F394900
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 299 | 211 | 295 | 169 |
Family's Representative Sequence
| Representative Sequence | 3300031595|Ga0265313_10011030|Ga0265313_100110305 |
| Length | 201 |
| Sequence | MDVLSPHWPRDRLSFGPTTNLTPLKKAQRIMTISMYQASVPVFVRMLDNLSTILDKATQHAAQRKIEPSVLLNTRLFPDMFPLLRQVQLTADFAKGTAARLAGVEVPKFADAEASFDELKVRIAKSIDFIKSFKPAQIDGSEERDITIPIGGQPQHFKGQTYLLHQAMPNFYFHATTTYAILRHCGVEVGKRDFLGPLNAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 2 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 3 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 4 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 5 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 38 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 42 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 43 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 44 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 45 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 47 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 48 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 105 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 106 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 107 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 108 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 109 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 110 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 112 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 113 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 115 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 117 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 118 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 119 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 120 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 123 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 124 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 125 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 126 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 127 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 128 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 129 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 130 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 131 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 132 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 133 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 134 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 174 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 175 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 176 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 177 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 178 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 179 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 180 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 181 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 182 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 183 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 198 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 204 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 205 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 206 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 207 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 208 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 209 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 210 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.66 |
| Metatranscriptomes | 0 |
| Isolates | 1.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.35 |
| Nodule | 0 |
| Rhizoplane | 0.67 |
| Rhizosphere | 88.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065714_10270097 | 3300005288 | Bacteria | 741 |
| 2 | Ga0065712_10198545 | 3300005290 | Bacteria | 1118 |
| 3 | Ga0070658_10471671 | 3300005327 | Unclassified | 1083 |
| 4 | Ga0070690_100055244 | 3300005330 | Bacteria | 2543 |
| 5 | Ga0070670_100000274 | 3300005331 | Bacteria | 45804 |
| 6 | Ga0068869_100004208 | 3300005334 | Bacteria | 8935 |
| 7 | Ga0068869_100050013 | 3300005334 | Bacteria | 3029 |
| 8 | Ga0070666_10029604 | 3300005335 | Bacteria | 3601 |
| 9 | Ga0070666_10066280 | 3300005335 | Bacteria | 2450 |
| 10 | Ga0070666_10761838 | 3300005335 | Bacteria | 712 |
| 11 | Ga0068868_100082275 | 3300005338 | Bacteria | 2582 |
| 12 | Ga0068868_100446362 | 3300005338 | Bacteria | 1124 |
| 13 | Ga0068868_100957312 | 3300005338 | Bacteria | 781 |
| 14 | Ga0068868_101198276 | 3300005338 | Bacteria | 702 |
| 15 | Ga0070661_100188291 | 3300005344 | Bacteria | 1573 |
| 16 | Ga0070668_100005409 | 3300005347 | Bacteria | 9480 |
| 17 | Ga0070668_100005976 | 3300005347 | Bacteria | 9030 |
| 18 | Ga0070668_100188258 | 3300005347 | Bacteria | 1689 |
| 19 | Ga0070669_100063162 | 3300005353 | Bacteria | 2725 |
| 20 | Ga0070669_100139322 | 3300005353 | Bacteria | 1869 |
| 21 | Ga0070669_100193750 | 3300005353 | Bacteria | 1595 |
| 22 | Ga0070675_100054056 | 3300005354 | Bacteria | 3303 |
| 23 | Ga0070675_100444259 | 3300005354 | Bacteria | 1162 |
| 24 | Ga0070675_101468218 | 3300005354 | Bacteria | 629 |
| 25 | Ga0070671_100002970 | 3300005355 | Bacteria | 13198 |
| 26 | Ga0070671_100890650 | 3300005355 | Bacteria | 777 |
| 27 | Ga0070674_100083570 | 3300005356 | Bacteria | 2287 |
| 28 | Ga0070674_100192273 | 3300005356 | Bacteria | 1571 |
| 29 | Ga0070673_100003645 | 3300005364 | Bacteria | 9641 |
| 30 | Ga0070673_101624031 | 3300005364 | Bacteria | 611 |
| 31 | Ga0070667_100000131 | 3300005367 | Bacteria | 94986 |
| 32 | Ga0070667_100002746 | 3300005367 | Bacteria | 15229 |
| 33 | Ga0070667_100192292 | 3300005367 | Bacteria | 1808 |
| 34 | Ga0070713_100222473 | 3300005436 | Bacteria | 1713 |
| 35 | Ga0070701_10277956 | 3300005438 | Bacteria | 1021 |
| 36 | Ga0070700_100125797 | 3300005441 | Bacteria | 1723 |
| 37 | Ga0070700_100738539 | 3300005441 | Bacteria | 786 |
| 38 | Ga0070663_100181946 | 3300005455 | Bacteria | 1631 |
| 39 | Ga0070678_100573718 | 3300005456 | Bacteria | 1004 |
| 40 | Ga0070662_101356427 | 3300005457 | Bacteria | 612 |
| 41 | Ga0068867_100001239 | 3300005459 | Bacteria | 17579 |
| 42 | Ga0068867_100070974 | 3300005459 | Bacteria | 2604 |
| 43 | Ga0070707_100824410 | 3300005468 | Bacteria | 892 |
| 44 | Ga0070679_100324579 | 3300005530 | Unclassified | 1488 |
| 45 | Ga0070672_100688165 | 3300005543 | Bacteria | 895 |
| 46 | Ga0070693_100329750 | 3300005547 | Bacteria | 1038 |
| 47 | Ga0070693_100536624 | 3300005547 | Bacteria | 835 |
| 48 | Ga0070665_100035735 | 3300005548 | Bacteria | 4998 |
| 49 | Ga0070665_100185455 | 3300005548 | Bacteria | 2081 |
| 50 | Ga0068855_100432653 | 3300005563 | Bacteria | 1438 |
| 51 | Ga0070664_100088678 | 3300005564 | Bacteria | 2674 |
| 52 | Ga0070702_100752653 | 3300005615 | Bacteria | 748 |
| 53 | Ga0068852_100391497 | 3300005616 | Bacteria | 1365 |
| 54 | Ga0068859_100006372 | 3300005617 | Bacteria | 11971 |
| 55 | Ga0068864_100048367 | 3300005618 | Bacteria | 3656 |
| 56 | Ga0068864_100179171 | 3300005618 | Bacteria | 1937 |
| 57 | Ga0068861_100000686 | 3300005719 | Bacteria | 20214 |
| 58 | Ga0068870_10367898 | 3300005840 | Bacteria | 927 |
| 59 | Ga0068863_100002100 | 3300005841 | Bacteria | 19742 |
| 60 | Ga0068863_100005504 | 3300005841 | Bacteria | 12458 |
| 61 | Ga0068858_100033232 | 3300005842 | Bacteria | 4789 |
| 62 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 63 | Ga0068860_100096671 | 3300005843 | Bacteria | 2815 |
| 64 | Ga0068862_100130788 | 3300005844 | Bacteria | 2220 |
| 65 | Ga0068862_100164378 | 3300005844 | Bacteria | 1983 |
| 66 | Ga0068862_100188365 | 3300005844 | Bacteria | 1855 |
| 67 | Ga0068862_101733040 | 3300005844 | Bacteria | 633 |
| 68 | Ga0070716_100407636 | 3300006173 | Bacteria | 979 |
| 69 | Ga0070716_101488399 | 3300006173 | Unclassified | 553 |
| 70 | Ga0075362_10140412 | 3300006177 | Bacteria | 1154 |
| 71 | Ga0075367_10117742 | 3300006178 | Bacteria | 1635 |
| 72 | Ga0097621_100162188 | 3300006237 | Bacteria | 1922 |
| 73 | Ga0097621_101184765 | 3300006237 | Bacteria | 719 |
| 74 | Ga0075370_10048233 | 3300006353 | Bacteria | 2413 |
| 75 | Ga0075370_10105474 | 3300006353 | Bacteria | 1634 |
| 76 | Ga0068871_100231666 | 3300006358 | Bacteria | 1603 |
| 77 | Ga0068871_100610151 | 3300006358 | Bacteria | 993 |
| 78 | Ga0075428_100202317 | 3300006844 | Bacteria | 2146 |
| 79 | Ga0075434_100333951 | 3300006871 | Bacteria | 1536 |
| 80 | Ga0075429_100073591 | 3300006880 | Bacteria | 2976 |
| 81 | Ga0075436_101160531 | 3300006914 | Bacteria | 582 |
| 82 | Ga0097620_100006371 | 3300006931 | Bacteria | 11971 |
| 83 | Ga0075435_100727193 | 3300007076 | Unclassified | 863 |
| 84 | Ga0111539_10966246 | 3300009094 | Bacteria | 990 |
| 85 | Ga0114129_10007310 | 3300009147 | Bacteria | 15728 |
| 86 | Ga0105248_10050686 | 3300009177 | Bacteria | 4656 |
| 87 | Ga0105248_10627088 | 3300009177 | Bacteria | 1213 |
| 88 | Ga0105249_10715799 | 3300009553 | Unclassified | 1062 |
| 89 | Ga0105246_10403576 | 3300011119 | Bacteria | 1136 |
| 90 | Ga0157374_10163635 | 3300013296 | Bacteria | 2168 |
| 91 | Ga0157378_10712223 | 3300013297 | Bacteria | 1024 |
| 92 | Ga0163162_10000003 | 3300013306 | Bacteria | 698280 |
| 93 | Ga0163162_11587744 | 3300013306 | Bacteria | 746 |
| 94 | Ga0182008_10008890 | 3300014497 | Bacteria | 5449 |
| 95 | Ga0157376_10060564 | 3300014969 | Bacteria | 3180 |
| 96 | Ga0182006_1000161 | 3300015261 | Bacteria | 71421 |
| 97 | Ga0182007_10023095 | 3300015262 | Bacteria | 2190 |
| 98 | Ga0182005_1004688 | 3300015265 | Bacteria | 4370 |
| 99 | Ga0209025_1097390 | 3300025294 | Bacteria | 942 |
| 100 | Ga0209257_1072668 | 3300025304 | Bacteria | 902 |
| 101 | Ga0207688_10549794 | 3300025901 | Bacteria | 725 |
| 102 | Ga0207680_10043121 | 3300025903 | Bacteria | 2644 |
| 103 | Ga0207645_10060018 | 3300025907 | Bacteria | 2429 |
| 104 | Ga0207643_10202632 | 3300025908 | Bacteria | 1209 |
| 105 | Ga0207707_10317552 | 3300025912 | Bacteria | 1345 |
| 106 | Ga0207646_10674934 | 3300025922 | Bacteria | 925 |
| 107 | Ga0207681_10046277 | 3300025923 | Bacteria | 2926 |
| 108 | Ga0207650_10004970 | 3300025925 | Bacteria | 9088 |
| 109 | Ga0207659_10013330 | 3300025926 | Bacteria | 5261 |
| 110 | Ga0207659_10064355 | 3300025926 | Bacteria | 2654 |
| 111 | Ga0207687_10988565 | 3300025927 | Bacteria | 721 |
| 112 | Ga0207664_11409059 | 3300025929 | Bacteria | 618 |
| 113 | Ga0207706_10673944 | 3300025933 | Bacteria | 885 |
| 114 | Ga0207669_10127096 | 3300025937 | Bacteria | 1744 |
| 115 | Ga0207669_10286468 | 3300025937 | Bacteria | 1245 |
| 116 | Ga0207665_10255106 | 3300025939 | Bacteria | 1297 |
| 117 | Ga0207691_10135402 | 3300025940 | Bacteria | 2173 |
| 118 | Ga0207711_10038080 | 3300025941 | Bacteria | 4088 |
| 119 | Ga0207689_10000147 | 3300025942 | Bacteria | 60540 |
| 120 | Ga0207651_10010054 | 3300025960 | Bacteria | 5220 |
| 121 | Ga0207712_10516452 | 3300025961 | Unclassified | 1023 |
| 122 | Ga0207668_10002244 | 3300025972 | Bacteria | 11271 |
| 123 | Ga0207668_10057922 | 3300025972 | Bacteria | 2705 |
| 124 | Ga0207668_10109501 | 3300025972 | Bacteria | 2069 |
| 125 | Ga0207668_10333200 | 3300025972 | Bacteria | 1263 |
| 126 | Ga0207658_10000067 | 3300025986 | Bacteria | 116584 |
| 127 | Ga0207658_10002875 | 3300025986 | Bacteria | 12338 |
| 128 | Ga0207658_10388456 | 3300025986 | Bacteria | 1224 |
| 129 | Ga0207658_10440647 | 3300025986 | Bacteria | 1152 |
| 130 | Ga0207677_10417560 | 3300026023 | Bacteria | 1142 |
| 131 | Ga0207703_10003494 | 3300026035 | Bacteria | 13148 |
| 132 | Ga0207678_10031878 | 3300026067 | Bacteria | 4595 |
| 133 | Ga0207708_10126419 | 3300026075 | Bacteria | 1996 |
| 134 | Ga0207708_10697671 | 3300026075 | Bacteria | 867 |
| 135 | Ga0207648_10113613 | 3300026089 | Bacteria | 2379 |
| 136 | Ga0207676_10010379 | 3300026095 | Bacteria | 6632 |
| 137 | Ga0207676_10223126 | 3300026095 | Bacteria | 1680 |
| 138 | Ga0207676_10770164 | 3300026095 | Bacteria | 937 |
| 139 | Ga0207675_100799750 | 3300026118 | Bacteria | 956 |
| 140 | Ga0207698_10227524 | 3300026142 | Bacteria | 1690 |
| 141 | Ga0207698_11361751 | 3300026142 | Unclassified | 725 |
| 142 | Ga0268266_10425098 | 3300028379 | Unclassified | 1259 |
| 143 | Ga0268266_10499483 | 3300028379 | Bacteria | 1161 |
| 144 | Ga0268265_10051286 | 3300028380 | Bacteria | 3114 |
| 145 | Ga0268265_10157697 | 3300028380 | Bacteria | 1923 |
| 146 | Ga0268265_10187395 | 3300028380 | Bacteria | 1783 |
| 147 | Ga0268265_11725487 | 3300028380 | Bacteria | 632 |
| 148 | Ga0268264_10000039 | 3300028381 | Bacteria | 376641 |
| 149 | Ga0268264_10008780 | 3300028381 | Bacteria | 8386 |
| 150 | Ga0268264_10763026 | 3300028381 | Bacteria | 964 |
| 151 | Ga0265334_10250464 | 3300028573 | Bacteria | 610 |
| 152 | Ga0265338_10000011 | 3300028800 | Bacteria | 433370 |
| 153 | Ga0265332_10016011 | 3300031238 | Bacteria | 3309 |
| 154 | Ga0265320_10073356 | 3300031240 | Bacteria | 1608 |
| 155 | Ga0265325_10000002 | 3300031241 | Bacteria | 396758 |
| 156 | Ga0265325_10068672 | 3300031241 | Bacteria | 1783 |
| 157 | Ga0265340_10088861 | 3300031247 | Bacteria | 1447 |
| 158 | Ga0265339_10000210 | 3300031249 | Bacteria | 48022 |
| 159 | Ga0265339_10041530 | 3300031249 | Bacteria | 2552 |
| 160 | Ga0265339_10059631 | 3300031249 | Bacteria | 2057 |
| 161 | Ga0265339_10161164 | 3300031249 | Bacteria | 1129 |
| 162 | Ga0265331_10004335 | 3300031250 | Bacteria | 8882 |
| 163 | Ga0265331_10004378 | 3300031250 | Bacteria | 8831 |
| 164 | Ga0265331_10007067 | 3300031250 | Bacteria | 6546 |
| 165 | Ga0265327_10000077 | 3300031251 | Bacteria | 211850 |
| 166 | Ga0265316_10107116 | 3300031344 | Bacteria | 2120 |
| 167 | Ga0265313_10003445 | 3300031595 | Bacteria | 12798 |
| 168 | Ga0265313_10005362 | 3300031595 | Bacteria | 9464 |
| 169 | Ga0265313_10011030 | 3300031595 | Bacteria | 5645 |
| 170 | Ga0265313_10099120 | 3300031595 | Bacteria | 1295 |
| 171 | Ga0265314_10029854 | 3300031711 | Bacteria | 4046 |
| 172 | Ga0265314_10030043 | 3300031711 | Bacteria | 4028 |
| 173 | Ga0265342_10004548 | 3300031712 | Bacteria | 10857 |
| 174 | Ga0265342_10039543 | 3300031712 | Bacteria | 2865 |
| 175 | Ga0307405_10052400 | 3300031731 | Bacteria | 2537 |
| 176 | Ga0307405_10418396 | 3300031731 | Bacteria | 1054 |
| 177 | Ga0307412_10007145 | 3300031911 | Bacteria | 6338 |
| 178 | Ga0307412_10059729 | 3300031911 | Bacteria | 2556 |
| 179 | Ga0307416_101531744 | 3300032002 | Bacteria | 772 |
| 180 | Ga0373932_0023037 | 3300035112 | Unclassified | 1661 |
| 181 | Ga0395905_0245251 | 3300037471 | Bacteria | 1674 |
| 182 | Ga0395905_0335075 | 3300037471 | Bacteria | 1404 |
| 183 | Ga0436364_0888144 | 3300037853 | Bacteria | 2125 |
| 184 | Ga0436360_0787492 | 3300039438 | Bacteria | 1268 |
| 185 | Ga0436360_1078989 | 3300039438 | Bacteria | 770 |
| 186 | Ga0436361_0277057 | 3300039447 | Unclassified | 628 |
| 187 | Ga0436361_0718484 | 3300039447 | Bacteria | 2569 |
| 188 | Ga0436363_1546514 | 3300039450 | Bacteria | 1160 |
| 189 | Ga0436362_0023373 | 3300039453 | Bacteria | 1355 |
| 190 | Ga0436362_0640269 | 3300039453 | Bacteria | 681 |
| 191 | Ga0439436_0000023 | 3300041404 | Bacteria | 58899 |
| 192 | Ga0439436_0064985 | 3300041404 | Bacteria | 1019 |
| 193 | Ga0439465_0003056 | 3300041413 | Bacteria | 5476 |
| 194 | Ga0451853_3597318 | 3300041512 | Bacteria | 2528 |
| 195 | Ga0453683_0076348 | 3300044673 | Bacteria | 2098 |
| 196 | Ga0466959_0206300 | 3300045049 | Bacteria | 1367 |
| 197 | Ga0451576_1599527 | 3300045051 | Bacteria | 676 |
| 198 | Ga0466967_0562718 | 3300045976 | Bacteria | 1123 |
| 199 | Ga0495653_0082148 | 3300046463 | Bacteria | 2379 |
| 200 | Ga0495653_0218755 | 3300046463 | Bacteria | 1281 |
| 201 | Ga0495650_0253876 | 3300046471 | Bacteria | 597 |
| 202 | Ga0495582_0000505 | 3300046473 | Bacteria | 21400 |
| 203 | Ga0495605_0263686 | 3300046474 | Bacteria | 735 |
| 204 | Ga0495584_0081712 | 3300046491 | Bacteria | 1626 |
| 205 | Ga0495585_0000024 | 3300046492 | Bacteria | 148384 |
| 206 | Ga0495596_0005925 | 3300046500 | Bacteria | 5701 |
| 207 | Ga0495583_0260473 | 3300046506 | Bacteria | 694 |
| 208 | Ga0495606_0092873 | 3300046507 | Bacteria | 1852 |
| 209 | Ga0495606_0277489 | 3300046507 | Bacteria | 918 |
| 210 | Ga0495610_0001255 | 3300046512 | Bacteria | 22785 |
| 211 | Ga0495630_0023695 | 3300046517 | Bacteria | 4538 |
| 212 | Ga0495631_0000130 | 3300046518 | Bacteria | 50580 |
| 213 | Ga0495631_0049287 | 3300046518 | Bacteria | 1844 |
| 214 | Ga0495643_0020041 | 3300046522 | Bacteria | 3863 |
| 215 | Ga0495648_0210009 | 3300046524 | Bacteria | 968 |
| 216 | Ga0495666_0042659 | 3300046526 | Bacteria | 2192 |
| 217 | Ga0495642_0047363 | 3300046528 | Bacteria | 1761 |
| 218 | Ga0495652_0076356 | 3300046529 | Bacteria | 2779 |
| 219 | Ga0495665_0004003 | 3300046531 | Bacteria | 7945 |
| 220 | Ga0495587_0009436 | 3300046536 | Bacteria | 6254 |
| 221 | Ga0495587_0030017 | 3300046536 | Bacteria | 3298 |
| 222 | Ga0495587_0094812 | 3300046536 | Bacteria | 1723 |
| 223 | Ga0495609_0001226 | 3300046538 | Bacteria | 17689 |
| 224 | Ga0495622_0145022 | 3300046557 | Bacteria | 1076 |
| 225 | Ga0495668_0021570 | 3300046616 | Bacteria | 3691 |
| 226 | Ga0495634_0003162 | 3300046642 | Bacteria | 13321 |
| 227 | Ga0495611_0034767 | 3300046648 | Bacteria | 2229 |
| 228 | Ga0495661_0000383 | 3300046665 | Bacteria | 47361 |
| 229 | Ga0495588_0055030 | 3300046674 | Bacteria | 2053 |
| 230 | Ga0495623_0004908 | 3300046679 | Bacteria | 8765 |
| 231 | Ga0495623_0082261 | 3300046679 | Bacteria | 1990 |
| 232 | Ga0495670_0015299 | 3300046691 | Bacteria | 3771 |
| 233 | Ga0495589_0042299 | 3300046794 | Bacteria | 2271 |
| 234 | Ga0495600_0011253 | 3300046809 | Bacteria | 5572 |
| 235 | Ga0495604_0034397 | 3300047317 | Bacteria | 4008 |
| 236 | Ga0495672_0030475 | 3300047320 | Bacteria | 3382 |
| 237 | Ga0495676_0612054 | 3300047321 | Bacteria | 709 |
| 238 | Ga0495683_0269334 | 3300047323 | Bacteria | 741 |
| 239 | Ga0495675_0016571 | 3300047444 | Bacteria | 4662 |
| 240 | Ga0495675_0101912 | 3300047444 | Bacteria | 1796 |
| 241 | Ga0495677_0018053 | 3300047445 | Bacteria | 2557 |
| 242 | Ga0495673_0009214 | 3300047469 | Bacteria | 5481 |
| 243 | Ga0495686_0000738 | 3300047472 | Bacteria | 43615 |
| 244 | Ga0495626_0000014 | 3300048091 | Bacteria | 246660 |
| 245 | Ga0495626_0054909 | 3300048091 | Bacteria | 1828 |
| 246 | Ga0496115_0294183 | 3300048918 | Bacteria | 1331 |
| 247 | Ga0496115_0724973 | 3300048918 | Bacteria | 780 |
| 248 | Ga0496117_0024502 | 3300048920 | Bacteria | 4771 |
| 249 | Ga0496118_0011158 | 3300048921 | Bacteria | 8801 |
| 250 | Ga0496119_0011034 | 3300048922 | Bacteria | 7534 |
| 251 | Ga0496120_0025265 | 3300048923 | Bacteria | 3690 |
| 252 | Ga0496121_0009772 | 3300048924 | Bacteria | 10967 |
| 253 | Ga0496122_0008238 | 3300048925 | Bacteria | 11315 |
| 254 | Ga0496123_0030559 | 3300048926 | Bacteria | 3941 |
| 255 | Ga0496124_0404704 | 3300048927 | Unclassified | 946 |
| 256 | Ga0496125_0054369 | 3300048928 | Bacteria | 3272 |
| 257 | Ga0495682_0107539 | 3300049460 | Bacteria | 999 |
| 258 | Ga0501039_0246208 | 3300049575 | Bacteria | 1406 |
| 259 | Ga0501047_0004162 | 3300049581 | Bacteria | 13615 |
| 260 | Ga0501067_0007254 | 3300049583 | Bacteria | 6155 |
| 261 | Ga0501070_0176827 | 3300049586 | Bacteria | 1757 |
| 262 | Ga0501072_0007532 | 3300049588 | Bacteria | 8261 |
| 263 | Ga0501073_0004084 | 3300049589 | Bacteria | 10948 |
| 264 | Ga0501073_0031552 | 3300049589 | Bacteria | 3780 |
| 265 | Ga0501074_0055363 | 3300049590 | Bacteria | 2859 |
| 266 | Ga0501074_0187798 | 3300049590 | Bacteria | 1474 |
| 267 | Ga0501076_0312551 | 3300049592 | Bacteria | 1289 |
| 268 | Ga0501079_0184211 | 3300049741 | Bacteria | 1630 |
| 269 | Ga0501079_0208800 | 3300049741 | Bacteria | 1525 |
| 270 | Ga0501079_0926503 | 3300049741 | Bacteria | 686 |
| 271 | Ga0501080_0032457 | 3300049742 | Bacteria | 4871 |
| 272 | Ga0501080_0045744 | 3300049742 | Bacteria | 4074 |
| 273 | Ga0501083_0003903 | 3300049744 | Bacteria | 10472 |
| 274 | Ga0501083_0680365 | 3300049744 | Bacteria | 669 |
| 275 | Ga0501035_0870054 | 3300049822 | Bacteria | 716 |
| 276 | Ga0501045_0231349 | 3300049824 | Bacteria | 1376 |
| 277 | nmdc:mga07m45_42635_c1 | 3300050496 | Bacteria | 2544 |
| 278 | nmdc:mga05p37_52115_c1 | 3300050507 | Bacteria | 5032 |
| 279 | nmdc:mga09592_36102_c1 | 3300050508 | Bacteria | 4139 |
| 280 | nmdc:mga08y16_38649_c1 | 3300050511 | Bacteria | 5009 |
| 281 | nmdc:mga0rr50_287105_c1 | 3300050513 | Bacteria | 1374 |
| 282 | nmdc:mga08x19_966761_c1 | 3300050514 | Bacteria | 605 |
| 283 | Ga0500607_000844 | 3300053121 | Bacteria | 29501 |
| 284 | Ga0500608_212305 | 3300053122 | Unclassified | 789 |
| 285 | Ga0500559_0002821 | 3300053136 | Bacteria | 8779 |
| 286 | Ga0500559_0007594 | 3300053136 | Bacteria | 4789 |
| 287 | Ga0500616_0120290 | 3300053153 | Bacteria | 1255 |
| 288 | Ga0500622_0252267 | 3300053156 | Bacteria | 774 |
| 289 | Ga0500637_0004470 | 3300053178 | Bacteria | 6641 |
| 290 | Ga0500645_000260 | 3300053730 | Bacteria | 38177 |
| 291 | Ga0500645_003109 | 3300053730 | Bacteria | 6926 |
| 292 | Ga0501084_0074249 | 3300054114 | Bacteria | 2848 |
| 293 | Ga0501084_0814516 | 3300054114 | Bacteria | 786 |
| 294 | Ga0501082_0045462 | 3300060353 | Bacteria | 3787 |
| 295 | Ga0501082_0595779 | 3300060353 | Bacteria | 967 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049822 | Ga0501035_0870054 | Ga0501035_0870054_97_639 | 148 |
| 2 | 3300009177 | Ga0105248_10050686 | Ga0105248_100506863 | 159 |
| 3 | 3300005548 | Ga0070665_100035735 | Ga0070665_1000357355 | 161 |
| 4 | 3300026067 | Ga0207678_10031878 | Ga0207678_100318784 | 161 |
| 5 | 3300028379 | Ga0268266_10425098 | Ga0268266_104250981 | 161 |
| 6 | 3300048920 | Ga0496117_0024502 | Ga0496117_0024502_3876_4397 | 161 |
| 7 | 3300048921 | Ga0496118_0011158 | Ga0496118_0011158_2101_2622 | 161 |
| 8 | 3300048923 | Ga0496120_0025265 | Ga0496120_0025265_2913_3434 | 161 |
| 9 | 3300048924 | Ga0496121_0009772 | Ga0496121_0009772_9860_10381 | 161 |
| 10 | 3300048925 | Ga0496122_0008238 | Ga0496122_0008238_7400_7921 | 161 |
| 11 | 3300048926 | Ga0496123_0030559 | Ga0496123_0030559_120_641 | 161 |
| 12 | 3300048927 | Ga0496124_0404704 | Ga0496124_0404704_228_749 | 161 |
| 13 | iso_pu_bacteria | 2818991440 | 2819565023 | 162 |
| 14 | iso_pu_bacteria | 2904463128 | 2904465452 | 162 |
| 15 | 3300005327 | Ga0070658_10471671 | Ga0070658_104716713 | 163 |
| 16 | 3300005355 | Ga0070671_100002970 | Ga0070671_10000297014 | 163 |
| 17 | 3300006353 | Ga0075370_10105474 | Ga0075370_101054742 | 163 |
| 18 | 3300006358 | Ga0068871_100610151 | Ga0068871_1006101512 | 163 |
| 19 | 3300013296 | Ga0157374_10163635 | Ga0157374_101636351 | 163 |
| 20 | 3300031731 | Ga0307405_10418396 | Ga0307405_104183961 | 163 |
| 21 | 3300037471 | Ga0395905_0335075 | Ga0395905_0335075_450_974 | 163 |
| 22 | 3300039447 | Ga0436361_0277057 | Ga0436361_0277057_124_615 | 163 |
| 23 | 3300048928 | Ga0496125_0054369 | Ga0496125_0054369_214_732 | 163 |
| 24 | 3300053153 | Ga0500616_0120290 | Ga0500616_0120290_390_902 | 163 |
| 25 | 3300053156 | Ga0500622_0252267 | Ga0500622_0252267_57_569 | 163 |
| 26 | 3300060353 | Ga0501082_0045462 | Ga0501082_0045462_2383_2874 | 163 |
| 27 | 3300005338 | Ga0068868_100957312 | Ga0068868_1009573121 | 164 |
| 28 | 3300005347 | Ga0070668_100188258 | Ga0070668_1001882583 | 164 |
| 29 | 3300009094 | Ga0111539_10966246 | Ga0111539_109662461 | 164 |
| 30 | 3300025972 | Ga0207668_10333200 | Ga0207668_103332002 | 164 |
| 31 | 3300035112 | Ga0373932_0023037 | Ga0373932_0023037_290_787 | 164 |
| 32 | 3300039447 | Ga0436361_0718484 | Ga0436361_0718484_203_697 | 164 |
| 33 | 3300041512 | Ga0451853_3597318 | Ga0451853_3597318_1921_2433 | 164 |
| 34 | 3300046463 | Ga0495653_0082148 | Ga0495653_0082148_837_1331 | 164 |
| 35 | 3300046463 | Ga0495653_0218755 | Ga0495653_0218755_365_859 | 164 |
| 36 | 3300046473 | Ga0495582_0000505 | Ga0495582_0000505_6193_6687 | 164 |
| 37 | 3300046491 | Ga0495584_0081712 | Ga0495584_0081712_490_987 | 164 |
| 38 | 3300046500 | Ga0495596_0005925 | Ga0495596_0005925_3845_4342 | 164 |
| 39 | 3300046506 | Ga0495583_0260473 | Ga0495583_0260473_64_561 | 164 |
| 40 | 3300046517 | Ga0495630_0023695 | Ga0495630_0023695_1809_2303 | 164 |
| 41 | 3300046518 | Ga0495631_0049287 | Ga0495631_0049287_890_1387 | 164 |
| 42 | 3300046522 | Ga0495643_0020041 | Ga0495643_0020041_2830_3327 | 164 |
| 43 | 3300046524 | Ga0495648_0210009 | Ga0495648_0210009_389_886 | 164 |
| 44 | 3300046526 | Ga0495666_0042659 | Ga0495666_0042659_380_874 | 164 |
| 45 | 3300046528 | Ga0495642_0047363 | Ga0495642_0047363_431_928 | 164 |
| 46 | 3300046529 | Ga0495652_0076356 | Ga0495652_0076356_2263_2757 | 164 |
| 47 | 3300046531 | Ga0495665_0004003 | Ga0495665_0004003_6090_6584 | 164 |
| 48 | 3300046536 | Ga0495587_0009436 | Ga0495587_0009436_5030_5524 | 164 |
| 49 | 3300046536 | Ga0495587_0030017 | Ga0495587_0030017_1614_2108 | 164 |
| 50 | 3300046538 | Ga0495609_0001226 | Ga0495609_0001226_9790_10287 | 164 |
| 51 | 3300046557 | Ga0495622_0145022 | Ga0495622_0145022_52_561 | 164 |
| 52 | 3300046616 | Ga0495668_0021570 | Ga0495668_0021570_650_1147 | 164 |
| 53 | 3300046642 | Ga0495634_0003162 | Ga0495634_0003162_12792_13286 | 164 |
| 54 | 3300046648 | Ga0495611_0034767 | Ga0495611_0034767_1227_1724 | 164 |
| 55 | 3300046674 | Ga0495588_0055030 | Ga0495588_0055030_1190_1684 | 164 |
| 56 | 3300046679 | Ga0495623_0004908 | Ga0495623_0004908_1133_1627 | 164 |
| 57 | 3300046679 | Ga0495623_0082261 | Ga0495623_0082261_463_957 | 164 |
| 58 | 3300046794 | Ga0495589_0042299 | Ga0495589_0042299_1677_2174 | 164 |
| 59 | 3300046809 | Ga0495600_0011253 | Ga0495600_0011253_227_721 | 164 |
| 60 | 3300047317 | Ga0495604_0034397 | Ga0495604_0034397_308_802 | 164 |
| 61 | 3300047320 | Ga0495672_0030475 | Ga0495672_0030475_2083_2580 | 164 |
| 62 | 3300047323 | Ga0495683_0269334 | Ga0495683_0269334_91_588 | 164 |
| 63 | 3300047444 | Ga0495675_0016571 | Ga0495675_0016571_1775_2269 | 164 |
| 64 | 3300047445 | Ga0495677_0018053 | Ga0495677_0018053_1970_2467 | 164 |
| 65 | 3300047469 | Ga0495673_0009214 | Ga0495673_0009214_599_1096 | 164 |
| 66 | 3300048091 | Ga0495626_0054909 | Ga0495626_0054909_857_1354 | 164 |
| 67 | 3300048918 | Ga0496115_0294183 | Ga0496115_0294183_32_526 | 164 |
| 68 | 3300048918 | Ga0496115_0724973 | Ga0496115_0724973_261_755 | 164 |
| 69 | 3300049744 | Ga0501083_0003903 | Ga0501083_0003903_6752_7246 | 164 |
| 70 | 3300050508 | nmdc:mga09592_36102_c1 | nmdc:mga09592_36102_c1_2366_2875 | 164 |
| 71 | 3300050511 | nmdc:mga08y16_38649_c1 | nmdc:mga08y16_38649_c1_1188_1697 | 164 |
| 72 | 3300054114 | Ga0501084_0814516 | Ga0501084_0814516_277_771 | 164 |
| 73 | iso_pu_bacteria | 2842918807 | 2842922454 | 164 |
| 74 | iso_pu_bacteria | 2953994433 | 2953996915 | 164 |
| 75 | 3300005335 | Ga0070666_10066280 | Ga0070666_100662801 | 166 |
| 76 | 3300005367 | Ga0070667_100000131 | Ga0070667_10000013171 | 166 |
| 77 | 3300005841 | Ga0068863_100005504 | Ga0068863_10000550411 | 166 |
| 78 | 3300005843 | Ga0068860_100000013 | Ga0068860_10000001348 | 166 |
| 79 | 3300005844 | Ga0068862_101733040 | Ga0068862_1017330401 | 166 |
| 80 | 3300025304 | Ga0209257_1072668 | Ga0209257_10726681 | 166 |
| 81 | 3300025986 | Ga0207658_10000067 | Ga0207658_1000006771 | 166 |
| 82 | 3300028380 | Ga0268265_11725487 | Ga0268265_117254871 | 166 |
| 83 | 3300028381 | Ga0268264_10000039 | Ga0268264_1000003950 | 166 |
| 84 | 3300031731 | Ga0307405_10052400 | Ga0307405_100524004 | 166 |
| 85 | 3300031911 | Ga0307412_10007145 | Ga0307412_100071454 | 166 |
| 86 | 3300032002 | Ga0307416_101531744 | Ga0307416_1015317442 | 166 |
| 87 | 3300039450 | Ga0436363_1546514 | Ga0436363_1546514_324_827 | 166 |
| 88 | 3300005364 | Ga0070673_101624031 | Ga0070673_1016240311 | 167 |
| 89 | 3300005844 | Ga0068862_100188365 | Ga0068862_1001883652 | 167 |
| 90 | 3300006178 | Ga0075367_10117742 | Ga0075367_101177422 | 167 |
| 91 | 3300006237 | Ga0097621_100162188 | Ga0097621_1001621882 | 167 |
| 92 | 3300006353 | Ga0075370_10048233 | Ga0075370_100482332 | 167 |
| 93 | 3300013306 | Ga0163162_10000003 | Ga0163162_10000003441 | 167 |
| 94 | 3300013306 | Ga0163162_11587744 | Ga0163162_115877442 | 167 |
| 95 | 3300025294 | Ga0209025_1097390 | Ga0209025_10973901 | 167 |
| 96 | 3300025929 | Ga0207664_11409059 | Ga0207664_114090591 | 167 |
| 97 | 3300028380 | Ga0268265_10187395 | Ga0268265_101873953 | 167 |
| 98 | 3300031240 | Ga0265320_10073356 | Ga0265320_100733562 | 167 |
| 99 | 3300031241 | Ga0265325_10068672 | Ga0265325_100686723 | 167 |
| 100 | 3300031249 | Ga0265339_10059631 | Ga0265339_100596312 | 167 |
| 101 | 3300031344 | Ga0265316_10107116 | Ga0265316_101071164 | 167 |
| 102 | 3300031595 | Ga0265313_10099120 | Ga0265313_100991202 | 167 |
| 103 | 3300050496 | nmdc:mga07m45_42635_c1 | nmdc:mga07m45_42635_c1_531_1049 | 167 |
| 104 | 3300053121 | Ga0500607_000844 | Ga0500607_000844_1848_2366 | 167 |
| 105 | 3300053122 | Ga0500608_212305 | Ga0500608_212305_130_648 | 167 |
| 106 | 3300053136 | Ga0500559_0002821 | Ga0500559_0002821_1792_2310 | 167 |
| 107 | 3300053136 | Ga0500559_0007594 | Ga0500559_0007594_13_531 | 167 |
| 108 | 3300053178 | Ga0500637_0004470 | Ga0500637_0004470_4325_4843 | 167 |
| 109 | 3300053730 | Ga0500645_003109 | Ga0500645_003109_4604_5122 | 167 |
| 110 | 3300005290 | Ga0065712_10198545 | Ga0065712_101985451 | 168 |
| 111 | 3300005330 | Ga0070690_100055244 | Ga0070690_1000552443 | 168 |
| 112 | 3300005331 | Ga0070670_100000274 | Ga0070670_10000027414 | 168 |
| 113 | 3300005334 | Ga0068869_100004208 | Ga0068869_1000042083 | 168 |
| 114 | 3300005334 | Ga0068869_100050013 | Ga0068869_1000500131 | 168 |
| 115 | 3300005335 | Ga0070666_10029604 | Ga0070666_100296043 | 168 |
| 116 | 3300005335 | Ga0070666_10761838 | Ga0070666_107618381 | 168 |
| 117 | 3300005338 | Ga0068868_100082275 | Ga0068868_1000822754 | 168 |
| 118 | 3300005338 | Ga0068868_100446362 | Ga0068868_1004463622 | 168 |
| 119 | 3300005338 | Ga0068868_101198276 | Ga0068868_1011982761 | 168 |
| 120 | 3300005344 | Ga0070661_100188291 | Ga0070661_1001882913 | 168 |
| 121 | 3300005347 | Ga0070668_100005409 | Ga0070668_1000054095 | 168 |
| 122 | 3300005347 | Ga0070668_100005976 | Ga0070668_1000059765 | 168 |
| 123 | 3300005353 | Ga0070669_100063162 | Ga0070669_1000631623 | 168 |
| 124 | 3300005353 | Ga0070669_100139322 | Ga0070669_1001393223 | 168 |
| 125 | 3300005353 | Ga0070669_100193750 | Ga0070669_1001937502 | 168 |
| 126 | 3300005354 | Ga0070675_100054056 | Ga0070675_1000540562 | 168 |
| 127 | 3300005354 | Ga0070675_100444259 | Ga0070675_1004442592 | 168 |
| 128 | 3300005354 | Ga0070675_101468218 | Ga0070675_1014682181 | 168 |
| 129 | 3300005355 | Ga0070671_100890650 | Ga0070671_1008906501 | 168 |
| 130 | 3300005356 | Ga0070674_100083570 | Ga0070674_1000835702 | 168 |
| 131 | 3300005356 | Ga0070674_100192273 | Ga0070674_1001922732 | 168 |
| 132 | 3300005364 | Ga0070673_100003645 | Ga0070673_1000036457 | 168 |
| 133 | 3300005367 | Ga0070667_100002746 | Ga0070667_10000274614 | 168 |
| 134 | 3300005367 | Ga0070667_100192292 | Ga0070667_1001922923 | 168 |
| 135 | 3300005436 | Ga0070713_100222473 | Ga0070713_1002224733 | 168 |
| 136 | 3300005438 | Ga0070701_10277956 | Ga0070701_102779562 | 168 |
| 137 | 3300005441 | Ga0070700_100125797 | Ga0070700_1001257972 | 168 |
| 138 | 3300005441 | Ga0070700_100738539 | Ga0070700_1007385391 | 168 |
| 139 | 3300005455 | Ga0070663_100181946 | Ga0070663_1001819461 | 168 |
| 140 | 3300005456 | Ga0070678_100573718 | Ga0070678_1005737182 | 168 |
| 141 | 3300005457 | Ga0070662_101356427 | Ga0070662_1013564271 | 168 |
| 142 | 3300005459 | Ga0068867_100001239 | Ga0068867_10000123914 | 168 |
| 143 | 3300005459 | Ga0068867_100070974 | Ga0068867_1000709742 | 168 |
| 144 | 3300005468 | Ga0070707_100824410 | Ga0070707_1008244101 | 168 |
| 145 | 3300005530 | Ga0070679_100324579 | Ga0070679_1003245792 | 168 |
| 146 | 3300005543 | Ga0070672_100688165 | Ga0070672_1006881652 | 168 |
| 147 | 3300005547 | Ga0070693_100329750 | Ga0070693_1003297501 | 168 |
| 148 | 3300005547 | Ga0070693_100536624 | Ga0070693_1005366242 | 168 |
| 149 | 3300005548 | Ga0070665_100185455 | Ga0070665_1001854553 | 168 |
| 150 | 3300005563 | Ga0068855_100432653 | Ga0068855_1004326532 | 168 |
| 151 | 3300005564 | Ga0070664_100088678 | Ga0070664_1000886783 | 168 |
| 152 | 3300005615 | Ga0070702_100752653 | Ga0070702_1007526531 | 168 |
| 153 | 3300005616 | Ga0068852_100391497 | Ga0068852_1003914972 | 168 |
| 154 | 3300005617 | Ga0068859_100006372 | Ga0068859_10000637213 | 168 |
| 155 | 3300005618 | Ga0068864_100048367 | Ga0068864_1000483672 | 168 |
| 156 | 3300005618 | Ga0068864_100179171 | Ga0068864_1001791713 | 168 |
| 157 | 3300005719 | Ga0068861_100000686 | Ga0068861_10000068618 | 168 |
| 158 | 3300005840 | Ga0068870_10367898 | Ga0068870_103678982 | 168 |
| 159 | 3300005841 | Ga0068863_100002100 | Ga0068863_10000210018 | 168 |
| 160 | 3300005842 | Ga0068858_100033232 | Ga0068858_1000332323 | 168 |
| 161 | 3300005843 | Ga0068860_100096671 | Ga0068860_1000966712 | 168 |
| 162 | 3300005844 | Ga0068862_100130788 | Ga0068862_1001307882 | 168 |
| 163 | 3300005844 | Ga0068862_100164378 | Ga0068862_1001643781 | 168 |
| 164 | 3300006173 | Ga0070716_100407636 | Ga0070716_1004076361 | 168 |
| 165 | 3300006173 | Ga0070716_101488399 | Ga0070716_1014883991 | 168 |
| 166 | 3300006177 | Ga0075362_10140412 | Ga0075362_101404121 | 168 |
| 167 | 3300006237 | Ga0097621_101184765 | Ga0097621_1011847652 | 168 |
| 168 | 3300006358 | Ga0068871_100231666 | Ga0068871_1002316662 | 168 |
| 169 | 3300006844 | Ga0075428_100202317 | Ga0075428_1002023172 | 168 |
| 170 | 3300006871 | Ga0075434_100333951 | Ga0075434_1003339513 | 168 |
| 171 | 3300006880 | Ga0075429_100073591 | Ga0075429_1000735913 | 168 |
| 172 | 3300006914 | Ga0075436_101160531 | Ga0075436_1011605311 | 168 |
| 173 | 3300006931 | Ga0097620_100006371 | Ga0097620_1000063712 | 168 |
| 174 | 3300007076 | Ga0075435_100727193 | Ga0075435_1007271931 | 168 |
| 175 | 3300009147 | Ga0114129_10007310 | Ga0114129_100073109 | 168 |
| 176 | 3300009177 | Ga0105248_10627088 | Ga0105248_106270881 | 168 |
| 177 | 3300009553 | Ga0105249_10715799 | Ga0105249_107157992 | 168 |
| 178 | 3300011119 | Ga0105246_10403576 | Ga0105246_104035762 | 168 |
| 179 | 3300013297 | Ga0157378_10712223 | Ga0157378_107122232 | 168 |
| 180 | 3300014497 | Ga0182008_10008890 | Ga0182008_100088905 | 168 |
| 181 | 3300014969 | Ga0157376_10060564 | Ga0157376_100605643 | 168 |
| 182 | 3300015261 | Ga0182006_1000161 | Ga0182006_100016151 | 168 |
| 183 | 3300015262 | Ga0182007_10023095 | Ga0182007_100230954 | 168 |
| 184 | 3300015265 | Ga0182005_1004688 | Ga0182005_10046883 | 168 |
| 185 | 3300025901 | Ga0207688_10549794 | Ga0207688_105497942 | 168 |
| 186 | 3300025903 | Ga0207680_10043121 | Ga0207680_100431214 | 168 |
| 187 | 3300025907 | Ga0207645_10060018 | Ga0207645_100600183 | 168 |
| 188 | 3300025908 | Ga0207643_10202632 | Ga0207643_102026322 | 168 |
| 189 | 3300025912 | Ga0207707_10317552 | Ga0207707_103175522 | 168 |
| 190 | 3300025922 | Ga0207646_10674934 | Ga0207646_106749342 | 168 |
| 191 | 3300025923 | Ga0207681_10046277 | Ga0207681_100462773 | 168 |
| 192 | 3300025925 | Ga0207650_10004970 | Ga0207650_100049707 | 168 |
| 193 | 3300025926 | Ga0207659_10013330 | Ga0207659_100133303 | 168 |
| 194 | 3300025926 | Ga0207659_10064355 | Ga0207659_100643554 | 168 |
| 195 | 3300025927 | Ga0207687_10988565 | Ga0207687_109885652 | 168 |
| 196 | 3300025933 | Ga0207706_10673944 | Ga0207706_106739441 | 168 |
| 197 | 3300025937 | Ga0207669_10127096 | Ga0207669_101270962 | 168 |
| 198 | 3300025937 | Ga0207669_10286468 | Ga0207669_102864682 | 168 |
| 199 | 3300025939 | Ga0207665_10255106 | Ga0207665_102551061 | 168 |
| 200 | 3300025940 | Ga0207691_10135402 | Ga0207691_101354022 | 168 |
| 201 | 3300025941 | Ga0207711_10038080 | Ga0207711_100380804 | 168 |
| 202 | 3300025942 | Ga0207689_10000147 | Ga0207689_1000014751 | 168 |
| 203 | 3300025960 | Ga0207651_10010054 | Ga0207651_100100544 | 168 |
| 204 | 3300025961 | Ga0207712_10516452 | Ga0207712_105164522 | 168 |
| 205 | 3300025972 | Ga0207668_10002244 | Ga0207668_1000224411 | 168 |
| 206 | 3300025972 | Ga0207668_10057922 | Ga0207668_100579222 | 168 |
| 207 | 3300025972 | Ga0207668_10109501 | Ga0207668_101095013 | 168 |
| 208 | 3300025986 | Ga0207658_10002875 | Ga0207658_1000287512 | 168 |
| 209 | 3300025986 | Ga0207658_10388456 | Ga0207658_103884562 | 168 |
| 210 | 3300025986 | Ga0207658_10440647 | Ga0207658_104406471 | 168 |
| 211 | 3300026023 | Ga0207677_10417560 | Ga0207677_104175602 | 168 |
| 212 | 3300026035 | Ga0207703_10003494 | Ga0207703_1000349413 | 168 |
| 213 | 3300026075 | Ga0207708_10126419 | Ga0207708_101264192 | 168 |
| 214 | 3300026075 | Ga0207708_10697671 | Ga0207708_106976712 | 168 |
| 215 | 3300026089 | Ga0207648_10113613 | Ga0207648_101136132 | 168 |
| 216 | 3300026095 | Ga0207676_10010379 | Ga0207676_100103796 | 168 |
| 217 | 3300026095 | Ga0207676_10223126 | Ga0207676_102231263 | 168 |
| 218 | 3300026095 | Ga0207676_10770164 | Ga0207676_107701642 | 168 |
| 219 | 3300026118 | Ga0207675_100799750 | Ga0207675_1007997502 | 168 |
| 220 | 3300026142 | Ga0207698_10227524 | Ga0207698_102275242 | 168 |
| 221 | 3300026142 | Ga0207698_11361751 | Ga0207698_113617511 | 168 |
| 222 | 3300028379 | Ga0268266_10499483 | Ga0268266_104994832 | 168 |
| 223 | 3300028380 | Ga0268265_10051286 | Ga0268265_100512861 | 168 |
| 224 | 3300028380 | Ga0268265_10157697 | Ga0268265_101576971 | 168 |
| 225 | 3300028381 | Ga0268264_10008780 | Ga0268264_100087807 | 168 |
| 226 | 3300028381 | Ga0268264_10763026 | Ga0268264_107630262 | 168 |
| 227 | 3300028573 | Ga0265334_10250464 | Ga0265334_102504641 | 168 |
| 228 | 3300028800 | Ga0265338_10000011 | Ga0265338_10000011458 | 168 |
| 229 | 3300031238 | Ga0265332_10016011 | Ga0265332_100160112 | 168 |
| 230 | 3300031241 | Ga0265325_10000002 | Ga0265325_10000002126 | 168 |
| 231 | 3300031247 | Ga0265340_10088861 | Ga0265340_100888613 | 168 |
| 232 | 3300031249 | Ga0265339_10000210 | Ga0265339_1000021015 | 168 |
| 233 | 3300031249 | Ga0265339_10041530 | Ga0265339_100415302 | 168 |
| 234 | 3300031249 | Ga0265339_10161164 | Ga0265339_101611642 | 168 |
| 235 | 3300031250 | Ga0265331_10004335 | Ga0265331_100043357 | 168 |
| 236 | 3300031250 | Ga0265331_10004378 | Ga0265331_100043785 | 168 |
| 237 | 3300031250 | Ga0265331_10007067 | Ga0265331_100070674 | 168 |
| 238 | 3300031251 | Ga0265327_10000077 | Ga0265327_10000077123 | 168 |
| 239 | 3300031595 | Ga0265313_10003445 | Ga0265313_1000344511 | 168 |
| 240 | 3300031595 | Ga0265313_10005362 | Ga0265313_100053625 | 168 |
| 241 | 3300031595 | Ga0265313_10011030 | Ga0265313_100110305 | 168 |
| 242 | 3300031711 | Ga0265314_10029854 | Ga0265314_100298545 | 168 |
| 243 | 3300031711 | Ga0265314_10030043 | Ga0265314_100300434 | 168 |
| 244 | 3300031712 | Ga0265342_10004548 | Ga0265342_1000454811 | 168 |
| 245 | 3300031712 | Ga0265342_10039543 | Ga0265342_100395432 | 168 |
| 246 | 3300031911 | Ga0307412_10059729 | Ga0307412_100597293 | 168 |
| 247 | 3300037471 | Ga0395905_0245251 | Ga0395905_0245251_41_559 | 168 |
| 248 | 3300037853 | Ga0436364_0888144 | Ga0436364_0888144_77_601 | 168 |
| 249 | 3300039438 | Ga0436360_0787492 | Ga0436360_0787492_562_1086 | 168 |
| 250 | 3300039438 | Ga0436360_1078989 | Ga0436360_1078989_27_539 | 168 |
| 251 | 3300039453 | Ga0436362_0023373 | Ga0436362_0023373_73_597 | 168 |
| 252 | 3300039453 | Ga0436362_0640269 | Ga0436362_0640269_117_641 | 168 |
| 253 | 3300041404 | Ga0439436_0000023 | Ga0439436_0000023_17251_17757 | 168 |
| 254 | 3300041404 | Ga0439436_0064985 | Ga0439436_0064985_190_696 | 168 |
| 255 | 3300041413 | Ga0439465_0003056 | Ga0439465_0003056_3771_4277 | 168 |
| 256 | 3300044673 | Ga0453683_0076348 | Ga0453683_0076348_144_659 | 168 |
| 257 | 3300045049 | Ga0466959_0206300 | Ga0466959_0206300_31_555 | 168 |
| 258 | 3300045051 | Ga0451576_1599527 | Ga0451576_1599527_144_653 | 168 |
| 259 | 3300045976 | Ga0466967_0562718 | Ga0466967_0562718_268_801 | 168 |
| 260 | 3300046471 | Ga0495650_0253876 | Ga0495650_0253876_38_547 | 168 |
| 261 | 3300046474 | Ga0495605_0263686 | Ga0495605_0263686_168_674 | 168 |
| 262 | 3300046492 | Ga0495585_0000024 | Ga0495585_0000024_57958_58464 | 168 |
| 263 | 3300046507 | Ga0495606_0092873 | Ga0495606_0092873_1011_1529 | 168 |
| 264 | 3300046507 | Ga0495606_0277489 | Ga0495606_0277489_294_800 | 168 |
| 265 | 3300046512 | Ga0495610_0001255 | Ga0495610_0001255_9679_10185 | 168 |
| 266 | 3300046518 | Ga0495631_0000130 | Ga0495631_0000130_42783_43289 | 168 |
| 267 | 3300046536 | Ga0495587_0094812 | Ga0495587_0094812_993_1541 | 168 |
| 268 | 3300046665 | Ga0495661_0000383 | Ga0495661_0000383_27221_27727 | 168 |
| 269 | 3300046691 | Ga0495670_0015299 | Ga0495670_0015299_3185_3691 | 168 |
| 270 | 3300047321 | Ga0495676_0612054 | Ga0495676_0612054_151_657 | 168 |
| 271 | 3300047444 | Ga0495675_0101912 | Ga0495675_0101912_402_950 | 168 |
| 272 | 3300047472 | Ga0495686_0000738 | Ga0495686_0000738_14726_15232 | 168 |
| 273 | 3300048091 | Ga0495626_0000014 | Ga0495626_0000014_215536_216054 | 168 |
| 274 | 3300048922 | Ga0496119_0011034 | Ga0496119_0011034_3638_4144 | 168 |
| 275 | 3300049460 | Ga0495682_0107539 | Ga0495682_0107539_49_555 | 168 |
| 276 | 3300049575 | Ga0501039_0246208 | Ga0501039_0246208_96_617 | 168 |
| 277 | 3300049581 | Ga0501047_0004162 | Ga0501047_0004162_23_535 | 168 |
| 278 | 3300049583 | Ga0501067_0007254 | Ga0501067_0007254_5382_5894 | 168 |
| 279 | 3300049586 | Ga0501070_0176827 | Ga0501070_0176827_1208_1717 | 168 |
| 280 | 3300049588 | Ga0501072_0007532 | Ga0501072_0007532_564_1076 | 168 |
| 281 | 3300049589 | Ga0501073_0004084 | Ga0501073_0004084_4395_4907 | 168 |
| 282 | 3300049589 | Ga0501073_0031552 | Ga0501073_0031552_3256_3765 | 168 |
| 283 | 3300049590 | Ga0501074_0055363 | Ga0501074_0055363_2307_2816 | 168 |
| 284 | 3300049590 | Ga0501074_0187798 | Ga0501074_0187798_904_1416 | 168 |
| 285 | 3300049592 | Ga0501076_0312551 | Ga0501076_0312551_544_1122 | 168 |
| 286 | 3300049741 | Ga0501079_0184211 | Ga0501079_0184211_962_1567 | 168 |
| 287 | 3300049741 | Ga0501079_0208800 | Ga0501079_0208800_867_1382 | 168 |
| 288 | 3300049741 | Ga0501079_0926503 | Ga0501079_0926503_46_555 | 168 |
| 289 | 3300049742 | Ga0501080_0032457 | Ga0501080_0032457_3839_4348 | 168 |
| 290 | 3300049742 | Ga0501080_0045744 | Ga0501080_0045744_2534_3046 | 168 |
| 291 | 3300049744 | Ga0501083_0680365 | Ga0501083_0680365_122_637 | 168 |
| 292 | 3300049824 | Ga0501045_0231349 | Ga0501045_0231349_35_550 | 168 |
| 293 | 3300050507 | nmdc:mga05p37_52115_c1 | nmdc:mga05p37_52115_c1_3860_4381 | 168 |
| 294 | 3300050513 | nmdc:mga0rr50_287105_c1 | nmdc:mga0rr50_287105_c1_688_1194 | 168 |
| 295 | 3300050514 | nmdc:mga08x19_966761_c1 | nmdc:mga08x19_966761_c1_57_566 | 168 |
| 296 | 3300053730 | Ga0500645_000260 | Ga0500645_000260_23_529 | 168 |
| 297 | 3300054114 | Ga0501084_0074249 | Ga0501084_0074249_928_1437 | 168 |
| 298 | 3300060353 | Ga0501082_0595779 | Ga0501082_0595779_169_684 | 168 |
| 299 | 3300005288 | Ga0065714_10270097 | Ga0065714_102700971 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2oqm-assembly2.cif.gz_D | crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution | 0.9302 | 6 | 169 |
| 3qth-assembly1.cif.gz_A | crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution | 0.9001 | 5 | 169 |
| 2oqm-assembly2.cif.gz_D | crystal structure of a dinb family member protein (sden_0562) from shewanella denitrificans at 1.83 a resolution | 0.8986 | 6 | 169 |
| 3qth-assembly1.cif.gz_B | crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution | 0.8878 | 5 | 169 |
| 3qth-assembly1.cif.gz_A | crystal structure of a dinb-like protein (cps_3021) from colwellia psychrerythraea 34h at 2.20 a resolution | 0.8451 | 5 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2oqmC01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.9394 | 4 | 167 | 1.20.120.450 |
| 2oqmC01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.9068 | 4 | 167 | 1.20.120.450 |
| 3qthB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8893 | 5 | 169 | 1.20.120.450 |
| 3qthB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8165 | 5 | 169 | 1.20.120.450 |
| 2qe9B01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.6468 | 13 | 168 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5C9A0H4-F1-model_v4 | DUF1993 domain-containing protein | 0.9907 | 1 | 168 |
|
| AF-G6YJU1-F1-model_v4 | DUF1993 family protein | 0.989 | 6 | 169 |
|
| AF-A0A3B9U1D8-F1-model_v4 | deleted | 0.9881 | 1 | 146 |
|
| AF-A0A0R2WLJ8-F1-model_v4 | DUF1993 domain-containing protein | 0.9877 | 6 | 168 |
|
| AF-A0A3N5H1L3-F1-model_v4 | DUF1993 domain-containing protein | 0.9873 | 51 | 169 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar