F394900

General Info

Members Datasets Scaffolds Average Seq Length
299 211 295 169

Family's Representative Sequence

Representative Sequence 3300031595|Ga0265313_10011030|Ga0265313_100110305
Length 201
Sequence MDVLSPHWPRDRLSFGPTTNLTPLKKAQRIMTISMYQASVPVFVRMLDNLSTILDKATQHAAQRKIEPSVLLNTRLFPDMFPLLRQVQLTADFAKGTAARLAGVEVPKFADAEASFDELKVRIAKSIDFIKSFKPAQIDGSEERDITIPIGGQPQHFKGQTYLLHQAMPNFYFHATTTYAILRHCGVEVGKRDFLGPLNAS

Samples

Sample ID Description Type Environment
1 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
2 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
3 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
4 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
128 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
155 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
175 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
176 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
177 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
204 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
205 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
206 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
209 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.66
Metatranscriptomes 0
Isolates 1.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0
Rhizoplane 0.67
Rhizosphere 88.96
Stem 0
Stem Tuber 0
Unclassified 5.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065714_10270097 3300005288 Bacteria 741
2 Ga0065712_10198545 3300005290 Bacteria 1118
3 Ga0070658_10471671 3300005327 Unclassified 1083
4 Ga0070690_100055244 3300005330 Bacteria 2543
5 Ga0070670_100000274 3300005331 Bacteria 45804
6 Ga0068869_100004208 3300005334 Bacteria 8935
7 Ga0068869_100050013 3300005334 Bacteria 3029
8 Ga0070666_10029604 3300005335 Bacteria 3601
9 Ga0070666_10066280 3300005335 Bacteria 2450
10 Ga0070666_10761838 3300005335 Bacteria 712
11 Ga0068868_100082275 3300005338 Bacteria 2582
12 Ga0068868_100446362 3300005338 Bacteria 1124
13 Ga0068868_100957312 3300005338 Bacteria 781
14 Ga0068868_101198276 3300005338 Bacteria 702
15 Ga0070661_100188291 3300005344 Bacteria 1573
16 Ga0070668_100005409 3300005347 Bacteria 9480
17 Ga0070668_100005976 3300005347 Bacteria 9030
18 Ga0070668_100188258 3300005347 Bacteria 1689
19 Ga0070669_100063162 3300005353 Bacteria 2725
20 Ga0070669_100139322 3300005353 Bacteria 1869
21 Ga0070669_100193750 3300005353 Bacteria 1595
22 Ga0070675_100054056 3300005354 Bacteria 3303
23 Ga0070675_100444259 3300005354 Bacteria 1162
24 Ga0070675_101468218 3300005354 Bacteria 629
25 Ga0070671_100002970 3300005355 Bacteria 13198
26 Ga0070671_100890650 3300005355 Bacteria 777
27 Ga0070674_100083570 3300005356 Bacteria 2287
28 Ga0070674_100192273 3300005356 Bacteria 1571
29 Ga0070673_100003645 3300005364 Bacteria 9641
30 Ga0070673_101624031 3300005364 Bacteria 611
31 Ga0070667_100000131 3300005367 Bacteria 94986
32 Ga0070667_100002746 3300005367 Bacteria 15229
33 Ga0070667_100192292 3300005367 Bacteria 1808
34 Ga0070713_100222473 3300005436 Bacteria 1713
35 Ga0070701_10277956 3300005438 Bacteria 1021
36 Ga0070700_100125797 3300005441 Bacteria 1723
37 Ga0070700_100738539 3300005441 Bacteria 786
38 Ga0070663_100181946 3300005455 Bacteria 1631
39 Ga0070678_100573718 3300005456 Bacteria 1004
40 Ga0070662_101356427 3300005457 Bacteria 612
41 Ga0068867_100001239 3300005459 Bacteria 17579
42 Ga0068867_100070974 3300005459 Bacteria 2604
43 Ga0070707_100824410 3300005468 Bacteria 892
44 Ga0070679_100324579 3300005530 Unclassified 1488
45 Ga0070672_100688165 3300005543 Bacteria 895
46 Ga0070693_100329750 3300005547 Bacteria 1038
47 Ga0070693_100536624 3300005547 Bacteria 835
48 Ga0070665_100035735 3300005548 Bacteria 4998
49 Ga0070665_100185455 3300005548 Bacteria 2081
50 Ga0068855_100432653 3300005563 Bacteria 1438
51 Ga0070664_100088678 3300005564 Bacteria 2674
52 Ga0070702_100752653 3300005615 Bacteria 748
53 Ga0068852_100391497 3300005616 Bacteria 1365
54 Ga0068859_100006372 3300005617 Bacteria 11971
55 Ga0068864_100048367 3300005618 Bacteria 3656
56 Ga0068864_100179171 3300005618 Bacteria 1937
57 Ga0068861_100000686 3300005719 Bacteria 20214
58 Ga0068870_10367898 3300005840 Bacteria 927
59 Ga0068863_100002100 3300005841 Bacteria 19742
60 Ga0068863_100005504 3300005841 Bacteria 12458
61 Ga0068858_100033232 3300005842 Bacteria 4789
62 Ga0068860_100000013 3300005843 Bacteria 323055
63 Ga0068860_100096671 3300005843 Bacteria 2815
64 Ga0068862_100130788 3300005844 Bacteria 2220
65 Ga0068862_100164378 3300005844 Bacteria 1983
66 Ga0068862_100188365 3300005844 Bacteria 1855
67 Ga0068862_101733040 3300005844 Bacteria 633
68 Ga0070716_100407636 3300006173 Bacteria 979
69 Ga0070716_101488399 3300006173 Unclassified 553
70 Ga0075362_10140412 3300006177 Bacteria 1154
71 Ga0075367_10117742 3300006178 Bacteria 1635
72 Ga0097621_100162188 3300006237 Bacteria 1922
73 Ga0097621_101184765 3300006237 Bacteria 719
74 Ga0075370_10048233 3300006353 Bacteria 2413
75 Ga0075370_10105474 3300006353 Bacteria 1634
76 Ga0068871_100231666 3300006358 Bacteria 1603
77 Ga0068871_100610151 3300006358 Bacteria 993
78 Ga0075428_100202317 3300006844 Bacteria 2146
79 Ga0075434_100333951 3300006871 Bacteria 1536
80 Ga0075429_100073591 3300006880 Bacteria 2976
81 Ga0075436_101160531 3300006914 Bacteria 582
82 Ga0097620_100006371 3300006931 Bacteria 11971
83 Ga0075435_100727193 3300007076 Unclassified 863
84 Ga0111539_10966246 3300009094 Bacteria 990
85 Ga0114129_10007310 3300009147 Bacteria 15728
86 Ga0105248_10050686 3300009177 Bacteria 4656
87 Ga0105248_10627088 3300009177 Bacteria 1213
88 Ga0105249_10715799 3300009553 Unclassified 1062
89 Ga0105246_10403576 3300011119 Bacteria 1136
90 Ga0157374_10163635 3300013296 Bacteria 2168
91 Ga0157378_10712223 3300013297 Bacteria 1024
92 Ga0163162_10000003 3300013306 Bacteria 698280
93 Ga0163162_11587744 3300013306 Bacteria 746
94 Ga0182008_10008890 3300014497 Bacteria 5449
95 Ga0157376_10060564 3300014969 Bacteria 3180
96 Ga0182006_1000161 3300015261 Bacteria 71421
97 Ga0182007_10023095 3300015262 Bacteria 2190
98 Ga0182005_1004688 3300015265 Bacteria 4370
99 Ga0209025_1097390 3300025294 Bacteria 942
100 Ga0209257_1072668 3300025304 Bacteria 902
101 Ga0207688_10549794 3300025901 Bacteria 725
102 Ga0207680_10043121 3300025903 Bacteria 2644
103 Ga0207645_10060018 3300025907 Bacteria 2429
104 Ga0207643_10202632 3300025908 Bacteria 1209
105 Ga0207707_10317552 3300025912 Bacteria 1345
106 Ga0207646_10674934 3300025922 Bacteria 925
107 Ga0207681_10046277 3300025923 Bacteria 2926
108 Ga0207650_10004970 3300025925 Bacteria 9088
109 Ga0207659_10013330 3300025926 Bacteria 5261
110 Ga0207659_10064355 3300025926 Bacteria 2654
111 Ga0207687_10988565 3300025927 Bacteria 721
112 Ga0207664_11409059 3300025929 Bacteria 618
113 Ga0207706_10673944 3300025933 Bacteria 885
114 Ga0207669_10127096 3300025937 Bacteria 1744
115 Ga0207669_10286468 3300025937 Bacteria 1245
116 Ga0207665_10255106 3300025939 Bacteria 1297
117 Ga0207691_10135402 3300025940 Bacteria 2173
118 Ga0207711_10038080 3300025941 Bacteria 4088
119 Ga0207689_10000147 3300025942 Bacteria 60540
120 Ga0207651_10010054 3300025960 Bacteria 5220
121 Ga0207712_10516452 3300025961 Unclassified 1023
122 Ga0207668_10002244 3300025972 Bacteria 11271
123 Ga0207668_10057922 3300025972 Bacteria 2705
124 Ga0207668_10109501 3300025972 Bacteria 2069
125 Ga0207668_10333200 3300025972 Bacteria 1263
126 Ga0207658_10000067 3300025986 Bacteria 116584
127 Ga0207658_10002875 3300025986 Bacteria 12338
128 Ga0207658_10388456 3300025986 Bacteria 1224
129 Ga0207658_10440647 3300025986 Bacteria 1152
130 Ga0207677_10417560 3300026023 Bacteria 1142
131 Ga0207703_10003494 3300026035 Bacteria 13148
132 Ga0207678_10031878 3300026067 Bacteria 4595
133 Ga0207708_10126419 3300026075 Bacteria 1996
134 Ga0207708_10697671 3300026075 Bacteria 867
135 Ga0207648_10113613 3300026089 Bacteria 2379
136 Ga0207676_10010379 3300026095 Bacteria 6632
137 Ga0207676_10223126 3300026095 Bacteria 1680
138 Ga0207676_10770164 3300026095 Bacteria 937
139 Ga0207675_100799750 3300026118 Bacteria 956
140 Ga0207698_10227524 3300026142 Bacteria 1690
141 Ga0207698_11361751 3300026142 Unclassified 725
142 Ga0268266_10425098 3300028379 Unclassified 1259
143 Ga0268266_10499483 3300028379 Bacteria 1161
144 Ga0268265_10051286 3300028380 Bacteria 3114
145 Ga0268265_10157697 3300028380 Bacteria 1923
146 Ga0268265_10187395 3300028380 Bacteria 1783
147 Ga0268265_11725487 3300028380 Bacteria 632
148 Ga0268264_10000039 3300028381 Bacteria 376641
149 Ga0268264_10008780 3300028381 Bacteria 8386
150 Ga0268264_10763026 3300028381 Bacteria 964
151 Ga0265334_10250464 3300028573 Bacteria 610
152 Ga0265338_10000011 3300028800 Bacteria 433370
153 Ga0265332_10016011 3300031238 Bacteria 3309
154 Ga0265320_10073356 3300031240 Bacteria 1608
155 Ga0265325_10000002 3300031241 Bacteria 396758
156 Ga0265325_10068672 3300031241 Bacteria 1783
157 Ga0265340_10088861 3300031247 Bacteria 1447
158 Ga0265339_10000210 3300031249 Bacteria 48022
159 Ga0265339_10041530 3300031249 Bacteria 2552
160 Ga0265339_10059631 3300031249 Bacteria 2057
161 Ga0265339_10161164 3300031249 Bacteria 1129
162 Ga0265331_10004335 3300031250 Bacteria 8882
163 Ga0265331_10004378 3300031250 Bacteria 8831
164 Ga0265331_10007067 3300031250 Bacteria 6546
165 Ga0265327_10000077 3300031251 Bacteria 211850
166 Ga0265316_10107116 3300031344 Bacteria 2120
167 Ga0265313_10003445 3300031595 Bacteria 12798
168 Ga0265313_10005362 3300031595 Bacteria 9464
169 Ga0265313_10011030 3300031595 Bacteria 5645
170 Ga0265313_10099120 3300031595 Bacteria 1295
171 Ga0265314_10029854 3300031711 Bacteria 4046
172 Ga0265314_10030043 3300031711 Bacteria 4028
173 Ga0265342_10004548 3300031712 Bacteria 10857
174 Ga0265342_10039543 3300031712 Bacteria 2865
175 Ga0307405_10052400 3300031731 Bacteria 2537
176 Ga0307405_10418396 3300031731 Bacteria 1054
177 Ga0307412_10007145 3300031911 Bacteria 6338
178 Ga0307412_10059729 3300031911 Bacteria 2556
179 Ga0307416_101531744 3300032002 Bacteria 772
180 Ga0373932_0023037 3300035112 Unclassified 1661
181 Ga0395905_0245251 3300037471 Bacteria 1674
182 Ga0395905_0335075 3300037471 Bacteria 1404
183 Ga0436364_0888144 3300037853 Bacteria 2125
184 Ga0436360_0787492 3300039438 Bacteria 1268
185 Ga0436360_1078989 3300039438 Bacteria 770
186 Ga0436361_0277057 3300039447 Unclassified 628
187 Ga0436361_0718484 3300039447 Bacteria 2569
188 Ga0436363_1546514 3300039450 Bacteria 1160
189 Ga0436362_0023373 3300039453 Bacteria 1355
190 Ga0436362_0640269 3300039453 Bacteria 681
191 Ga0439436_0000023 3300041404 Bacteria 58899
192 Ga0439436_0064985 3300041404 Bacteria 1019
193 Ga0439465_0003056 3300041413 Bacteria 5476
194 Ga0451853_3597318 3300041512 Bacteria 2528
195 Ga0453683_0076348 3300044673 Bacteria 2098
196 Ga0466959_0206300 3300045049 Bacteria 1367
197 Ga0451576_1599527 3300045051 Bacteria 676
198 Ga0466967_0562718 3300045976 Bacteria 1123
199 Ga0495653_0082148 3300046463 Bacteria 2379
200 Ga0495653_0218755 3300046463 Bacteria 1281
201 Ga0495650_0253876 3300046471 Bacteria 597
202 Ga0495582_0000505 3300046473 Bacteria 21400
203 Ga0495605_0263686 3300046474 Bacteria 735
204 Ga0495584_0081712 3300046491 Bacteria 1626
205 Ga0495585_0000024 3300046492 Bacteria 148384
206 Ga0495596_0005925 3300046500 Bacteria 5701
207 Ga0495583_0260473 3300046506 Bacteria 694
208 Ga0495606_0092873 3300046507 Bacteria 1852
209 Ga0495606_0277489 3300046507 Bacteria 918
210 Ga0495610_0001255 3300046512 Bacteria 22785
211 Ga0495630_0023695 3300046517 Bacteria 4538
212 Ga0495631_0000130 3300046518 Bacteria 50580
213 Ga0495631_0049287 3300046518 Bacteria 1844
214 Ga0495643_0020041 3300046522 Bacteria 3863
215 Ga0495648_0210009 3300046524 Bacteria 968
216 Ga0495666_0042659 3300046526 Bacteria 2192
217 Ga0495642_0047363 3300046528 Bacteria 1761
218 Ga0495652_0076356 3300046529 Bacteria 2779
219 Ga0495665_0004003 3300046531 Bacteria 7945
220 Ga0495587_0009436 3300046536 Bacteria 6254
221 Ga0495587_0030017 3300046536 Bacteria 3298
222 Ga0495587_0094812 3300046536 Bacteria 1723
223 Ga0495609_0001226 3300046538 Bacteria 17689
224 Ga0495622_0145022 3300046557 Bacteria 1076
225 Ga0495668_0021570 3300046616 Bacteria 3691
226 Ga0495634_0003162 3300046642 Bacteria 13321
227 Ga0495611_0034767 3300046648 Bacteria 2229
228 Ga0495661_0000383 3300046665 Bacteria 47361
229 Ga0495588_0055030 3300046674 Bacteria 2053
230 Ga0495623_0004908 3300046679 Bacteria 8765
231 Ga0495623_0082261 3300046679 Bacteria 1990
232 Ga0495670_0015299 3300046691 Bacteria 3771
233 Ga0495589_0042299 3300046794 Bacteria 2271
234 Ga0495600_0011253 3300046809 Bacteria 5572
235 Ga0495604_0034397 3300047317 Bacteria 4008
236 Ga0495672_0030475 3300047320 Bacteria 3382
237 Ga0495676_0612054 3300047321 Bacteria 709
238 Ga0495683_0269334 3300047323 Bacteria 741
239 Ga0495675_0016571 3300047444 Bacteria 4662
240 Ga0495675_0101912 3300047444 Bacteria 1796
241 Ga0495677_0018053 3300047445 Bacteria 2557
242 Ga0495673_0009214 3300047469 Bacteria 5481
243 Ga0495686_0000738 3300047472 Bacteria 43615
244 Ga0495626_0000014 3300048091 Bacteria 246660
245 Ga0495626_0054909 3300048091 Bacteria 1828
246 Ga0496115_0294183 3300048918 Bacteria 1331
247 Ga0496115_0724973 3300048918 Bacteria 780
248 Ga0496117_0024502 3300048920 Bacteria 4771
249 Ga0496118_0011158 3300048921 Bacteria 8801
250 Ga0496119_0011034 3300048922 Bacteria 7534
251 Ga0496120_0025265 3300048923 Bacteria 3690
252 Ga0496121_0009772 3300048924 Bacteria 10967
253 Ga0496122_0008238 3300048925 Bacteria 11315
254 Ga0496123_0030559 3300048926 Bacteria 3941
255 Ga0496124_0404704 3300048927 Unclassified 946
256 Ga0496125_0054369 3300048928 Bacteria 3272
257 Ga0495682_0107539 3300049460 Bacteria 999
258 Ga0501039_0246208 3300049575 Bacteria 1406
259 Ga0501047_0004162 3300049581 Bacteria 13615
260 Ga0501067_0007254 3300049583 Bacteria 6155
261 Ga0501070_0176827 3300049586 Bacteria 1757
262 Ga0501072_0007532 3300049588 Bacteria 8261
263 Ga0501073_0004084 3300049589 Bacteria 10948
264 Ga0501073_0031552 3300049589 Bacteria 3780
265 Ga0501074_0055363 3300049590 Bacteria 2859
266 Ga0501074_0187798 3300049590 Bacteria 1474
267 Ga0501076_0312551 3300049592 Bacteria 1289
268 Ga0501079_0184211 3300049741 Bacteria 1630
269 Ga0501079_0208800 3300049741 Bacteria 1525
270 Ga0501079_0926503 3300049741 Bacteria 686
271 Ga0501080_0032457 3300049742 Bacteria 4871
272 Ga0501080_0045744 3300049742 Bacteria 4074
273 Ga0501083_0003903 3300049744 Bacteria 10472
274 Ga0501083_0680365 3300049744 Bacteria 669
275 Ga0501035_0870054 3300049822 Bacteria 716
276 Ga0501045_0231349 3300049824 Bacteria 1376
277 nmdc:mga07m45_42635_c1 3300050496 Bacteria 2544
278 nmdc:mga05p37_52115_c1 3300050507 Bacteria 5032
279 nmdc:mga09592_36102_c1 3300050508 Bacteria 4139
280 nmdc:mga08y16_38649_c1 3300050511 Bacteria 5009
281 nmdc:mga0rr50_287105_c1 3300050513 Bacteria 1374
282 nmdc:mga08x19_966761_c1 3300050514 Bacteria 605
283 Ga0500607_000844 3300053121 Bacteria 29501
284 Ga0500608_212305 3300053122 Unclassified 789
285 Ga0500559_0002821 3300053136 Bacteria 8779
286 Ga0500559_0007594 3300053136 Bacteria 4789
287 Ga0500616_0120290 3300053153 Bacteria 1255
288 Ga0500622_0252267 3300053156 Bacteria 774
289 Ga0500637_0004470 3300053178 Bacteria 6641
290 Ga0500645_000260 3300053730 Bacteria 38177
291 Ga0500645_003109 3300053730 Bacteria 6926
292 Ga0501084_0074249 3300054114 Bacteria 2848
293 Ga0501084_0814516 3300054114 Bacteria 786
294 Ga0501082_0045462 3300060353 Bacteria 3787
295 Ga0501082_0595779 3300060353 Bacteria 967

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049822 Ga0501035_0870054 Ga0501035_0870054_97_639 148
2 3300009177 Ga0105248_10050686 Ga0105248_100506863 159
3 3300005548 Ga0070665_100035735 Ga0070665_1000357355 161
4 3300026067 Ga0207678_10031878 Ga0207678_100318784 161
5 3300028379 Ga0268266_10425098 Ga0268266_104250981 161
6 3300048920 Ga0496117_0024502 Ga0496117_0024502_3876_4397 161
7 3300048921 Ga0496118_0011158 Ga0496118_0011158_2101_2622 161
8 3300048923 Ga0496120_0025265 Ga0496120_0025265_2913_3434 161
9 3300048924 Ga0496121_0009772 Ga0496121_0009772_9860_10381 161
10 3300048925 Ga0496122_0008238 Ga0496122_0008238_7400_7921 161
11 3300048926 Ga0496123_0030559 Ga0496123_0030559_120_641 161
12 3300048927 Ga0496124_0404704 Ga0496124_0404704_228_749 161
13 iso_pu_bacteria 2818991440 2819565023 162
14 iso_pu_bacteria 2904463128 2904465452 162
15 3300005327 Ga0070658_10471671 Ga0070658_104716713 163
16 3300005355 Ga0070671_100002970 Ga0070671_10000297014 163
17 3300006353 Ga0075370_10105474 Ga0075370_101054742 163
18 3300006358 Ga0068871_100610151 Ga0068871_1006101512 163
19 3300013296 Ga0157374_10163635 Ga0157374_101636351 163
20 3300031731 Ga0307405_10418396 Ga0307405_104183961 163
21 3300037471 Ga0395905_0335075 Ga0395905_0335075_450_974 163
22 3300039447 Ga0436361_0277057 Ga0436361_0277057_124_615 163
23 3300048928 Ga0496125_0054369 Ga0496125_0054369_214_732 163
24 3300053153 Ga0500616_0120290 Ga0500616_0120290_390_902 163
25 3300053156 Ga0500622_0252267 Ga0500622_0252267_57_569 163
26 3300060353 Ga0501082_0045462 Ga0501082_0045462_2383_2874 163
27 3300005338 Ga0068868_100957312 Ga0068868_1009573121 164
28 3300005347 Ga0070668_100188258 Ga0070668_1001882583 164
29 3300009094 Ga0111539_10966246 Ga0111539_109662461 164
30 3300025972 Ga0207668_10333200 Ga0207668_103332002 164
31 3300035112 Ga0373932_0023037 Ga0373932_0023037_290_787 164
32 3300039447 Ga0436361_0718484 Ga0436361_0718484_203_697 164
33 3300041512 Ga0451853_3597318 Ga0451853_3597318_1921_2433 164
34 3300046463 Ga0495653_0082148 Ga0495653_0082148_837_1331 164
35 3300046463 Ga0495653_0218755 Ga0495653_0218755_365_859 164
36 3300046473 Ga0495582_0000505 Ga0495582_0000505_6193_6687 164
37 3300046491 Ga0495584_0081712 Ga0495584_0081712_490_987 164
38 3300046500 Ga0495596_0005925 Ga0495596_0005925_3845_4342 164
39 3300046506 Ga0495583_0260473 Ga0495583_0260473_64_561 164
40 3300046517 Ga0495630_0023695 Ga0495630_0023695_1809_2303 164
41 3300046518 Ga0495631_0049287 Ga0495631_0049287_890_1387 164
42 3300046522 Ga0495643_0020041 Ga0495643_0020041_2830_3327 164
43 3300046524 Ga0495648_0210009 Ga0495648_0210009_389_886 164
44 3300046526 Ga0495666_0042659 Ga0495666_0042659_380_874 164
45 3300046528 Ga0495642_0047363 Ga0495642_0047363_431_928 164
46 3300046529 Ga0495652_0076356 Ga0495652_0076356_2263_2757 164
47 3300046531 Ga0495665_0004003 Ga0495665_0004003_6090_6584 164
48 3300046536 Ga0495587_0009436 Ga0495587_0009436_5030_5524 164
49 3300046536 Ga0495587_0030017 Ga0495587_0030017_1614_2108 164
50 3300046538 Ga0495609_0001226 Ga0495609_0001226_9790_10287 164
51 3300046557 Ga0495622_0145022 Ga0495622_0145022_52_561 164
52 3300046616 Ga0495668_0021570 Ga0495668_0021570_650_1147 164
53 3300046642 Ga0495634_0003162 Ga0495634_0003162_12792_13286 164
54 3300046648 Ga0495611_0034767 Ga0495611_0034767_1227_1724 164
55 3300046674 Ga0495588_0055030 Ga0495588_0055030_1190_1684 164
56 3300046679 Ga0495623_0004908 Ga0495623_0004908_1133_1627 164
57 3300046679 Ga0495623_0082261 Ga0495623_0082261_463_957 164
58 3300046794 Ga0495589_0042299 Ga0495589_0042299_1677_2174 164
59 3300046809 Ga0495600_0011253 Ga0495600_0011253_227_721 164
60 3300047317 Ga0495604_0034397 Ga0495604_0034397_308_802 164
61 3300047320 Ga0495672_0030475 Ga0495672_0030475_2083_2580 164
62 3300047323 Ga0495683_0269334 Ga0495683_0269334_91_588 164
63 3300047444 Ga0495675_0016571 Ga0495675_0016571_1775_2269 164
64 3300047445 Ga0495677_0018053 Ga0495677_0018053_1970_2467 164
65 3300047469 Ga0495673_0009214 Ga0495673_0009214_599_1096 164
66 3300048091 Ga0495626_0054909 Ga0495626_0054909_857_1354 164
67 3300048918 Ga0496115_0294183 Ga0496115_0294183_32_526 164
68 3300048918 Ga0496115_0724973 Ga0496115_0724973_261_755 164
69 3300049744 Ga0501083_0003903 Ga0501083_0003903_6752_7246 164
70 3300050508 nmdc:mga09592_36102_c1 nmdc:mga09592_36102_c1_2366_2875 164
71 3300050511 nmdc:mga08y16_38649_c1 nmdc:mga08y16_38649_c1_1188_1697 164
72 3300054114 Ga0501084_0814516 Ga0501084_0814516_277_771 164
73 iso_pu_bacteria 2842918807 2842922454 164
74 iso_pu_bacteria 2953994433 2953996915 164
75 3300005335 Ga0070666_10066280 Ga0070666_100662801 166
76 3300005367 Ga0070667_100000131 Ga0070667_10000013171 166
77 3300005841 Ga0068863_100005504 Ga0068863_10000550411 166
78 3300005843 Ga0068860_100000013 Ga0068860_10000001348 166
79 3300005844 Ga0068862_101733040 Ga0068862_1017330401 166
80 3300025304 Ga0209257_1072668 Ga0209257_10726681 166
81 3300025986 Ga0207658_10000067 Ga0207658_1000006771 166
82 3300028380 Ga0268265_11725487 Ga0268265_117254871 166
83 3300028381 Ga0268264_10000039 Ga0268264_1000003950 166
84 3300031731 Ga0307405_10052400 Ga0307405_100524004 166
85 3300031911 Ga0307412_10007145 Ga0307412_100071454 166
86 3300032002 Ga0307416_101531744 Ga0307416_1015317442 166
87 3300039450 Ga0436363_1546514 Ga0436363_1546514_324_827 166
88 3300005364 Ga0070673_101624031 Ga0070673_1016240311 167
89 3300005844 Ga0068862_100188365 Ga0068862_1001883652 167
90 3300006178 Ga0075367_10117742 Ga0075367_101177422 167
91 3300006237 Ga0097621_100162188 Ga0097621_1001621882 167
92 3300006353 Ga0075370_10048233 Ga0075370_100482332 167
93 3300013306 Ga0163162_10000003 Ga0163162_10000003441 167
94 3300013306 Ga0163162_11587744 Ga0163162_115877442 167
95 3300025294 Ga0209025_1097390 Ga0209025_10973901 167
96 3300025929 Ga0207664_11409059 Ga0207664_114090591 167
97 3300028380 Ga0268265_10187395 Ga0268265_101873953 167
98 3300031240 Ga0265320_10073356 Ga0265320_100733562 167
99 3300031241 Ga0265325_10068672 Ga0265325_100686723 167
100 3300031249 Ga0265339_10059631 Ga0265339_100596312 167
101 3300031344 Ga0265316_10107116 Ga0265316_101071164 167
102 3300031595 Ga0265313_10099120 Ga0265313_100991202 167
103 3300050496 nmdc:mga07m45_42635_c1 nmdc:mga07m45_42635_c1_531_1049 167
104 3300053121 Ga0500607_000844 Ga0500607_000844_1848_2366 167
105 3300053122 Ga0500608_212305 Ga0500608_212305_130_648 167
106 3300053136 Ga0500559_0002821 Ga0500559_0002821_1792_2310 167
107 3300053136 Ga0500559_0007594 Ga0500559_0007594_13_531 167
108 3300053178 Ga0500637_0004470 Ga0500637_0004470_4325_4843 167
109 3300053730 Ga0500645_003109 Ga0500645_003109_4604_5122 167
110 3300005290 Ga0065712_10198545 Ga0065712_101985451 168
111 3300005330 Ga0070690_100055244 Ga0070690_1000552443 168
112 3300005331 Ga0070670_100000274 Ga0070670_10000027414 168
113 3300005334 Ga0068869_100004208 Ga0068869_1000042083 168
114 3300005334 Ga0068869_100050013 Ga0068869_1000500131 168
115 3300005335 Ga0070666_10029604 Ga0070666_100296043 168
116 3300005335 Ga0070666_10761838 Ga0070666_107618381 168
117 3300005338 Ga0068868_100082275 Ga0068868_1000822754 168
118 3300005338 Ga0068868_100446362 Ga0068868_1004463622 168
119 3300005338 Ga0068868_101198276 Ga0068868_1011982761 168
120 3300005344 Ga0070661_100188291 Ga0070661_1001882913 168
121 3300005347 Ga0070668_100005409 Ga0070668_1000054095 168
122 3300005347 Ga0070668_100005976 Ga0070668_1000059765 168
123 3300005353 Ga0070669_100063162 Ga0070669_1000631623 168
124 3300005353 Ga0070669_100139322 Ga0070669_1001393223 168
125 3300005353 Ga0070669_100193750 Ga0070669_1001937502 168
126 3300005354 Ga0070675_100054056 Ga0070675_1000540562 168
127 3300005354 Ga0070675_100444259 Ga0070675_1004442592 168
128 3300005354 Ga0070675_101468218 Ga0070675_1014682181 168
129 3300005355 Ga0070671_100890650 Ga0070671_1008906501 168
130 3300005356 Ga0070674_100083570 Ga0070674_1000835702 168
131 3300005356 Ga0070674_100192273 Ga0070674_1001922732 168
132 3300005364 Ga0070673_100003645 Ga0070673_1000036457 168
133 3300005367 Ga0070667_100002746 Ga0070667_10000274614 168
134 3300005367 Ga0070667_100192292 Ga0070667_1001922923 168
135 3300005436 Ga0070713_100222473 Ga0070713_1002224733 168
136 3300005438 Ga0070701_10277956 Ga0070701_102779562 168
137 3300005441 Ga0070700_100125797 Ga0070700_1001257972 168
138 3300005441 Ga0070700_100738539 Ga0070700_1007385391 168
139 3300005455 Ga0070663_100181946 Ga0070663_1001819461 168
140 3300005456 Ga0070678_100573718 Ga0070678_1005737182 168
141 3300005457 Ga0070662_101356427 Ga0070662_1013564271 168
142 3300005459 Ga0068867_100001239 Ga0068867_10000123914 168
143 3300005459 Ga0068867_100070974 Ga0068867_1000709742 168
144 3300005468 Ga0070707_100824410 Ga0070707_1008244101 168
145 3300005530 Ga0070679_100324579 Ga0070679_1003245792 168
146 3300005543 Ga0070672_100688165 Ga0070672_1006881652 168
147 3300005547 Ga0070693_100329750 Ga0070693_1003297501 168
148 3300005547 Ga0070693_100536624 Ga0070693_1005366242 168
149 3300005548 Ga0070665_100185455 Ga0070665_1001854553 168
150 3300005563 Ga0068855_100432653 Ga0068855_1004326532 168
151 3300005564 Ga0070664_100088678 Ga0070664_1000886783 168
152 3300005615 Ga0070702_100752653 Ga0070702_1007526531 168
153 3300005616 Ga0068852_100391497 Ga0068852_1003914972 168
154 3300005617 Ga0068859_100006372 Ga0068859_10000637213 168
155 3300005618 Ga0068864_100048367 Ga0068864_1000483672 168
156 3300005618 Ga0068864_100179171 Ga0068864_1001791713 168
157 3300005719 Ga0068861_100000686 Ga0068861_10000068618 168
158 3300005840 Ga0068870_10367898 Ga0068870_103678982 168
159 3300005841 Ga0068863_100002100 Ga0068863_10000210018 168
160 3300005842 Ga0068858_100033232 Ga0068858_1000332323 168
161 3300005843 Ga0068860_100096671 Ga0068860_1000966712 168
162 3300005844 Ga0068862_100130788 Ga0068862_1001307882 168
163 3300005844 Ga0068862_100164378 Ga0068862_1001643781 168
164 3300006173 Ga0070716_100407636 Ga0070716_1004076361 168
165 3300006173 Ga0070716_101488399 Ga0070716_1014883991 168
166 3300006177 Ga0075362_10140412 Ga0075362_101404121 168
167 3300006237 Ga0097621_101184765 Ga0097621_1011847652 168
168 3300006358 Ga0068871_100231666 Ga0068871_1002316662 168
169 3300006844 Ga0075428_100202317 Ga0075428_1002023172 168
170 3300006871 Ga0075434_100333951 Ga0075434_1003339513 168
171 3300006880 Ga0075429_100073591 Ga0075429_1000735913 168
172 3300006914 Ga0075436_101160531 Ga0075436_1011605311 168
173 3300006931 Ga0097620_100006371 Ga0097620_1000063712 168
174 3300007076 Ga0075435_100727193 Ga0075435_1007271931 168
175 3300009147 Ga0114129_10007310 Ga0114129_100073109 168
176 3300009177 Ga0105248_10627088 Ga0105248_106270881 168
177 3300009553 Ga0105249_10715799 Ga0105249_107157992 168
178 3300011119 Ga0105246_10403576 Ga0105246_104035762 168
179 3300013297 Ga0157378_10712223 Ga0157378_107122232 168
180 3300014497 Ga0182008_10008890 Ga0182008_100088905 168
181 3300014969 Ga0157376_10060564 Ga0157376_100605643 168
182 3300015261 Ga0182006_1000161 Ga0182006_100016151 168
183 3300015262 Ga0182007_10023095 Ga0182007_100230954 168
184 3300015265 Ga0182005_1004688 Ga0182005_10046883 168
185 3300025901 Ga0207688_10549794 Ga0207688_105497942 168
186 3300025903 Ga0207680_10043121 Ga0207680_100431214 168
187 3300025907 Ga0207645_10060018 Ga0207645_100600183 168
188 3300025908 Ga0207643_10202632 Ga0207643_102026322 168
189 3300025912 Ga0207707_10317552 Ga0207707_103175522 168
190 3300025922 Ga0207646_10674934 Ga0207646_106749342 168
191 3300025923 Ga0207681_10046277 Ga0207681_100462773 168
192 3300025925 Ga0207650_10004970 Ga0207650_100049707 168
193 3300025926 Ga0207659_10013330 Ga0207659_100133303 168
194 3300025926 Ga0207659_10064355 Ga0207659_100643554 168
195 3300025927 Ga0207687_10988565 Ga0207687_109885652 168
196 3300025933 Ga0207706_10673944 Ga0207706_106739441 168
197 3300025937 Ga0207669_10127096 Ga0207669_101270962 168
198 3300025937 Ga0207669_10286468 Ga0207669_102864682 168
199 3300025939 Ga0207665_10255106 Ga0207665_102551061 168
200 3300025940 Ga0207691_10135402 Ga0207691_101354022 168
201 3300025941 Ga0207711_10038080 Ga0207711_100380804 168
202 3300025942 Ga0207689_10000147 Ga0207689_1000014751 168
203 3300025960 Ga0207651_10010054 Ga0207651_100100544 168
204 3300025961 Ga0207712_10516452 Ga0207712_105164522 168
205 3300025972 Ga0207668_10002244 Ga0207668_1000224411 168
206 3300025972 Ga0207668_10057922 Ga0207668_100579222 168
207 3300025972 Ga0207668_10109501 Ga0207668_101095013 168
208 3300025986 Ga0207658_10002875 Ga0207658_1000287512 168
209 3300025986 Ga0207658_10388456 Ga0207658_103884562 168
210 3300025986 Ga0207658_10440647 Ga0207658_104406471 168
211 3300026023 Ga0207677_10417560 Ga0207677_104175602 168
212 3300026035 Ga0207703_10003494 Ga0207703_1000349413 168
213 3300026075 Ga0207708_10126419 Ga0207708_101264192 168
214 3300026075 Ga0207708_10697671 Ga0207708_106976712 168
215 3300026089 Ga0207648_10113613 Ga0207648_101136132 168
216 3300026095 Ga0207676_10010379 Ga0207676_100103796 168
217 3300026095 Ga0207676_10223126 Ga0207676_102231263 168
218 3300026095 Ga0207676_10770164 Ga0207676_107701642 168
219 3300026118 Ga0207675_100799750 Ga0207675_1007997502 168
220 3300026142 Ga0207698_10227524 Ga0207698_102275242 168
221 3300026142 Ga0207698_11361751 Ga0207698_113617511 168
222 3300028379 Ga0268266_10499483 Ga0268266_104994832 168
223 3300028380 Ga0268265_10051286 Ga0268265_100512861 168
224 3300028380 Ga0268265_10157697 Ga0268265_101576971 168
225 3300028381 Ga0268264_10008780 Ga0268264_100087807 168
226 3300028381 Ga0268264_10763026 Ga0268264_107630262 168
227 3300028573 Ga0265334_10250464 Ga0265334_102504641 168
228 3300028800 Ga0265338_10000011 Ga0265338_10000011458 168
229 3300031238 Ga0265332_10016011 Ga0265332_100160112 168
230 3300031241 Ga0265325_10000002 Ga0265325_10000002126 168
231 3300031247 Ga0265340_10088861 Ga0265340_100888613 168
232 3300031249 Ga0265339_10000210 Ga0265339_1000021015 168
233 3300031249 Ga0265339_10041530 Ga0265339_100415302 168
234 3300031249 Ga0265339_10161164 Ga0265339_101611642 168
235 3300031250 Ga0265331_10004335 Ga0265331_100043357 168
236 3300031250 Ga0265331_10004378 Ga0265331_100043785 168
237 3300031250 Ga0265331_10007067 Ga0265331_100070674 168
238 3300031251 Ga0265327_10000077 Ga0265327_10000077123 168
239 3300031595 Ga0265313_10003445 Ga0265313_1000344511 168
240 3300031595 Ga0265313_10005362 Ga0265313_100053625 168
241 3300031595 Ga0265313_10011030 Ga0265313_100110305 168
242 3300031711 Ga0265314_10029854 Ga0265314_100298545 168
243 3300031711 Ga0265314_10030043 Ga0265314_100300434 168
244 3300031712 Ga0265342_10004548 Ga0265342_1000454811 168
245 3300031712 Ga0265342_10039543 Ga0265342_100395432 168
246 3300031911 Ga0307412_10059729 Ga0307412_100597293 168
247 3300037471 Ga0395905_0245251 Ga0395905_0245251_41_559 168
248 3300037853 Ga0436364_0888144 Ga0436364_0888144_77_601 168
249 3300039438 Ga0436360_0787492 Ga0436360_0787492_562_1086 168
250 3300039438 Ga0436360_1078989 Ga0436360_1078989_27_539 168
251 3300039453 Ga0436362_0023373 Ga0436362_0023373_73_597 168
252 3300039453 Ga0436362_0640269 Ga0436362_0640269_117_641 168
253 3300041404 Ga0439436_0000023 Ga0439436_0000023_17251_17757 168
254 3300041404 Ga0439436_0064985 Ga0439436_0064985_190_696 168
255 3300041413 Ga0439465_0003056 Ga0439465_0003056_3771_4277 168
256 3300044673 Ga0453683_0076348 Ga0453683_0076348_144_659 168
257 3300045049 Ga0466959_0206300 Ga0466959_0206300_31_555 168
258 3300045051 Ga0451576_1599527 Ga0451576_1599527_144_653 168
259 3300045976 Ga0466967_0562718 Ga0466967_0562718_268_801 168
260 3300046471 Ga0495650_0253876 Ga0495650_0253876_38_547 168
261 3300046474 Ga0495605_0263686 Ga0495605_0263686_168_674 168
262 3300046492 Ga0495585_0000024 Ga0495585_0000024_57958_58464 168
263 3300046507 Ga0495606_0092873 Ga0495606_0092873_1011_1529 168
264 3300046507 Ga0495606_0277489 Ga0495606_0277489_294_800 168
265 3300046512 Ga0495610_0001255 Ga0495610_0001255_9679_10185 168
266 3300046518 Ga0495631_0000130 Ga0495631_0000130_42783_43289 168
267 3300046536 Ga0495587_0094812 Ga0495587_0094812_993_1541 168
268 3300046665 Ga0495661_0000383 Ga0495661_0000383_27221_27727 168
269 3300046691 Ga0495670_0015299 Ga0495670_0015299_3185_3691 168
270 3300047321 Ga0495676_0612054 Ga0495676_0612054_151_657 168
271 3300047444 Ga0495675_0101912 Ga0495675_0101912_402_950 168
272 3300047472 Ga0495686_0000738 Ga0495686_0000738_14726_15232 168
273 3300048091 Ga0495626_0000014 Ga0495626_0000014_215536_216054 168
274 3300048922 Ga0496119_0011034 Ga0496119_0011034_3638_4144 168
275 3300049460 Ga0495682_0107539 Ga0495682_0107539_49_555 168
276 3300049575 Ga0501039_0246208 Ga0501039_0246208_96_617 168
277 3300049581 Ga0501047_0004162 Ga0501047_0004162_23_535 168
278 3300049583 Ga0501067_0007254 Ga0501067_0007254_5382_5894 168
279 3300049586 Ga0501070_0176827 Ga0501070_0176827_1208_1717 168
280 3300049588 Ga0501072_0007532 Ga0501072_0007532_564_1076 168
281 3300049589 Ga0501073_0004084 Ga0501073_0004084_4395_4907 168
282 3300049589 Ga0501073_0031552 Ga0501073_0031552_3256_3765 168
283 3300049590 Ga0501074_0055363 Ga0501074_0055363_2307_2816 168
284 3300049590 Ga0501074_0187798 Ga0501074_0187798_904_1416 168
285 3300049592 Ga0501076_0312551 Ga0501076_0312551_544_1122 168
286 3300049741 Ga0501079_0184211 Ga0501079_0184211_962_1567 168
287 3300049741 Ga0501079_0208800 Ga0501079_0208800_867_1382 168
288 3300049741 Ga0501079_0926503 Ga0501079_0926503_46_555 168
289 3300049742 Ga0501080_0032457 Ga0501080_0032457_3839_4348 168
290 3300049742 Ga0501080_0045744 Ga0501080_0045744_2534_3046 168
291 3300049744 Ga0501083_0680365 Ga0501083_0680365_122_637 168
292 3300049824 Ga0501045_0231349 Ga0501045_0231349_35_550 168
293 3300050507 nmdc:mga05p37_52115_c1 nmdc:mga05p37_52115_c1_3860_4381 168
294 3300050513 nmdc:mga0rr50_287105_c1 nmdc:mga0rr50_287105_c1_688_1194 168
295 3300050514 nmdc:mga08x19_966761_c1 nmdc:mga08x19_966761_c1_57_566 168
296 3300053730 Ga0500645_000260 Ga0500645_000260_23_529 168
297 3300054114 Ga0501084_0074249 Ga0501084_0074249_928_1437 168
298 3300060353 Ga0501082_0595779 Ga0501082_0595779_169_684 168
299 3300005288 Ga0065714_10270097 Ga0065714_102700971 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09351

DUF1993

Domain of unknown function (DUF1993)

35

195

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.9302 6 169
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.9001 5 169
2oqm-assembly2.cif.gz_D crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution 0.8986 6 169
3qth-assembly1.cif.gz_B crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8878 5 169
3qth-assembly1.cif.gz_A crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution 0.8451 5 169
ID Description Score Start End Superfamily
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9394 4 167 1.20.120.450
2oqmC01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9068 4 167 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8893 5 169 1.20.120.450
3qthB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8165 5 169 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.6468 13 168 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A5C9A0H4-F1-model_v4 DUF1993 domain-containing protein 0.9907 1 168
AF-G6YJU1-F1-model_v4 DUF1993 family protein 0.989 6 169
AF-A0A3B9U1D8-F1-model_v4 deleted 0.9881 1 146
AF-A0A0R2WLJ8-F1-model_v4 DUF1993 domain-containing protein 0.9877 6 168
AF-A0A3N5H1L3-F1-model_v4 DUF1993 domain-containing protein 0.9873 51 169

Feature Viewer

pLDDT pTM Quality
95.13 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map