Ga0207694_10025142 3300025924 Bacteria 4524
45 Ga0207691_10657870 3300025940 Bacteria 885
46 Ga0207667_10216138 3300025949 Bacteria 1964
47 Ga0207667_10500028 3300025949 Bacteria 1233
48 Ga0207640_10154794 3300025981 Bacteria 1688
49 Ga0207640_10199058 3300025981 Bacteria 1517
50 Ga0207639_10119761 3300026041 Bacteria 2161
51 Ga0207678_10118133 3300026067 Bacteria 2263
52 Ga0207698_10006204 3300026142 Bacteria 7437
53 Ga0209813_10009536 3300027866 Bacteria 2487
54 Ga0268266_10300417 3300028379 Bacteria 1497
55 Ga0307515_10030191 3300028794 Bacteria 9118
56 Ga0307515_10054676 3300028794 Bacteria 5854
57 Ga0307512_10001476 3300030522 Bacteria 33144
58 Ga0307512_10031121 3300030522 Bacteria 4628
59 Ga0307508_10004538 3300031616 Bacteria 13530
60 Ga0307508_10122725 3300031616 Bacteria 2200
61 Ga0307514_10005798 3300031649 Bacteria 10911
62 Ga0307514_10082203 3300031649 Bacteria 2377
63 Ga0307516_10031212 3300031730 Bacteria 5371
64 Ga0307518_10082185 3300031838 Bacteria 2325
65 Ga0307518_10108491 3300031838 Bacteria 1980
66 Ga0307510_10075312 3300033180 Bacteria 3328
67 Ga0307510_10267283 3300033180 Bacteria 1188
68 Ga0395898_0027824 3300037466 Bacteria 5669
69 Ga0395898_1098215 3300037466 Bacteria 729
70 Ga0395905_0071895 3300037471 Bacteria 3243
71 Ga0395901_0256677 3300038443 Bacteria 1820
72 Ga0451841_1154986 3300041498 Bacteria 1226
73 Ga0451853_0773861 3300041512 Bacteria 3378
74 Ga0451853_1285506 3300041512 Bacteria 1028
75 Ga0451853_3616581 3300041512 Bacteria 2675
76 Ga0439449_0004122 3300042007 Bacteria 5626
77 Ga0439449_0006819 3300042007 Bacteria 4355
78 Ga0439449_0143070 3300042007 Bacteria 891
79 Ga0439455_0001299 3300042012 Bacteria 4106
80 Ga0439455_0034785 3300042012 Bacteria 1269
81 Ga0450894_000110 3300042131 Bacteria 13800
82 Ga0450903_002093 3300042138 Bacteria 3589
83 Ga0450906_001115 3300042145 Bacteria 5954
84 Ga0439458_0025991 3300042157 Bacteria 1375
85 Ga0439458_0053141 3300042157 Bacteria 1002
86 Ga0466969_0005590 3300044656 Bacteria 6680
87 Ga0466969_0063625 3300044656 Bacteria 1787
88 Ga0466972_0048822 3300044658 Bacteria 2044
89 Ga0466965_0001600 3300044683 Bacteria 9243
90 Ga0466966_0001512 3300044684 Bacteria 14923
91 Ga0466961_0002718 3300044693 Bacteria 10997
92 Ga0466961_0039644 3300044693 Bacteria 3020
93 Ga0466963_0000924 3300044694 Bacteria 14981
94 Ga0466963_0047275 3300044694 Bacteria 2840
95 Ga0466964_0094036 3300044706 Bacteria 1310
96 Ga0466964_0234057 3300044706 Bacteria 898
97 Ga0466971_0001812 3300044719 Bacteria 9071
98 Ga0466970_0000459 3300044765 Bacteria 20111
99 Ga0466970_0004210 3300044765 Bacteria 7082
100 Ga0466970_0056462 3300044765 Bacteria 2098
101 Ga0466957_0002411 3300044842 Bacteria 10037
102 Ga0466957_0148932 3300044842 Bacteria 1512
103 Ga0466959_0000407 3300045049 Bacteria 25154
104 Ga0466958_0000629 3300045836 Bacteria 15130
105 Ga0466958_0151540 3300045836 Bacteria 1463
106 Ga0466967_0002626 3300045976 Bacteria 11315
107 Ga0466967_0162320 3300045976 Bacteria 2098
108 Ga0466967_0289756 3300045976 Bacteria 1573
109 Ga0466967_1659640 3300045976 Bacteria 636
110 Ga0495627_084561 3300046453 Bacteria 917
111 Ga0495592_0172643 3300046454 Bacteria 1479
112 Ga0495603_0015419 3300046455 Bacteria 4623
113 Ga0495603_0031723 3300046455 Bacteria 3181
114 Ga0495603_0339106 3300046455 Bacteria 862
115 Ga0495603_0341173 3300046455 Bacteria 859
116 Ga0495603_0479259 3300046455 Bacteria 712
117 Ga0495629_0040097 3300046459 Bacteria 3295
118 Ga0495629_0059155 3300046459 Bacteria 2678
119 Ga0495629_0095335 3300046459 Bacteria 2076
120 Ga0495629_0367949 3300046459 Bacteria 979
121 Ga0495638_0047568 3300046460 Bacteria 2689
122 Ga0495638_0380893 3300046460 Bacteria 737
123 Ga0495651_0020188 3300046462 Bacteria 5171
124 Ga0495582_0102490 3300046473 Bacteria 1603
125 Ga0495605_0003375 3300046474 Bacteria 9534
126 Ga0495605_0135034 3300046474 Bacteria 1110
127 Ga0495605_0286373 3300046474 Bacteria 699
128 Ga0495639_0013008 3300046475 Bacteria 3591
129 Ga0495662_0020136 3300046476 Bacteria 3228
130 Ga0495662_0025506 3300046476 Bacteria 2854
131 Ga0495662_0100161 3300046476 Bacteria 1417
132 Ga0495662_0101953 3300046476 Bacteria 1404
133 Ga0495585_0143420 3300046492 Bacteria 1249
134 Ga0495594_0006468 3300046499 Bacteria 6030
135 Ga0495594_0015561 3300046499 Bacteria 3998
136 Ga0495594_0101196 3300046499 Bacteria 1621
137 Ga0495594_0138150 3300046499 Bacteria 1381
138 Ga0495594_0331554 3300046499 Bacteria 866
139 Ga0495607_0036383 3300046501 Bacteria 2966
140 Ga0495583_0013025 3300046506 Bacteria 4667
141 Ga0495583_0060312 3300046506 Bacteria 1696
142 Ga0495606_0019391 3300046507 Bacteria 5062
143 Ga0495606_0241810 3300046507 Bacteria 1006
144 Ga0495608_0402120 3300046511 Bacteria 837
145 Ga0495610_0026077 3300046512 Bacteria 3125
146 Ga0495616_0012684 3300046513 Bacteria 4773
147 Ga0495618_0191805 3300046514 Bacteria 1295
148 Ga0495618_0272567 3300046514 Bacteria 1057
149 Ga0495620_0027084 3300046515 Bacteria 2687
150 Ga0495620_0043412 3300046515 Bacteria 1958
151 Ga0495628_0004534 3300046516 Bacteria 12300
152 Ga0495628_0092128 3300046516 Bacteria 2345
153 Ga0495628_0126639 3300046516 Bacteria 1956
154 Ga0495631_0002194 3300046518 Bacteria 11237
155 Ga0495643_0026535 3300046522 Bacteria 3268
156 Ga0495644_0088356 3300046523 Bacteria 1169
157 Ga0495648_0040133 3300046524 Bacteria 2971
158 Ga0495648_0176176 3300046524 Bacteria 1091
159 Ga0495666_0045637 3300046526 Bacteria 2113
160 Ga0495652_0006486 3300046529 Bacteria 10878
161 Ga0495652_0109449 3300046529 Bacteria 2224
162 Ga0495640_0009664 3300046533 Bacteria 7498
163 Ga0495640_0363919 3300046533 Bacteria 891
164 Ga0495609_0015882 3300046538 Bacteria 3516
165 Ga0495597_0043702 3300046542 Bacteria 1994
166 Ga0495645_0003837 3300046543 Bacteria 10232
167 Ga0495622_0142050 3300046557 Bacteria 1089
168 Ga0495622_0198096 3300046557 Bacteria 896
169 Ga0495622_0245473 3300046557 Bacteria 788
170 Ga0495633_0009958 3300046558 Bacteria 5218
171 Ga0495633_0094192 3300046558 Bacteria 1392
172 Ga0495668_0035092 3300046616 Bacteria 2810
173 Ga0495668_0122342 3300046616 Bacteria 1423
174 Ga0495634_0334583 3300046642 Bacteria 909
175 Ga0495611_0018667 3300046648 Bacteria 2976
176 Ga0495611_0099655 3300046648 Bacteria 1348
177 Ga0495625_0007642 3300046660 Bacteria 9375
178 Ga0495625_0020792 3300046660 Bacteria 5060
179 Ga0495635_0085552 3300046663 Bacteria 2157
180 Ga0495661_0031539 3300046665 Bacteria 3361
181 Ga0495588_0000456 3300046674 Bacteria 20551
182 Ga0495588_0168105 3300046674 Bacteria 1160
183 Ga0495657_0026691 3300046675 Bacteria 4087
184 Ga0495657_0043956 3300046675 Bacteria 3042
185 Ga0495657_0122010 3300046675 Bacteria 1640
186 Ga0495623_0020208 3300046679 Bacteria 4304
187 Ga0495613_0005357 3300046689 Bacteria 9635
188 Ga0495613_0011068 3300046689 Bacteria 6697
189 Ga0495613_0033715 3300046689 Bacteria 3803
190 Ga0495613_0057052 3300046689 Bacteria 2867
191 Ga0495613_0138689 3300046689 Bacteria 1738
192 Ga0495613_0157635 3300046689 Bacteria 1616
193 Ga0495624_0074054 3300046690 Bacteria 2116
194 Ga0495670_0239947 3300046691 Bacteria 965
195 Ga0495589_0005478 3300046794 Bacteria 6698
196 Ga0495589_0008678 3300046794 Bacteria 5293
197 Ga0495589_0026502 3300046794 Bacteria 2936
198 Ga0495589_0050180 3300046794 Bacteria 2064
199 Ga0495600_0041548 3300046809 Bacteria 2997
200 Ga0495600_0094015 3300046809 Bacteria 1955
201 Ga0495660_0070476 3300046810 Bacteria 1855
202 Ga0495581_0107163 3300047315 Bacteria 1624
203 Ga0495604_0035541 3300047317 Bacteria 3935
204 Ga0495604_0130583 3300047317 Bacteria 1806
205 Ga0495636_0000378 3300047318 Bacteria 16752
206 Ga0495636_0116581 3300047318 Bacteria 1179
207 Ga0495674_0127820 3300047319 Bacteria 2143
208 Ga0495676_0009493 3300047321 Bacteria 8861
209 Ga0495676_0102183 3300047321 Bacteria 2118
210 Ga0495676_0122380 3300047321 Bacteria 1890
211 Ga0495676_0268498 3300047321 Bacteria 1158
212 Ga0495680_0008869 3300047322 Bacteria 9095
213 Ga0495683_0022872 3300047323 Bacteria 3213
214 Ga0495683_0073059 3300047323 Bacteria 1682
215 Ga0495687_022205 3300047443 Bacteria 3051
216 Ga0495687_045445 3300047443 Bacteria 1901
217 Ga0495687_049710 3300047443 Bacteria 1791
218 Ga0495687_072001 3300047443 Bacteria 1382
219 Ga0495687_094861 3300047443 Bacteria 1133
220 Ga0495687_116777 3300047443 Bacteria 970
221 Ga0495687_166874 3300047443 Bacteria 734
222 Ga0495685_006043 3300047447 Bacteria 3957
223 Ga0495685_009036 3300047447 Bacteria 3321
224 Ga0495685_019386 3300047447 Bacteria 2337
225 Ga0495686_0017484 3300047472 Bacteria 4829
226 Ga0495686_0235309 3300047472 Bacteria 1035
227 Ga0495614_0237542 3300048089 Bacteria 831
228 Ga0495626_0024890 3300048091 Bacteria 2931
229 Ga0496109_0084805 3300048912 Bacteria 2923
230 Ga0496119_0210087 3300048922 Eukaryota 1002
231 Ga0495678_073274 3300049459 Bacteria 1249
232 Ga0495682_0143062 3300049460 Bacteria 854
233 Ga0501033_0000804 3300049570 Bacteria 28723
234 Ga0501033_0420958 3300049570 Bacteria 930
235 Ga0501034_0039202 3300049571 Bacteria 4799
236 Ga0501036_0030127 3300049572 Bacteria 4584
237 Ga0501036_0042744 3300049572 Bacteria 3836
238 Ga0501038_0308523 3300049574 Bacteria 1240
239 Ga0501039_0004258 3300049575 Bacteria 10774
240 Ga0501041_0880409 3300049577 Bacteria 575
241 Ga0501042_0310641 3300049578 Bacteria 1139
242 Ga0501043_0002501 3300049579 Bacteria 15539
243 Ga0501043_0125175 3300049579 Bacteria 2015
244 Ga0501046_0041435 3300049580 Bacteria 3675
245 Ga0501047_0067948 3300049581 Bacteria 3433
246 Ga0501070_0005046 3300049586 Bacteria 11258
247 Ga0501080_0061620 3300049742 Bacteria 3492
248 Ga0501035_0022571 3300049822 Bacteria 5779
249 Ga0501035_0122067 3300049822 Bacteria 2277
250 Ga0501044_0051282 3300049823 Bacteria 4254
251 Ga0501044_0142032 3300049823 Bacteria 2389
252 Ga0501044_0181691 3300049823 Bacteria 2070
253 Ga0501044_1215618 3300049823 Bacteria 621
254 nmdc:mga06z11_93521_c1 3300050494 Bacteria 1637
255 Ga0500560_097623 3300053107 Bacteria 984
256 Ga0500560_188450 3300053107 Bacteria 672
257 Ga0500600_0045793 3300053149 Bacteria 2502
258 Ga0500600_0199479 3300053149 Bacteria 944
259 Ga0466962_0000182 3300061719 Bacteria 26106
260 2547408954 2547132111 Bacteria 8013147
261 2585306504 2582581313 Bacteria 10042643
262 2585320040 2582581314 Bacteria 11452267
263 2616693296 2616644814 Bacteria 11555299
264 2644442070 2643221678 Bacteria 9540101
265 2644631667 2643221714 Bacteria 9015452
266 2768643937 2767802112 Bacteria 6465194
267 2784586345 2784132148 Bacteria 8627943
268 2786667679 2786546132 Bacteria 10419719
269 2808847140 2808606359 Bacteria 9866990
270 2808917947 2808606375 Bacteria 9466072
271 2809229845 2808606448 Bacteria 8656184
272 2855683747 2855683550 Bacteria 7134265
273 2862290161 2862281513 Bacteria 9621493
274 2862391929 2862382967 Bacteria 10317375
275 2862514769 2862507626 Bacteria 9425308
276 2862580429 2862574272 Bacteria 10567477
277 2863408052 2863404153 Bacteria 9672205
278 2867321423 2867319477 Bacteria 7069771
279 2873157916 2873151551 Bacteria 8625867
280 2912723142 2912715099 Bacteria 9460473
281 2912726606 2912723979 Bacteria 8557534
282 2919469994 2919468124 Bacteria 9133025
283 2946073481 2946072368 Bacteria 8999607
284 2947232387 2947224130 Bacteria 9938529
285 2954673819 2954673503 Bacteria 9685905
286 2954690172 2954682443 Bacteria 9862841
287 2954700022 2954691527 Bacteria 10720516
288 2954702196 2954701450 Bacteria 10834262
289 2954718848 2954711539 Bacteria 10867210
290 2954728818 2954721474 Bacteria 10456478
291 2954732994 2954731030 Bacteria 10243860
292 2954751874 2954749733 Bacteria 10366972
293 2954766839 2954759201 Bacteria 9358192
294 3006394403 3006393351 Bacteria 6615579
295 8008560629 8008558824 Bacteria 10610750
296 8008581162 8008574985 Bacteria 7815457
297 8023624468 8023623736 Bacteria 8593882
298 8025481217 8025478263 Bacteria 8209203
299 8056832754 8056829672 Bacteria 9045328
300 Ga0450897_015412
301 JGI24739J22299_10045489
302 JGI24737J22298_10061366
303 JGI24735J21928_10156898
304 JGI24738J21930_10041160
305 rootH1_10074698
306 rootH1_10043571
307 Ga0070663_100154308
308 Ga0068853_100161684
309 Ga0068853_100515264
310 Ga0070665_100423578
311 Ga0068855_100044652
312 Ga0068855_100363192
313 Ga0068854_100230665
314 Ga0068854_100265298
315 Ga0068856_100228364
316 Ga0068852_100010465
317 Ga0068851_10193606
318 Ga0081455_10068552
319 Ga0070715_10504684
320 Ga0075367_10072188
321 Ga0105251_10087491
322 Ga0105240_10031074
323 Ga0105243_10436043
324 Ga0105243_12186592
325 Ga0105241_10025005
326 Ga0105238_10043357
327 Ga0105238_11077893
328 Ga0105239_10358098
329 Ga0105239_10817245
330 Ga0157369_10041246
331 Ga0157374_10129429
332 Ga0182008_10001610
333 Ga0182007_10005470
334 Ga0183367_1003
335 Ga0207647_10005022
336 Ga0207647_10023187
337 Ga0207685_10032907
338 Ga0207685_10385911
339 Ga0207705_10395732
340 Ga0207654_10022062
341 Ga0207695_10132881
342 Ga0207671_10000748
343 Ga0207694_10025142
344 Ga0207691_10657870
345 Ga0207667_10216138
346 Ga0207667_10500028
347 Ga0207640_10154794
348 Ga0207640_10199058
349 Ga0207639_10119761
350 Ga0207678_10118133
351 Ga0207698_10006204
352 Ga0209813_10009536
353 Ga0268266_10300417
354 Ga0307515_10030191
355 Ga0307515_10054676
356 Ga0307512_10001476
357 Ga0307512_10031121
358 Ga0307508_10004538
359 Ga0307508_10122725
360 Ga0307514_10005798
361 Ga0307514_10082203
362 Ga0307516_10031212
363 Ga0307518_10082185
364 Ga0307518_10108491
365 Ga0307510_10075312
366 Ga0307510_10267283
367 Ga0395898_0027824
368 Ga0395898_1098215
369 Ga0395905_0071895
370 Ga0395901_0256677
371 Ga0451841_1154986
372 Ga0451853_0773861
373 Ga0451853_1285506
374 Ga0451853_3616581
375 Ga0439449_0004122
376 Ga0439449_0006819
377 Ga0439449_0143070
378 Ga0439455_0001299
379 Ga0439455_0034785
380 Ga0450894_000110
381 Ga0450903_002093
382 Ga0450906_001115
383 Ga0439458_0025991
384 Ga0439458_0053141
385 Ga0466969_0005590
386 Ga0466969_0063625
387 Ga0466972_0048822
388 Ga0466965_0001600
389 Ga0466966_0001512
390 Ga0466961_0002718
391 Ga0466961_0039644
392 Ga0466963_0000924
393 Ga0466963_0047275
394 Ga0466964_0094036
395 Ga0466964_0234057
396 Ga0466971_0001812
397 Ga0466970_0000459
398 Ga0466970_0004210
399 Ga0466970_0056462
400 Ga0466957_0002411
401 Ga0466957_0148932
402 Ga0466959_0000407
403 Ga0466958_0000629
404 Ga0466958_0151540
405 Ga0466967_0002626
406 Ga0466967_0162320
407 Ga0466967_0289756
408 Ga0466967_1659640
409 Ga0495627_084561
410 Ga0495592_0172643
411 Ga0495603_0015419
412 Ga0495603_0031723
413 Ga0495603_0339106
414 Ga0495603_0341173
415 Ga0495603_0479259
416 Ga0495629_0040097
417 Ga0495629_0059155
418 Ga0495629_0095335
419 Ga0495629_0367949
420 Ga0495638_0047568
421 Ga0495638_0380893
422 Ga0495651_0020188
423 Ga0495582_0102490
424 Ga0495605_0003375
425 Ga0495605_0135034
426 Ga0495605_0286373
427 Ga0495639_0013008
428 Ga0495662_0020136
429 Ga0495662_0025506
430 Ga0495662_0100161
431 Ga0495662_0101953
432 Ga0495585_0143420
433 Ga0495594_0006468
434 Ga0495594_0015561
435 Ga0495594_0101196
436 Ga0495594_0138150
437 Ga0495594_0331554
438 Ga0495607_0036383
439 Ga0495583_0013025
440 Ga0495583_0060312
441 Ga0495606_0019391
442 Ga0495606_0241810
443 Ga0495608_0402120
444 Ga0495610_0026077
445 Ga0495616_0012684
446 Ga0495618_0191805
447 Ga0495618_0272567
448 Ga0495620_0027084
449 Ga0495620_0043412
450 Ga0495628_0004534
451 Ga0495628_0092128
452 Ga0495628_0126639
453 Ga0495631_0002194
454 Ga0495643_0026535
455 Ga0495644_0088356
456 Ga0495648_0040133
457 Ga0495648_0176176
458 Ga0495666_0045637
459 Ga0495652_0006486
460 Ga0495652_0109449
461 Ga0495640_0009664
462 Ga0495640_0363919
463 Ga0495609_0015882
464 Ga0495597_0043702
465 Ga0495645_0003837
466 Ga0495622_0142050
467 Ga0495622_0198096
468 Ga0495622_0245473
469 Ga0495633_0009958
470 Ga0495633_0094192
471 Ga0495668_0035092
472 Ga0495668_0122342
473 Ga0495634_0334583
474 Ga0495611_0018667
475 Ga0495611_0099655
476 Ga0495625_0007642
477 Ga0495625_0020792
478 Ga0495635_0085552
479 Ga0495661_0031539
480 Ga0495588_0000456
481 Ga0495588_0168105
482 Ga0495657_0026691
483 Ga0495657_0043956
484 Ga0495657_0122010
485 Ga0495623_0020208
486 Ga0495613_0005357
487 Ga0495613_0011068
488 Ga0495613_0033715
489 Ga0495613_0057052
490 Ga0495613_0138689
491 Ga0495613_0157635
492 Ga0495624_0074054
493 Ga0495670_0239947
494 Ga0495589_0005478
495 Ga0495589_0008678
496 Ga0495589_0026502
497 Ga0495589_0050180
498 Ga0495600_0041548
499 Ga0495600_0094015
500 Ga0495660_0070476
501 Ga0495581_0107163
502 Ga0495604_0035541
503 Ga0495604_0130583
504 Ga0495636_0000378
505 Ga0495636_0116581
506 Ga0495674_0127820
507 Ga0495676_0009493
508 Ga0495676_0102183
509 Ga0495676_0122380
510 Ga0495676_0268498
511 Ga0495680_0008869
512 Ga0495683_0022872
513 Ga0495683_0073059
514 Ga0495687_022205
515 Ga0495687_045445
516 Ga0495687_049710
517 Ga0495687_072001
518 Ga0495687_094861
519 Ga0495687_116777
520 Ga0495687_166874
521 Ga0495685_006043
522 Ga0495685_009036
523 Ga0495685_019386
524 Ga0495686_0017484
525 Ga0495686_0235309
526 Ga0495614_0237542
527 Ga0495626_0024890
528 Ga0496109_0084805
529 Ga0496119_0210087
530 Ga0495678_073274
531 Ga0495682_0143062
532 Ga0501033_0000804
533 Ga0501033_0420958
534 Ga0501034_0039202
535 Ga0501036_0030127
536 Ga0501036_0042744
537 Ga0501038_0308523
538 Ga0501039_0004258
539 Ga0501041_0880409
540 Ga0501042_0310641
541 Ga0501043_0002501
542 Ga0501043_0125175
543 Ga0501046_0041435
544 Ga0501047_0067948
545 Ga0501070_0005046
546 Ga0501080_0061620
547 Ga0501035_0022571
548 Ga0501035_0122067
549 Ga0501044_0051282
550 Ga0501044_0142032
551 Ga0501044_0181691
552 Ga0501044_1215618
553 nmdc:mga06z11_93521_c1
554 Ga0500560_097623
555 Ga0500560_188450
556 Ga0500600_0045793
557 Ga0500600_0199479
558 Ga0466962_0000182
559 2547408954
560 2585306504
561 2585320040
562 2616693296
563 2644442070
564 2644631667
565 2768643937
566 2784586345
567 2786667679
568 2808847140
569 2808917947
570 2809229845
571 2855683747
572 2862290161
573 2862391929
574 2862514769
575 2862580429
576 2863408052
577 2867321423
578 2873157916
579 2912723142
580 2912726606
581 2919469994
582 2946073481
583 2947232387
584 2954673819
585 2954690172
586 2954700022
587 2954702196
588 2954718848
589 2954728818
590 2954732994
591 2954751874
592 2954766839
593 3006394403
594 8008560629
595 8008581162
596 8023624468
597 8025481217
598 8056832754

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

54

166

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

31

157

0.84

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

74

159

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.8792 10 150
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.866 10 150
3e0k-assembly1.cif.gz_A-2 crystal structure of c-termianl domain of n-acetylglutamate synthase from vibrio parahaemolyticus 0.8622 8 149
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.8616 8 178
7daj-assembly1.cif.gz_B the crystal structure of serotonin n-acetyltransferase in complex with acetyl-coa from oryza sativa 0.8606 8 146
ID Description Score Start End Superfamily
af_Q54U46_65_201_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.924 70 157 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8944 53 178 3.40.630.30
af_P76539_1_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8702 10 150 3.40.630.30
4qvtA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8689 10 142 3.40.630.30
4pv6F00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8622 5 179 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A818NTL2-F1-model_v4 N-acetyltransferase domain-containing protein 0.9826 94 178 GO:0016747
AF-A0A1I1N1P7-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.9809 8 179 GO:0005840
GO:0016747
AF-A0A0Q8PZ50-F1-model_v4 GCN5 family acetyltransferase 0.9805 6 178 GO:0016747
AF-A0A7G9SAQ8-F1-model_v4 GNAT family N-acetyltransferase 0.9805 10 179 GO:0016747
AF-A0A5C4RS21-F1-model_v4 GNAT family N-acetyltransferase 0.9773 8 178 GO:0016747

Map