F394879

General Info

Members Datasets Scaffolds Average Seq Length
299 196 598 739

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10026715|Ga0207691_100267154
Length 778
Sequence MPFSTYLPERMGGITLSPAGPFIAGAHVELTLVYTAGTFGIDDTGMVKISWRTTSDMSKPQFDKPQAANFTTVEASNGAKLEVWFDRLNVRPFANTLLIRVGRGYLRAGDTLTIRLGDRRQGSPGFRLQTNVEANVELRTAVDAFATYEFCELPAQPSFDLVPGPAASWKAILPSLAFVGEPFRLAVVAEDKWGNCTADASQSFELVSSHPVRGLPARLEIKNGDGPHVIENLVAVAEGDIDIHLLANGDALARANPLRVTKQAELRRYWGDLHGQSGETIGMGTADAYFRYARDAAFIDMVGHQGNDFQITDTFWKELNRLTAEFDAPGRFVCLPGYEWSGNTGMGGDRNIFYRHEGRPIRRSSHILVEGQTSTDAIYTADALFRGLEGEDAIVIAHVGGRYADLKYAHDGRLERAVEVHSTWGTFEWILHDAFEKGYRVGVVCHSDDHKGRPGATRPGASSFGAIGGLTCYFMPELTRDALFEALRQRRHYGTSGARIFVDLRASFDQPVVCFGEDPQLRPSTEFPVRQAVMGNIIRPGRVPMHVAAEVIGTAPIERVDVLHRTMVARTFRPYSASDLGRRVRVLWQGAEYRGRGRETLWEGKLAVTGNRITRFAQVNFLNPERTVRETAAGTALMWNSVTTGNLAGIDLWLDEAQRGTLSIETNIVSGAVEIAALADNTITLDVDGRPDRSAVEVLHQDLIPCLATPPSSIGHXXXXEEALAAVRGRAKVAVLMPALDFEQVLRVAAADRLLPEKATSFQPKPNVGVLIRALHDE

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
105 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
106 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
155 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
187 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
188 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
189 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
193 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
194 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
195 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
196 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.02
Nodule 0
Rhizoplane 12.71
Rhizosphere 79.6
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10026715 3300025940 Bacteria 5416
2 JGI25153J46596_10003395 3300003215 Bacteria 8929
3 rootH2_10248920 3300003320 Bacteria 2927
4 JGI25404J52841_10001035 3300003659 Bacteria 4613
5 Ga0070658_10035502 3300005327 Bacteria 4016
6 Ga0070676_10017582 3300005328 Bacteria 3956
7 Ga0070666_10047917 3300005335 Bacteria 2870
8 Ga0070660_100079907 3300005339 Bacteria 2566
9 Ga0070689_100016405 3300005340 Bacteria 5421
10 Ga0070668_100001860 3300005347 Bacteria 15410
11 Ga0070668_100070523 3300005347 Bacteria 2721
12 Ga0070671_100067823 3300005355 Bacteria 2975
13 Ga0070674_100002871 3300005356 Bacteria 9524
14 Ga0070674_100018396 3300005356 Bacteria 4417
15 Ga0070673_100004969 3300005364 Bacteria 8476
16 Ga0070667_100051066 3300005367 Bacteria 3486
17 Ga0070713_100012035 3300005436 Bacteria 6334
18 Ga0070713_100019396 3300005436 Bacteria 5190
19 Ga0070663_100008307 3300005455 Bacteria 6379
20 Ga0070678_100006657 3300005456 Bacteria 6796
21 Ga0070678_100044708 3300005456 Bacteria 3164
22 Ga0070662_100002080 3300005457 Bacteria 12274
23 Ga0070699_100002099 3300005518 Bacteria 18045
24 Ga0070699_100027987 3300005518 Bacteria 4861
25 Ga0070679_100001473 3300005530 Bacteria 20869
26 Ga0070679_100045634 3300005530 Bacteria 4367
27 Ga0068853_100053695 3300005539 Bacteria 3470
28 Ga0070672_100013023 3300005543 Bacteria 5862
29 Ga0070686_100033486 3300005544 Bacteria 3158
30 Ga0068855_100009155 3300005563 Bacteria 11959
31 Ga0068856_100065941 3300005614 Bacteria 3577
32 Ga0068859_100008922 3300005617 Bacteria 10128
33 Ga0068864_100050958 3300005618 Bacteria 3564
34 Ga0068861_100010003 3300005719 Bacteria 6570
35 Ga0068860_100110068 3300005843 Bacteria 2632
36 Ga0081455_10002333 3300005937 Bacteria 22645
37 Ga0081455_10009199 3300005937 Bacteria 10181
38 Ga0081455_10022622 3300005937 Bacteria 5870
39 Ga0081455_10069163 3300005937 Bacteria 2937
40 Ga0081538_10003472 3300005981 Bacteria 14887
41 Ga0081540_1000747 3300005983 Bacteria 29934
42 Ga0081540_1000980 3300005983 Bacteria 25755
43 Ga0081540_1003605 3300005983 Bacteria 12150
44 Ga0081540_1003940 3300005983 Bacteria 11537
45 Ga0081539_10000785 3300005985 Bacteria 61844
46 Ga0070717_10002307 3300006028 Bacteria 13393
47 Ga0070717_10023790 3300006028 Bacteria 4858
48 Ga0075365_10011164 3300006038 Bacteria 5271
49 Ga0075365_10021602 3300006038 Bacteria 4018
50 Ga0075363_100001602 3300006048 Bacteria 8710
51 Ga0075363_100004791 3300006048 Bacteria 5966
52 Ga0075364_10031435 3300006051 Bacteria 3411
53 Ga0070712_100000918 3300006175 Bacteria 17671
54 Ga0075367_10004082 3300006178 Bacteria 7067
55 Ga0075367_10012193 3300006178 Bacteria 4572
56 Ga0097621_100041133 3300006237 Bacteria 3719
57 Ga0075428_100008701 3300006844 Bacteria 11260
58 Ga0075428_100074289 3300006844 Bacteria 3713
59 Ga0075430_100005836 3300006846 Bacteria 10390
60 Ga0075431_100000057 3300006847 Bacteria 62693
61 Ga0075431_100002357 3300006847 Bacteria 18140
62 Ga0075431_100006652 3300006847 Bacteria 11480
63 Ga0075431_100023441 3300006847 Bacteria 6315
64 Ga0075429_100007500 3300006880 Bacteria 9471
65 Ga0075429_100045599 3300006880 Bacteria 3814
66 Ga0097620_100008922 3300006931 Bacteria 10128
67 Ga0099794_10002879 3300007265 Bacteria 6459
68 Ga0099795_10006104 3300007788 Bacteria 3261
69 Ga0105240_10000975 3300009093 Bacteria 50973
70 Ga0111539_10000474 3300009094 Bacteria 50665
71 Ga0105245_10002061 3300009098 Bacteria 18231
72 Ga0105247_10010354 3300009101 Bacteria 5639
73 Ga0114129_10000591 3300009147 Bacteria 44866
74 Ga0105241_10056910 3300009174 Bacteria 2998
75 Ga0105242_10024562 3300009176 Bacteria 4761
76 Ga0105248_10017324 3300009177 Bacteria 7940
77 Ga0105248_10035983 3300009177 Bacteria 5538
78 Ga0105248_10143346 3300009177 Bacteria 2696
79 Ga0105237_10037421 3300009545 Bacteria 4905
80 Ga0105238_10006808 3300009551 Bacteria 11415
81 Ga0105238_10021283 3300009551 Bacteria 6609
82 Ga0105249_10034217 3300009553 Bacteria 4602
83 Ga0105249_10049847 3300009553 Bacteria 3818
84 Ga0105239_10036784 3300010375 Bacteria 5370
85 Ga0105239_10037206 3300010375 Bacteria 5337
86 Ga0105246_10009055 3300011119 Bacteria 6131
87 Ga0105246_10013278 3300011119 Bacteria 5162
88 Ga0157374_10012622 3300013296 Bacteria 7354
89 Ga0163162_10024629 3300013306 Bacteria 5943
90 Ga0157375_10007615 3300013308 Bacteria 9472
91 Ga0157375_10008870 3300013308 Bacteria 8802
92 Ga0163163_10029970 3300014325 Bacteria 5237
93 Ga0157380_10006081 3300014326 Bacteria 8461
94 Ga0157380_10024819 3300014326 Bacteria 4541
95 Ga0157380_10043590 3300014326 Bacteria 3513
96 Ga0157377_10037044 3300014745 Bacteria 2686
97 Ga0157376_10015069 3300014969 Bacteria 5828
98 Ga0157376_10082258 3300014969 Bacteria 2766
99 Ga0209758_1005193 3300025297 Bacteria 10233
100 Ga0207642_10005126 3300025899 Bacteria 4263
101 Ga0207688_10034396 3300025901 Bacteria 2806
102 Ga0207643_10005682 3300025908 Bacteria 6669
103 Ga0207684_10018163 3300025910 Bacteria 6026
104 Ga0207684_10056992 3300025910 Bacteria 3315
105 Ga0207707_10005625 3300025912 Bacteria 10964
106 Ga0207707_10101307 3300025912 Bacteria 2517
107 Ga0207695_10029784 3300025913 Bacteria 6023
108 Ga0207695_10114277 3300025913 Bacteria 2675
109 Ga0207693_10002234 3300025915 Bacteria 16865
110 Ga0207657_10038409 3300025919 Bacteria 4262
111 Ga0207694_10014871 3300025924 Bacteria 5869
112 Ga0207659_10003831 3300025926 Bacteria 9066
113 Ga0207687_10010910 3300025927 Bacteria 5938
114 Ga0207664_10020576 3300025929 Bacteria 4894
115 Ga0207664_10021855 3300025929 Bacteria 4767
116 Ga0207706_10045727 3300025933 Bacteria 3877
117 Ga0207670_10000705 3300025936 Bacteria 17626
118 Ga0207669_10002463 3300025937 Bacteria 7900
119 Ga0207669_10020813 3300025937 Bacteria 3448
120 Ga0207665_10002379 3300025939 Bacteria 12703
121 Ga0207691_10023450 3300025940 Bacteria 5809
122 Ga0207691_10027708 3300025940 Bacteria 5311
123 Ga0207711_10004964 3300025941 Bacteria 11291
124 Ga0207689_10002150 3300025942 Bacteria 18534
125 Ga0207661_10000346 3300025944 Bacteria 29746
126 Ga0207651_10001641 3300025960 Bacteria 10275
127 Ga0207712_10036667 3300025961 Bacteria 3341
128 Ga0207677_10027459 3300026023 Bacteria 3585
129 Ga0207639_10083806 3300026041 Bacteria 2531
130 Ga0207678_10004035 3300026067 Bacteria 13206
131 Ga0207708_10021691 3300026075 Bacteria 4845
132 Ga0207648_10014395 3300026089 Bacteria 7310
133 Ga0207676_10018513 3300026095 Bacteria 5064
134 Ga0207674_10112185 3300026116 Bacteria 2700
135 Ga0207675_100015562 3300026118 Bacteria 7095
136 Ga0207675_100079818 3300026118 Bacteria 3066
137 Ga0207683_10003473 3300026121 Bacteria 13753
138 Ga0207683_10013395 3300026121 Bacteria 6992
139 Ga0207683_10017909 3300026121 Bacteria 6040
140 Ga0207683_10125445 3300026121 Bacteria 2307
141 Ga0207698_10055431 3300026142 Bacteria 3055
142 Ga0209813_10003012 3300027866 Bacteria 3910
143 Ga0207428_10019285 3300027907 Bacteria 5815
144 Ga0268266_10030894 3300028379 Bacteria 4548
145 Ga0268265_10048132 3300028380 Unclassified 3199
146 Ga0265338_10033438 3300028800 Bacteria 4990
147 Ga0307513_10093908 3300031456 Bacteria 3047
148 Ga0373923_0001165 3300035111 Bacteria 7314
149 Ga0373936_0000103 3300035113 Bacteria 30865
150 Ga0373954_0000605 3300035118 Bacteria 13642
151 Ga0373943_0000924 3300035170 Bacteria 12939
152 Ga0373943_0023610 3300035170 Unclassified 2860
153 Ga0373955_0004119 3300035172 Bacteria 6418
154 Ga0373924_0001114 3300035410 Bacteria 8608
155 Ga0373935_0000017 3300035692 Bacteria 70368
156 Ga0373927_0019422 3300035695 Bacteria 4456
157 Ga0373927_0026573 3300035695 Bacteria 3784
158 Ga0373947_0000916 3300035725 Bacteria 17899
159 Ga0373947_0046489 3300035725 Unclassified 2599
160 Ga0373947_0052231 3300035725 Bacteria 2462
161 Ga0373937_0000103 3300036401 Bacteria 80386
162 Ga0373937_0038220 3300036401 Bacteria 4375
163 Ga0373925_0000058 3300037068 Bacteria 122682
164 Ga0373925_0014307 3300037068 Bacteria 5740
165 Ga0436365_0611669 3300039437 Bacteria 6796
166 Ga0466966_0039858 3300044684 Bacteria 3024
167 Ga0466957_0020419 3300044842 Bacteria 3898
168 Ga0466967_0026678 3300045976 Bacteria 4790
169 Ga0495592_0000343 3300046454 Bacteria 38047
170 Ga0495629_0002223 3300046459 Bacteria 14968
171 Ga0495629_0020597 3300046459 Unclassified 4710
172 Ga0495638_0004488 3300046460 Bacteria 10574
173 Ga0495651_0002876 3300046462 Bacteria 13334
174 Ga0495651_0022048 3300046462 Unclassified 4953
175 Ga0495653_0000072 3300046463 Bacteria 85266
176 Ga0495580_0033663 3300046472 Bacteria 3691
177 Ga0495580_0038432 3300046472 Unclassified 3428
178 Ga0495582_0005553 3300046473 Bacteria 7022
179 Ga0495639_0018874 3300046475 Unclassified 3005
180 Ga0495662_0008685 3300046476 Bacteria 4993
181 Ga0495662_0009791 3300046476 Unclassified 4708
182 Ga0495664_0000009 3300046477 Bacteria 289534
183 Ga0495594_0012500 3300046499 Unclassified 4422
184 Ga0495608_0000608 3300046511 Bacteria 24628
185 Ga0495618_0000061 3300046514 Bacteria 78337
186 Ga0495628_0000012 3300046516 Bacteria 224162
187 Ga0495630_0000945 3300046517 Bacteria 20329
188 Ga0495666_0028216 3300046526 Unclassified 2762
189 Ga0495652_0000021 3300046529 Bacteria 181454
190 Ga0495652_0028637 3300046529 Unclassified 4899
191 Ga0495665_0013942 3300046531 Unclassified 4342
192 Ga0495640_0000028 3300046533 Bacteria 79904
193 Ga0495640_0004326 3300046533 Bacteria 11338
194 Ga0495587_0000033 3300046536 Bacteria 123885
195 Ga0495645_0000017 3300046543 Bacteria 156865
196 Ga0495622_0016988 3300046557 Unclassified 3387
197 Ga0495667_0000515 3300046559 Bacteria 24734
198 Ga0495667_0006000 3300046559 Bacteria 8216
199 Ga0495656_0017128 3300046615 Bacteria 2761
200 Ga0495634_0001144 3300046642 Bacteria 24509
201 Ga0495634_0021586 3300046642 Bacteria 4548
202 Ga0495634_0050874 3300046642 Unclassified 2780
203 Ga0495635_0000019 3300046663 Bacteria 193402
204 Ga0495635_0009452 3300046663 Bacteria 6816
205 Ga0495657_0000982 3300046675 Bacteria 25117
206 Ga0495599_0000024 3300046678 Bacteria 121388
207 Ga0495623_0000022 3300046679 Bacteria 98899
208 Ga0495646_0000033 3300046680 Bacteria 83930
209 Ga0495658_0008046 3300046683 Bacteria 5220
210 Ga0495669_0009305 3300046684 Bacteria 4140
211 Ga0495613_0024393 3300046689 Unclassified 4507
212 Ga0495613_0040374 3300046689 Bacteria 3458
213 Ga0495600_0000028 3300046809 Bacteria 90661
214 Ga0495581_0029631 3300047315 Unclassified 3171
215 Ga0495604_0000011 3300047317 Bacteria 292024
216 Ga0495604_0026589 3300047317 Unclassified 4606
217 Ga0495674_0000015 3300047319 Bacteria 224071
218 Ga0495674_0032085 3300047319 Bacteria 4767
219 Ga0495676_0038702 3300047321 Unclassified 3958
220 Ga0495680_0001545 3300047322 Bacteria 24639
221 Ga0495680_0027159 3300047322 Unclassified 4707
222 Ga0495680_0095436 3300047322 Bacteria 2223
223 Ga0495675_0001637 3300047444 Bacteria 13445
224 Ga0495684_0000036 3300047471 Bacteria 107181
225 Ga0495684_0017213 3300047471 Bacteria 5564
226 Ga0495684_0018817 3300047471 Bacteria 5321
227 Ga0495593_0001316 3300047673 Bacteria 14553
228 Ga0495602_0000018 3300048088 Bacteria 183837
229 Ga0495614_0015997 3300048089 Unclassified 3267
230 Ga0496101_0004713 3300048904 Bacteria 8637
231 Ga0496102_0001488 3300048905 Bacteria 20706
232 Ga0496102_0005151 3300048905 Bacteria 11088
233 Ga0496102_0018355 3300048905 Bacteria 6145
234 Ga0496102_0053023 3300048905 Bacteria 3697
235 Ga0496103_0020911 3300048906 Bacteria 3935
236 Ga0496103_0042422 3300048906 Bacteria 2799
237 Ga0496104_0000711 3300048907 Bacteria 28620
238 Ga0496104_0000925 3300048907 Bacteria 25187
239 Ga0496104_0000971 3300048907 Bacteria 24544
240 Ga0496104_0007444 3300048907 Bacteria 9673
241 Ga0496105_0005447 3300048908 Bacteria 9657
242 Ga0496105_0005694 3300048908 Bacteria 9482
243 Ga0496105_0008367 3300048908 Bacteria 8038
244 Ga0496105_0030743 3300048908 Bacteria 4401
245 Ga0496106_0006058 3300048909 Bacteria 8951
246 Ga0496106_0007320 3300048909 Bacteria 8158
247 Ga0496106_0011446 3300048909 Bacteria 6562
248 Ga0496107_0009825 3300048910 Bacteria 6636
249 Ga0496108_0000835 3300048911 Bacteria 23948
250 Ga0496108_0009760 3300048911 Bacteria 7775
251 Ga0496108_0072046 3300048911 Bacteria 2916
252 Ga0496108_0088546 3300048911 Bacteria 2630
253 Ga0496109_0010188 3300048912 Bacteria 8024
254 Ga0496110_0009265 3300048913 Bacteria 7959
255 Ga0496110_0016576 3300048913 Bacteria 6153
256 Ga0496111_0001496 3300048914 Bacteria 13385
257 Ga0496112_0002146 3300048915 Bacteria 15661
258 Ga0496113_0001106 3300048916 Bacteria 14611
259 Ga0496113_0056553 3300048916 Bacteria 2946
260 Ga0496114_0003597 3300048917 Bacteria 11911
261 Ga0496114_0011065 3300048917 Bacteria 7199
262 Ga0496114_0017981 3300048917 Bacteria 5712
263 Ga0496114_0051378 3300048917 Bacteria 3432
264 Ga0496115_0001995 3300048918 Bacteria 14586
265 Ga0496115_0013160 3300048918 Bacteria 6250
266 Ga0496115_0023996 3300048918 Bacteria 4737
267 Ga0496115_0041751 3300048918 Bacteria 3652
268 Ga0496121_0004144 3300048924 Bacteria 19837
269 Ga0496126_0007725 3300048929 Bacteria 11734
270 Ga0501077_0052574 3300049593 Bacteria 2587
271 nmdc:mga0yw44_38116_c1 3300050492 Bacteria 2842
272 nmdc:mga0yw44_9615_c1 3300050492 Bacteria 4902
273 nmdc:mga0k408_4789_c1 3300050493 Bacteria 5999
274 nmdc:mga06z11_11809_c1 3300050494 Bacteria 3778
275 nmdc:mga06z11_1520_c1 3300050494 Bacteria 8597
276 nmdc:mga06z11_630_c1 3300050494 Bacteria 12819
277 nmdc:mga04h51_3303_c1 3300050495 Bacteria 3909
278 nmdc:mga05p37_14801_c1 3300050507 Bacteria 9368
279 nmdc:mga05p37_228_c1 3300050507 Bacteria 56943
280 nmdc:mga09592_6527_c1 3300050508 Bacteria 9501
281 nmdc:mga0qj67_11075_c1 3300050509 Bacteria 6752
282 nmdc:mga0qj67_2569_c1 3300050509 Bacteria 12968
283 nmdc:mga0qj67_70669_c1 3300050509 Bacteria 2785
284 nmdc:mga06r32_1001_c1 3300050510 Bacteria 25328
285 nmdc:mga06r32_145_c1 3300050510 Bacteria 53373
286 nmdc:mga06r32_26788_c1 3300050510 Bacteria 5380
287 nmdc:mga06r32_7465_c1 3300050510 Bacteria 9837
288 nmdc:mga08y16_420_c1 3300050511 Bacteria 39045
289 nmdc:mga08y16_8855_c1 3300050511 Bacteria 10564
290 Ga0495601_0000024 3300053077 Bacteria 133160
291 Ga0495612_0000606 3300053078 Bacteria 14418
292 Ga0495612_0004327 3300053078 Bacteria 5888
293 Ga0495595_0000036 3300053084 Bacteria 79035
294 Ga0495595_0001797 3300053084 Bacteria 8362
295 Ga0495619_0000034 3300053085 Bacteria 129851
296 Ga0495619_0012421 3300053085 Bacteria 5363
297 Ga0495619_0026557 3300053085 Bacteria 3726
298 Ga0495619_0047820 3300053085 Bacteria 2818
299 Ga0500647_0014547 3300053091 Bacteria 3580
300 Ga0207691_10026715
301 JGI25153J46596_10003395
302 rootH2_10248920
303 JGI25404J52841_10001035
304 Ga0070658_10035502
305 Ga0070676_10017582
306 Ga0070666_10047917
307 Ga0070660_100079907
308 Ga0070689_100016405
309 Ga0070668_100001860
310 Ga0070668_100070523
311 Ga0070671_100067823
312 Ga0070674_100002871
313 Ga0070674_100018396
314 Ga0070673_100004969
315 Ga0070667_100051066
316 Ga0070713_100012035
317 Ga0070713_100019396
318 Ga0070663_100008307
319 Ga0070678_100006657
320 Ga0070678_100044708
321 Ga0070662_100002080
322 Ga0070699_100002099
323 Ga0070699_100027987
324 Ga0070679_100001473
325 Ga0070679_100045634
326 Ga0068853_100053695
327 Ga0070672_100013023
328 Ga0070686_100033486
329 Ga0068855_100009155
330 Ga0068856_100065941
331 Ga0068859_100008922
332 Ga0068864_100050958
333 Ga0068861_100010003
334 Ga0068860_100110068
335 Ga0081455_10002333
336 Ga0081455_10009199
337 Ga0081455_10022622
338 Ga0081455_10069163
339 Ga0081538_10003472
340 Ga0081540_1000747
341 Ga0081540_1000980
342 Ga0081540_1003605
343 Ga0081540_1003940
344 Ga0081539_10000785
345 Ga0070717_10002307
346 Ga0070717_10023790
347 Ga0075365_10011164
348 Ga0075365_10021602
349 Ga0075363_100001602
350 Ga0075363_100004791
351 Ga0075364_10031435
352 Ga0070712_100000918
353 Ga0075367_10004082
354 Ga0075367_10012193
355 Ga0097621_100041133
356 Ga0075428_100008701
357 Ga0075428_100074289
358 Ga0075430_100005836
359 Ga0075431_100000057
360 Ga0075431_100002357
361 Ga0075431_100006652
362 Ga0075431_100023441
363 Ga0075429_100007500
364 Ga0075429_100045599
365 Ga0097620_100008922
366 Ga0099794_10002879
367 Ga0099795_10006104
368 Ga0105240_10000975
369 Ga0111539_10000474
370 Ga0105245_10002061
371 Ga0105247_10010354
372 Ga0114129_10000591
373 Ga0105241_10056910
374 Ga0105242_10024562
375 Ga0105248_10017324
376 Ga0105248_10035983
377 Ga0105248_10143346
378 Ga0105237_10037421
379 Ga0105238_10006808
380 Ga0105238_10021283
381 Ga0105249_10034217
382 Ga0105249_10049847
383 Ga0105239_10036784
384 Ga0105239_10037206
385 Ga0105246_10009055
386 Ga0105246_10013278
387 Ga0157374_10012622
388 Ga0163162_10024629
389 Ga0157375_10007615
390 Ga0157375_10008870
391 Ga0163163_10029970
392 Ga0157380_10006081
393 Ga0157380_10024819
394 Ga0157380_10043590
395 Ga0157377_10037044
396 Ga0157376_10015069
397 Ga0157376_10082258
398 Ga0209758_1005193
399 Ga0207642_10005126
400 Ga0207688_10034396
401 Ga0207643_10005682
402 Ga0207684_10018163
403 Ga0207684_10056992
404 Ga0207707_10005625
405 Ga0207707_10101307
406 Ga0207695_10029784
407 Ga0207695_10114277
408 Ga0207693_10002234
409 Ga0207657_10038409
410 Ga0207694_10014871
411 Ga0207659_10003831
412 Ga0207687_10010910
413 Ga0207664_10020576
414 Ga0207664_10021855
415 Ga0207706_10045727
416 Ga0207670_10000705
417 Ga0207669_10002463
418 Ga0207669_10020813
419 Ga0207665_10002379
420 Ga0207691_10023450
421 Ga0207691_10027708
422 Ga0207711_10004964
423 Ga0207689_10002150
424 Ga0207661_10000346
425 Ga0207651_10001641
426 Ga0207712_10036667
427 Ga0207677_10027459
428 Ga0207639_10083806
429 Ga0207678_10004035
430 Ga0207708_10021691
431 Ga0207648_10014395
432 Ga0207676_10018513
433 Ga0207674_10112185
434 Ga0207675_100015562
435 Ga0207675_100079818
436 Ga0207683_10003473
437 Ga0207683_10013395
438 Ga0207683_10017909
439 Ga0207683_10125445
440 Ga0207698_10055431
441 Ga0209813_10003012
442 Ga0207428_10019285
443 Ga0268266_10030894
444 Ga0268265_10048132
445 Ga0265338_10033438
446 Ga0307513_10093908
447 Ga0373923_0001165
448 Ga0373936_0000103
449 Ga0373954_0000605
450 Ga0373943_0000924
451 Ga0373943_0023610
452 Ga0373955_0004119
453 Ga0373924_0001114
454 Ga0373935_0000017
455 Ga0373927_0019422
456 Ga0373927_0026573
457 Ga0373947_0000916
458 Ga0373947_0046489
459 Ga0373947_0052231
460 Ga0373937_0000103
461 Ga0373937_0038220
462 Ga0373925_0000058
463 Ga0373925_0014307
464 Ga0436365_0611669
465 Ga0466966_0039858
466 Ga0466957_0020419
467 Ga0466967_0026678
468 Ga0495592_0000343
469 Ga0495629_0002223
470 Ga0495629_0020597
471 Ga0495638_0004488
472 Ga0495651_0002876
473 Ga0495651_0022048
474 Ga0495653_0000072
475 Ga0495580_0033663
476 Ga0495580_0038432
477 Ga0495582_0005553
478 Ga0495639_0018874
479 Ga0495662_0008685
480 Ga0495662_0009791
481 Ga0495664_0000009
482 Ga0495594_0012500
483 Ga0495608_0000608
484 Ga0495618_0000061
485 Ga0495628_0000012
486 Ga0495630_0000945
487 Ga0495666_0028216
488 Ga0495652_0000021
489 Ga0495652_0028637
490 Ga0495665_0013942
491 Ga0495640_0000028
492 Ga0495640_0004326
493 Ga0495587_0000033
494 Ga0495645_0000017
495 Ga0495622_0016988
496 Ga0495667_0000515
497 Ga0495667_0006000
498 Ga0495656_0017128
499 Ga0495634_0001144
500 Ga0495634_0021586
501 Ga0495634_0050874
502 Ga0495635_0000019
503 Ga0495635_0009452
504 Ga0495657_0000982
505 Ga0495599_0000024
506 Ga0495623_0000022
507 Ga0495646_0000033
508 Ga0495658_0008046
509 Ga0495669_0009305
510 Ga0495613_0024393
511 Ga0495613_0040374
512 Ga0495600_0000028
513 Ga0495581_0029631
514 Ga0495604_0000011
515 Ga0495604_0026589
516 Ga0495674_0000015
517 Ga0495674_0032085
518 Ga0495676_0038702
519 Ga0495680_0001545
520 Ga0495680_0027159
521 Ga0495680_0095436
522 Ga0495675_0001637
523 Ga0495684_0000036
524 Ga0495684_0017213
525 Ga0495684_0018817
526 Ga0495593_0001316
527 Ga0495602_0000018
528 Ga0495614_0015997
529 Ga0496101_0004713
530 Ga0496102_0001488
531 Ga0496102_0005151
532 Ga0496102_0018355
533 Ga0496102_0053023
534 Ga0496103_0020911
535 Ga0496103_0042422
536 Ga0496104_0000711
537 Ga0496104_0000925
538 Ga0496104_0000971
539 Ga0496104_0007444
540 Ga0496105_0005447
541 Ga0496105_0005694
542 Ga0496105_0008367
543 Ga0496105_0030743
544 Ga0496106_0006058
545 Ga0496106_0007320
546 Ga0496106_0011446
547 Ga0496107_0009825
548 Ga0496108_0000835
549 Ga0496108_0009760
550 Ga0496108_0072046
551 Ga0496108_0088546
552 Ga0496109_0010188
553 Ga0496110_0009265
554 Ga0496110_0016576
555 Ga0496111_0001496
556 Ga0496112_0002146
557 Ga0496113_0001106
558 Ga0496113_0056553
559 Ga0496114_0003597
560 Ga0496114_0011065
561 Ga0496114_0017981
562 Ga0496114_0051378
563 Ga0496115_0001995
564 Ga0496115_0013160
565 Ga0496115_0023996
566 Ga0496115_0041751
567 Ga0496121_0004144
568 Ga0496126_0007725
569 Ga0501077_0052574
570 nmdc:mga0yw44_38116_c1
571 nmdc:mga0yw44_9615_c1
572 nmdc:mga0k408_4789_c1
573 nmdc:mga06z11_11809_c1
574 nmdc:mga06z11_1520_c1
575 nmdc:mga06z11_630_c1
576 nmdc:mga04h51_3303_c1
577 nmdc:mga05p37_14801_c1
578 nmdc:mga05p37_228_c1
579 nmdc:mga09592_6527_c1
580 nmdc:mga0qj67_11075_c1
581 nmdc:mga0qj67_2569_c1
582 nmdc:mga0qj67_70669_c1
583 nmdc:mga06r32_1001_c1
584 nmdc:mga06r32_145_c1
585 nmdc:mga06r32_26788_c1
586 nmdc:mga06r32_7465_c1
587 nmdc:mga08y16_420_c1
588 nmdc:mga08y16_8855_c1
589 Ga0495601_0000024
590 Ga0495612_0000606
591 Ga0495612_0004327
592 Ga0495595_0000036
593 Ga0495595_0001797
594 Ga0495619_0000034
595 Ga0495619_0012421
596 Ga0495619_0026557
597 Ga0495619_0047820
598 Ga0500647_0014547

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12228

DUF3604

Protein of unknown function (DUF3604)

247

406

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
3idu-assembly2.cif.gz_B crystal structure of the cardb domain of the pf1109 protein in complex with di-metal ions from pyrococcus furiosus, northeast structural genomics consortium target pfr193a 0.6238 168 263
2m8x-assembly1.cif.gz_A restrained cs-rosetta solution nmr structure of the cardb domain of pf1109 from pyrococcus furiosus. northeast structural genomics consortium target pfr193a 0.6045 168 263
1y1u-assembly2.cif.gz_C structure of unphosphorylated stat5a 0.5952 166 265
5y0a-assembly1.cif.gz_H cryo-em structure of zika virus complexed with fab of zka190 at ph 8.0 and 37 celsius degree 0.5923 168 250
7cj2-assembly2.cif.gz_K crystal structure of the fab antibody complexed with human ykl-40 0.5859 168 268
ID Description Score Start End Superfamily
6b6lB05 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7913 166 254 2.60.40.10
5t99B05 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7743 167 260 2.60.40.10
5dmyC05 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7368 167 264 2.60.40.10
4ypjB05 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7098 167 263 2.60.40.10
af_Q9VCR7_1_130_2.60.40.1080 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6927 167 264 2.60.40.1080
ID Description Score Start End GO Terms
AF-A0A2D9F210-F1-model_v4 DUF3604 domain-containing protein 0.9644 504 745
AF-A0A354QAS2-F1-model_v4 DUF3604 domain-containing protein 0.9629 161 248
AF-A0A354QAU8-F1-model_v4 DUF3604 domain-containing protein 0.9615 465 746
AF-A0A7V2W8M0-F1-model_v4 DUF3604 domain-containing protein 0.9588 177 746
AF-A0A7V2W8M0-F1-model_v4 DUF3604 domain-containing protein 0.9572 177 746

Map