F394856

General Info

Members Datasets Scaffolds Average Seq Length
299 165 598 205

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10002872|Ga0157379_100028724
Length 215
Sequence MRSAHTQTTARTVGEVLYNFHWVIPGEAARAMQAWAGGLGPFLKRRGIRAIINLRGRNDDLSWWKKETATAKANGIAHLDAMLDSRKLPTREMLERLVACFDTAPRPFMVKCSGGQDRASFAAALYVIHRDGWQAMPAAQAQFARFPYLHFPKTHQRWLKPFLEFARTDSGGAPLAQWIRESYTPEKLKAWLDDHGMEGSYAAIFTQPTRSPFQW

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
122 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
123 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
124 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
125 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
126 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
149 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
150 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
151 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
162 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
163 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
164 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 0
Rhizoplane 0
Rhizosphere 95.32
Stem 0
Stem Tuber 0
Unclassified 21.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10002872 3300014968 Bacteria 14522
2 JGI25165J46597_1000066 3300003214 Bacteria 199459
3 rootH2_10184274 3300003320 Bacteria 3523
4 Ga0070658_10014875 3300005327 Bacteria 6234
5 Ga0070658_10644699 3300005327 Bacteria 919
6 Ga0070690_100189443 3300005330 Bacteria 1425
7 Ga0070670_100350623 3300005331 Bacteria 1297
8 Ga0068869_100007944 3300005334 Bacteria 6815
9 Ga0068869_100205491 3300005334 Bacteria 1555
10 Ga0070666_10036306 3300005335 Bacteria 3270
11 Ga0068868_100157198 3300005338 Unclassified 1875
12 Ga0068868_100539557 3300005338 Bacteria 1026
13 Ga0070660_100008974 3300005339 Bacteria 7013
14 Ga0070660_100056103 3300005339 Bacteria 3047
15 Ga0070661_100100679 3300005344 Bacteria 2149
16 Ga0070692_10087013 3300005345 Unclassified 1692
17 Ga0070674_100144548 3300005356 Bacteria 1789
18 Ga0070673_100052495 3300005364 Bacteria 3198
19 Ga0070673_100416973 3300005364 Unclassified 1203
20 Ga0070709_10036132 3300005434 Bacteria 3007
21 Ga0070714_100032578 3300005435 Bacteria 4352
22 Ga0070713_100000002 3300005436 Bacteria 245989
23 Ga0070713_100057600 3300005436 Bacteria 3237
24 Ga0070711_100055777 3300005439 Bacteria 2730
25 Ga0070700_100142000 3300005441 Bacteria 1633
26 Ga0070681_10196997 3300005458 Bacteria 1933
27 Ga0068867_100013572 3300005459 Bacteria 5769
28 Ga0070699_100519010 3300005518 Bacteria 1083
29 Ga0070679_100106726 3300005530 Bacteria 2786
30 Ga0070679_100118819 3300005530 Bacteria 2628
31 Ga0070679_100303206 3300005530 Unclassified 1548
32 Ga0070684_100610896 3300005535 Unclassified 1014
33 Ga0070697_100288534 3300005536 Bacteria 1409
34 Ga0068853_100069523 3300005539 Bacteria 3063
35 Ga0068853_100691072 3300005539 Unclassified 973
36 Ga0070695_100200449 3300005545 Bacteria 1426
37 Ga0070695_100207162 3300005545 Bacteria 1405
38 Ga0070693_100034238 3300005547 Bacteria 2810
39 Ga0070665_100002717 3300005548 Bacteria 19178
40 Ga0070665_100105323 3300005548 Bacteria 2822
41 Ga0070665_100399226 3300005548 Unclassified 1383
42 Ga0070665_100449193 3300005548 Bacteria 1298
43 Ga0068855_100119639 3300005563 Bacteria 3015
44 Ga0070664_100293649 3300005564 Unclassified 1467
45 Ga0070664_100412038 3300005564 Bacteria 1237
46 Ga0068857_100000488 3300005577 Bacteria 28351
47 Ga0068854_100049959 3300005578 Unclassified 2990
48 Ga0068856_100000312 3300005614 Bacteria 53339
49 Ga0068856_100043905 3300005614 Bacteria 4397
50 Ga0068856_100128920 3300005614 Unclassified 2534
51 Ga0070702_100589710 3300005615 Unclassified 831
52 Ga0068852_100092284 3300005616 Bacteria 2711
53 Ga0068864_100029868 3300005618 Bacteria 4620
54 Ga0068861_100879186 3300005719 Unclassified 847
55 Ga0068870_10499054 3300005840 Bacteria 811
56 Ga0068860_100297828 3300005843 Unclassified 1579
57 Ga0081455_10087004 3300005937 Bacteria 2544
58 Ga0070716_100016346 3300006173 Bacteria 3827
59 Ga0070712_100000045 3300006175 Bacteria 66187
60 Ga0097621_100002395 3300006237 Bacteria 12851
61 Ga0097621_100042395 3300006237 Bacteria 3665
62 Ga0097621_100097834 3300006237 Bacteria 2464
63 Ga0097621_100186118 3300006237 Unclassified 1796
64 Ga0068871_100002867 3300006358 Bacteria 11816
65 Ga0068871_100110157 3300006358 Bacteria 2315
66 Ga0068871_100128000 3300006358 Unclassified 2151
67 Ga0068871_100174870 3300006358 Bacteria 1842
68 Ga0068865_100083558 3300006881 Bacteria 2298
69 Ga0068865_100295572 3300006881 Bacteria 1294
70 Ga0075436_100005402 3300006914 Bacteria 8791
71 Ga0105240_10101116 3300009093 Bacteria 3507
72 Ga0105240_10146732 3300009093 Bacteria 2815
73 Ga0105240_10171887 3300009093 Bacteria 2565
74 Ga0105240_10172179 3300009093 Bacteria 2563
75 Ga0105240_10220244 3300009093 Bacteria 2211
76 Ga0105240_10748729 3300009093 Unclassified 1062
77 Ga0105245_10385312 3300009098 Bacteria 1397
78 Ga0105243_10001197 3300009148 Bacteria 23346
79 Ga0105241_10052173 3300009174 Bacteria 3121
80 Ga0105241_10091716 3300009174 Bacteria 2398
81 Ga0105242_10027650 3300009176 Bacteria 4507
82 Ga0105237_10001328 3300009545 Bacteria 32811
83 Ga0105237_10128839 3300009545 Bacteria 2525
84 Ga0105237_10257971 3300009545 Unclassified 1746
85 Ga0105238_10069874 3300009551 Bacteria 3512
86 Ga0105238_10141154 3300009551 Bacteria 2386
87 Ga0105238_10159686 3300009551 Unclassified 2230
88 Ga0105238_10239989 3300009551 Unclassified 1790
89 Ga0105238_11063614 3300009551 Unclassified 831
90 Ga0105249_10451242 3300009553 Unclassified 1325
91 Ga0105239_10116647 3300010375 Bacteria 2963
92 Ga0105239_10290070 3300010375 Bacteria 1843
93 Ga0105246_10117055 3300011119 Bacteria 1968
94 Ga0105246_10179770 3300011119 Bacteria 1628
95 Ga0105246_10222800 3300011119 Bacteria 1479
96 Ga0157373_10006548 3300013100 Bacteria 8690
97 Ga0157370_10026052 3300013104 Bacteria 5778
98 Ga0157370_10086249 3300013104 Bacteria 2950
99 Ga0157370_10147487 3300013104 Bacteria 2190
100 Ga0157369_10001118 3300013105 Bacteria 33541
101 Ga0157369_10185503 3300013105 Unclassified 2188
102 Ga0157374_10766734 3300013296 Unclassified 980
103 Ga0163162_10253058 3300013306 Bacteria 1893
104 Ga0163162_11202428 3300013306 Unclassified 860
105 Ga0157372_10044453 3300013307 Bacteria 4922
106 Ga0157372_10170319 3300013307 Bacteria 2519
107 Ga0163163_10101352 3300014325 Bacteria 2902
108 Ga0163163_10125200 3300014325 Bacteria 2607
109 Ga0157379_10026768 3300014968 Bacteria 5134
110 Ga0157379_10439988 3300014968 Bacteria 1202
111 Ga0209233_1000045 3300025261 Bacteria 473379
112 Ga0209233_1004043 3300025261 Bacteria 5075
113 Ga0207688_10304074 3300025901 Bacteria 976
114 Ga0207680_10017215 3300025903 Bacteria 3814
115 Ga0207699_10000133 3300025906 Bacteria 50958
116 Ga0207645_10033106 3300025907 Bacteria 3322
117 Ga0207643_10375261 3300025908 Bacteria 896
118 Ga0207705_10013994 3300025909 Bacteria 5782
119 Ga0207705_10119502 3300025909 Bacteria 1954
120 Ga0207654_10038281 3300025911 Unclassified 2690
121 Ga0207707_10245132 3300025912 Unclassified 1557
122 Ga0207707_10667510 3300025912 Unclassified 875
123 Ga0207695_10007642 3300025913 Bacteria 13697
124 Ga0207695_10098347 3300025913 Bacteria 2926
125 Ga0207695_10139646 3300025913 Unclassified 2373
126 Ga0207695_10142998 3300025913 Unclassified 2339
127 Ga0207671_10022590 3300025914 Bacteria 4753
128 Ga0207671_10281983 3300025914 Bacteria 1310
129 Ga0207693_10000035 3300025915 Bacteria 110713
130 Ga0207657_10006000 3300025919 Bacteria 12639
131 Ga0207657_10030468 3300025919 Bacteria 4896
132 Ga0207649_10135764 3300025920 Bacteria 1677
133 Ga0207652_10011608 3300025921 Bacteria 7107
134 Ga0207652_10207706 3300025921 Bacteria 1763
135 Ga0207694_10031450 3300025924 Bacteria 4054
136 Ga0207694_10102099 3300025924 Bacteria 2273
137 Ga0207694_10153878 3300025924 Unclassified 1854
138 Ga0207687_10111947 3300025927 Bacteria 2028
139 Ga0207700_10000037 3300025928 Bacteria 115488
140 Ga0207690_10498259 3300025932 Unclassified 985
141 Ga0207686_10022187 3300025934 Bacteria 3654
142 Ga0207709_10031231 3300025935 Bacteria 3109
143 Ga0207670_10699789 3300025936 Unclassified 839
144 Ga0207704_10301953 3300025938 Bacteria 1227
145 Ga0207691_10392793 3300025940 Bacteria 1183
146 Ga0207689_10024520 3300025942 Bacteria 5061
147 Ga0207689_10187240 3300025942 Unclassified 1707
148 Ga0207667_10067240 3300025949 Bacteria 3733
149 Ga0207667_10168620 3300025949 Unclassified 2250
150 Ga0207667_10502076 3300025949 Bacteria 1230
151 Ga0207640_10059638 3300025981 Unclassified 2519
152 Ga0207703_10007284 3300026035 Bacteria 8795
153 Ga0207639_10017735 3300026041 Bacteria 5048
154 Ga0207639_10128183 3300026041 Bacteria 2096
155 Ga0207639_10407302 3300026041 Unclassified 1226
156 Ga0207702_10000007 3300026078 Bacteria 332551
157 Ga0207702_10000012 3300026078 Bacteria 269770
158 Ga0207702_10053696 3300026078 Bacteria 3412
159 Ga0207702_10158286 3300026078 Unclassified 2066
160 Ga0207648_10048323 3300026089 Bacteria 3726
161 Ga0207676_10285668 3300026095 Bacteria 1500
162 Ga0207674_10000107 3300026116 Bacteria 95635
163 Ga0268266_10000357 3300028379 Bacteria 70858
164 Ga0268266_10020420 3300028379 Bacteria 5645
165 Ga0268266_10187045 3300028379 Bacteria 1889
166 Ga0268266_10448096 3300028379 Unclassified 1227
167 Ga0268264_10452432 3300028381 Unclassified 1244
168 Ga0265318_10003625 3300028577 Bacteria 7710
169 Ga0265338_10001374 3300028800 Bacteria 39593
170 Ga0265338_10386882 3300028800 Unclassified 999
171 Ga0265332_10050288 3300031238 Unclassified 1791
172 Ga0265325_10028873 3300031241 Bacteria 2986
173 Ga0265340_10109185 3300031247 Bacteria 1280
174 Ga0265340_10237837 3300031247 Bacteria 813
175 Ga0265331_10023873 3300031250 Bacteria 3100
176 Ga0307513_10234004 3300031456 Unclassified 1648
177 Ga0265313_10003138 3300031595 Bacteria 13641
178 Ga0265313_10007299 3300031595 Bacteria 7588
179 Ga0265314_10012564 3300031711 Bacteria 6898
180 Ga0265314_10072609 3300031711 Bacteria 2298
181 Ga0265314_10077199 3300031711 Bacteria 2210
182 Ga0265342_10049362 3300031712 Bacteria 2518
183 Ga0307516_10007154 3300031730 Bacteria 12884
184 Ga0307516_10149611 3300031730 Bacteria 2097
185 Ga0307516_10226449 3300031730 Bacteria 1576
186 Ga0373926_0163949 3300035083 Unclassified 849
187 Ga0373955_0191072 3300035172 Unclassified 1217
188 Ga0373933_0021877 3300035724 Bacteria 3637
189 Ga0373937_0006685 3300036401 Bacteria 9957
190 Ga0373925_0167772 3300037068 Unclassified 1732
191 Ga0451841_1067848 3300041498 Unclassified 659
192 Ga0495664_0049367 3300046477 Bacteria 2498
193 Ga0495664_0368786 3300046477 Unclassified 864
194 Ga0495585_0088801 3300046492 Unclassified 1667
195 Ga0495606_0040419 3300046507 Bacteria 3135
196 Ga0495606_0286315 3300046507 Unclassified 899
197 Ga0495628_0202348 3300046516 Bacteria 1496
198 Ga0495652_0058433 3300046529 Bacteria 3265
199 Ga0495609_0123461 3300046538 Unclassified 1112
200 Ga0495645_0055921 3300046543 Bacteria 2865
201 Ga0495622_0002481 3300046557 Bacteria 8925
202 Ga0495623_0097825 3300046679 Unclassified 1792
203 Ga0495672_0134000 3300047320 Unclassified 1301
204 Ga0495675_0051262 3300047444 Bacteria 2622
205 Ga0495602_0118623 3300048088 Bacteria 2134
206 Ga0496121_0000342 3300048924 Bacteria 97267
207 Ga0501031_0005337 3300049568 Bacteria 8370
208 Ga0501031_0054919 3300049568 Bacteria 2595
209 Ga0501031_0195050 3300049568 Unclassified 1322
210 Ga0501032_0107270 3300049569 Bacteria 1850
211 Ga0501032_0315321 3300049569 Bacteria 1010
212 Ga0501033_0013658 3300049570 Bacteria 6179
213 Ga0501033_0018280 3300049570 Bacteria 5296
214 Ga0501033_0027445 3300049570 Bacteria 4280
215 Ga0501033_0063186 3300049570 Bacteria 2725
216 Ga0501033_0071501 3300049570 Bacteria 2548
217 Ga0501033_0083504 3300049570 Bacteria 2341
218 Ga0501033_0127712 3300049570 Unclassified 1843
219 Ga0501033_0167100 3300049570 Bacteria 1581
220 Ga0501033_0189522 3300049570 Bacteria 1472
221 Ga0501034_0007822 3300049571 Bacteria 11368
222 Ga0501034_0316823 3300049571 Bacteria 1493
223 Ga0501034_0453619 3300049571 Bacteria 1200
224 Ga0501036_0047013 3300049572 Bacteria 3654
225 Ga0501036_0300826 3300049572 Unclassified 1342
226 Ga0501036_0350800 3300049572 Bacteria 1232
227 Ga0501036_0586235 3300049572 Bacteria 926
228 Ga0501037_0018392 3300049573 Bacteria 5150
229 Ga0501037_0037237 3300049573 Bacteria 3586
230 Ga0501037_0071899 3300049573 Unclassified 2516
231 Ga0501037_0091444 3300049573 Bacteria 2200
232 Ga0501037_0104486 3300049573 Bacteria 2042
233 Ga0501037_0105562 3300049573 Bacteria 2030
234 Ga0501037_0241571 3300049573 Bacteria 1266
235 Ga0501038_0013914 3300049574 Bacteria 7333
236 Ga0501038_0025426 3300049574 Bacteria 5278
237 Ga0501038_0097108 3300049574 Bacteria 2458
238 Ga0501038_0108555 3300049574 Bacteria 2301
239 Ga0501038_0200890 3300049574 Unclassified 1600
240 Ga0501039_0000722 3300049575 Bacteria 23835
241 Ga0501042_0106823 3300049578 Bacteria 2015
242 Ga0501043_0002787 3300049579 Bacteria 14605
243 Ga0501043_0123887 3300049579 Bacteria 2027
244 Ga0501043_0159090 3300049579 Bacteria 1765
245 Ga0501043_0262181 3300049579 Bacteria 1329
246 Ga0501043_0274765 3300049579 Bacteria 1293
247 Ga0501043_0390782 3300049579 Unclassified 1052
248 Ga0501046_0045565 3300049580 Bacteria 3484
249 Ga0501046_0102404 3300049580 Bacteria 2195
250 Ga0501046_0114054 3300049580 Bacteria 2062
251 Ga0501047_0002340 3300049581 Bacteria 18119
252 Ga0501047_0027509 3300049581 Bacteria 5479
253 Ga0501047_0065482 3300049581 Bacteria 3503
254 Ga0501047_0550747 3300049581 Unclassified 978
255 Ga0501047_0610036 3300049581 Bacteria 912
256 Ga0501047_0942515 3300049581 Unclassified 676
257 Ga0501048_0326880 3300049582 Unclassified 1092
258 Ga0501067_0000729 3300049583 Bacteria 17689
259 Ga0501068_0078035 3300049584 Bacteria 2029
260 Ga0501069_0045069 3300049585 Bacteria 2442
261 Ga0501070_0000017 3300049586 Bacteria 173127
262 Ga0501070_0100133 3300049586 Bacteria 2397
263 Ga0501070_0175803 3300049586 Bacteria 1763
264 Ga0501072_0017363 3300049588 Bacteria 5529
265 Ga0501073_0022904 3300049589 Bacteria 4492
266 Ga0501074_0002558 3300049590 Bacteria 12695
267 Ga0501075_0550916 3300049591 Unclassified 880
268 Ga0501076_0106262 3300049592 Bacteria 2266
269 Ga0501079_0001593 3300049741 Bacteria 16128
270 Ga0501079_0095492 3300049741 Bacteria 2304
271 Ga0501080_0000444 3300049742 Bacteria 32129
272 Ga0501083_0003163 3300049744 Bacteria 11458
273 Ga0501035_0001450 3300049822 Bacteria 24304
274 Ga0501035_0012962 3300049822 Bacteria 7694
275 Ga0501035_0057722 3300049822 Bacteria 3460
276 Ga0501035_0065677 3300049822 Bacteria 3221
277 Ga0501035_0075225 3300049822 Bacteria 2987
278 Ga0501035_0174284 3300049822 Bacteria 1856
279 Ga0501035_0334312 3300049822 Bacteria 1270
280 Ga0501035_0376505 3300049822 Bacteria 1184
281 Ga0501035_0557545 3300049822 Bacteria 938
282 Ga0501044_0004434 3300049823 Bacteria 15704
283 Ga0501044_0020097 3300049823 Bacteria 7129
284 Ga0501044_0057723 3300049823 Bacteria 3983
285 Ga0501044_0137053 3300049823 Bacteria 2438
286 Ga0501044_0210748 3300049823 Bacteria 1897
287 Ga0501044_0441882 3300049823 Bacteria 1208
288 Ga0501045_0365342 3300049824 Unclassified 1074
289 nmdc:mga0n895_395734_c1 3300050512 Bacteria 1397
290 nmdc:mga0rr50_39913_c1 3300050513 Bacteria 3408
291 nmdc:mga08x19_180721_c1 3300050514 Unclassified 1440
292 nmdc:mga08x19_38_c1 3300050514 Bacteria 159604
293 nmdc:mga08x19_99_c1 3300050514 Bacteria 76277
294 Ga0500635_0012450 3300053080 Bacteria 2444
295 Ga0500566_0172011 3300053094 Unclassified 1119
296 Ga0500595_010723 3300053119 Bacteria 3626
297 Ga0500559_0057132 3300053136 Bacteria 1733
298 Ga0501084_0009168 3300054114 Bacteria 8184
299 Ga0501084_0202315 3300054114 Bacteria 1676
300 Ga0157379_10002872
301 JGI25165J46597_1000066
302 rootH2_10184274
303 Ga0070658_10014875
304 Ga0070658_10644699
305 Ga0070690_100189443
306 Ga0070670_100350623
307 Ga0068869_100007944
308 Ga0068869_100205491
309 Ga0070666_10036306
310 Ga0068868_100157198
311 Ga0068868_100539557
312 Ga0070660_100008974
313 Ga0070660_100056103
314 Ga0070661_100100679
315 Ga0070692_10087013
316 Ga0070674_100144548
317 Ga0070673_100052495
318 Ga0070673_100416973
319 Ga0070709_10036132
320 Ga0070714_100032578
321 Ga0070713_100000002
322 Ga0070713_100057600
323 Ga0070711_100055777
324 Ga0070700_100142000
325 Ga0070681_10196997
326 Ga0068867_100013572
327 Ga0070699_100519010
328 Ga0070679_100106726
329 Ga0070679_100118819
330 Ga0070679_100303206
331 Ga0070684_100610896
332 Ga0070697_100288534
333 Ga0068853_100069523
334 Ga0068853_100691072
335 Ga0070695_100200449
336 Ga0070695_100207162
337 Ga0070693_100034238
338 Ga0070665_100002717
339 Ga0070665_100105323
340 Ga0070665_100399226
341 Ga0070665_100449193
342 Ga0068855_100119639
343 Ga0070664_100293649
344 Ga0070664_100412038
345 Ga0068857_100000488
346 Ga0068854_100049959
347 Ga0068856_100000312
348 Ga0068856_100043905
349 Ga0068856_100128920
350 Ga0070702_100589710
351 Ga0068852_100092284
352 Ga0068864_100029868
353 Ga0068861_100879186
354 Ga0068870_10499054
355 Ga0068860_100297828
356 Ga0081455_10087004
357 Ga0070716_100016346
358 Ga0070712_100000045
359 Ga0097621_100002395
360 Ga0097621_100042395
361 Ga0097621_100097834
362 Ga0097621_100186118
363 Ga0068871_100002867
364 Ga0068871_100110157
365 Ga0068871_100128000
366 Ga0068871_100174870
367 Ga0068865_100083558
368 Ga0068865_100295572
369 Ga0075436_100005402
370 Ga0105240_10101116
371 Ga0105240_10146732
372 Ga0105240_10171887
373 Ga0105240_10172179
374 Ga0105240_10220244
375 Ga0105240_10748729
376 Ga0105245_10385312
377 Ga0105243_10001197
378 Ga0105241_10052173
379 Ga0105241_10091716
380 Ga0105242_10027650
381 Ga0105237_10001328
382 Ga0105237_10128839
383 Ga0105237_10257971
384 Ga0105238_10069874
385 Ga0105238_10141154
386 Ga0105238_10159686
387 Ga0105238_10239989
388 Ga0105238_11063614
389 Ga0105249_10451242
390 Ga0105239_10116647
391 Ga0105239_10290070
392 Ga0105246_10117055
393 Ga0105246_10179770
394 Ga0105246_10222800
395 Ga0157373_10006548
396 Ga0157370_10026052
397 Ga0157370_10086249
398 Ga0157370_10147487
399 Ga0157369_10001118
400 Ga0157369_10185503
401 Ga0157374_10766734
402 Ga0163162_10253058
403 Ga0163162_11202428
404 Ga0157372_10044453
405 Ga0157372_10170319
406 Ga0163163_10101352
407 Ga0163163_10125200
408 Ga0157379_10026768
409 Ga0157379_10439988
410 Ga0209233_1000045
411 Ga0209233_1004043
412 Ga0207688_10304074
413 Ga0207680_10017215
414 Ga0207699_10000133
415 Ga0207645_10033106
416 Ga0207643_10375261
417 Ga0207705_10013994
418 Ga0207705_10119502
419 Ga0207654_10038281
420 Ga0207707_10245132
421 Ga0207707_10667510
422 Ga0207695_10007642
423 Ga0207695_10098347
424 Ga0207695_10139646
425 Ga0207695_10142998
426 Ga0207671_10022590
427 Ga0207671_10281983
428 Ga0207693_10000035
429 Ga0207657_10006000
430 Ga0207657_10030468
431 Ga0207649_10135764
432 Ga0207652_10011608
433 Ga0207652_10207706
434 Ga0207694_10031450
435 Ga0207694_10102099
436 Ga0207694_10153878
437 Ga0207687_10111947
438 Ga0207700_10000037
439 Ga0207690_10498259
440 Ga0207686_10022187
441 Ga0207709_10031231
442 Ga0207670_10699789
443 Ga0207704_10301953
444 Ga0207691_10392793
445 Ga0207689_10024520
446 Ga0207689_10187240
447 Ga0207667_10067240
448 Ga0207667_10168620
449 Ga0207667_10502076
450 Ga0207640_10059638
451 Ga0207703_10007284
452 Ga0207639_10017735
453 Ga0207639_10128183
454 Ga0207639_10407302
455 Ga0207702_10000007
456 Ga0207702_10000012
457 Ga0207702_10053696
458 Ga0207702_10158286
459 Ga0207648_10048323
460 Ga0207676_10285668
461 Ga0207674_10000107
462 Ga0268266_10000357
463 Ga0268266_10020420
464 Ga0268266_10187045
465 Ga0268266_10448096
466 Ga0268264_10452432
467 Ga0265318_10003625
468 Ga0265338_10001374
469 Ga0265338_10386882
470 Ga0265332_10050288
471 Ga0265325_10028873
472 Ga0265340_10109185
473 Ga0265340_10237837
474 Ga0265331_10023873
475 Ga0307513_10234004
476 Ga0265313_10003138
477 Ga0265313_10007299
478 Ga0265314_10012564
479 Ga0265314_10072609
480 Ga0265314_10077199
481 Ga0265342_10049362
482 Ga0307516_10007154
483 Ga0307516_10149611
484 Ga0307516_10226449
485 Ga0373926_0163949
486 Ga0373955_0191072
487 Ga0373933_0021877
488 Ga0373937_0006685
489 Ga0373925_0167772
490 Ga0451841_1067848
491 Ga0495664_0049367
492 Ga0495664_0368786
493 Ga0495585_0088801
494 Ga0495606_0040419
495 Ga0495606_0286315
496 Ga0495628_0202348
497 Ga0495652_0058433
498 Ga0495609_0123461
499 Ga0495645_0055921
500 Ga0495622_0002481
501 Ga0495623_0097825
502 Ga0495672_0134000
503 Ga0495675_0051262
504 Ga0495602_0118623
505 Ga0496121_0000342
506 Ga0501031_0005337
507 Ga0501031_0054919
508 Ga0501031_0195050
509 Ga0501032_0107270
510 Ga0501032_0315321
511 Ga0501033_0013658
512 Ga0501033_0018280
513 Ga0501033_0027445
514 Ga0501033_0063186
515 Ga0501033_0071501
516 Ga0501033_0083504
517 Ga0501033_0127712
518 Ga0501033_0167100
519 Ga0501033_0189522
520 Ga0501034_0007822
521 Ga0501034_0316823
522 Ga0501034_0453619
523 Ga0501036_0047013
524 Ga0501036_0300826
525 Ga0501036_0350800
526 Ga0501036_0586235
527 Ga0501037_0018392
528 Ga0501037_0037237
529 Ga0501037_0071899
530 Ga0501037_0091444
531 Ga0501037_0104486
532 Ga0501037_0105562
533 Ga0501037_0241571
534 Ga0501038_0013914
535 Ga0501038_0025426
536 Ga0501038_0097108
537 Ga0501038_0108555
538 Ga0501038_0200890
539 Ga0501039_0000722
540 Ga0501042_0106823
541 Ga0501043_0002787
542 Ga0501043_0123887
543 Ga0501043_0159090
544 Ga0501043_0262181
545 Ga0501043_0274765
546 Ga0501043_0390782
547 Ga0501046_0045565
548 Ga0501046_0102404
549 Ga0501046_0114054
550 Ga0501047_0002340
551 Ga0501047_0027509
552 Ga0501047_0065482
553 Ga0501047_0550747
554 Ga0501047_0610036
555 Ga0501047_0942515
556 Ga0501048_0326880
557 Ga0501067_0000729
558 Ga0501068_0078035
559 Ga0501069_0045069
560 Ga0501070_0000017
561 Ga0501070_0100133
562 Ga0501070_0175803
563 Ga0501072_0017363
564 Ga0501073_0022904
565 Ga0501074_0002558
566 Ga0501075_0550916
567 Ga0501076_0106262
568 Ga0501079_0001593
569 Ga0501079_0095492
570 Ga0501080_0000444
571 Ga0501083_0003163
572 Ga0501035_0001450
573 Ga0501035_0012962
574 Ga0501035_0057722
575 Ga0501035_0065677
576 Ga0501035_0075225
577 Ga0501035_0174284
578 Ga0501035_0334312
579 Ga0501035_0376505
580 Ga0501035_0557545
581 Ga0501044_0004434
582 Ga0501044_0020097
583 Ga0501044_0057723
584 Ga0501044_0137053
585 Ga0501044_0210748
586 Ga0501044_0441882
587 Ga0501045_0365342
588 nmdc:mga0n895_395734_c1
589 nmdc:mga0rr50_39913_c1
590 nmdc:mga08x19_180721_c1
591 nmdc:mga08x19_38_c1
592 nmdc:mga08x19_99_c1
593 Ga0500635_0012450
594 Ga0500566_0172011
595 Ga0500595_010723
596 Ga0500559_0057132
597 Ga0501084_0009168
598 Ga0501084_0202315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i6o-assembly1.cif.gz_A crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n 0.7703 17 165
7mom-assembly1.cif.gz_A crystal structure of arabidopsis thaliana plant and fungi atypical dual specificity phosphatase 1(atpfa-dsp1 ) in complex with a metaphosphate intermediate 0.7519 14 158
3nme-assembly1.cif.gz_B structure of a plant phosphatase 0.748 15 137
2q47-assembly1.cif.gz_B ensemble refinement of the protein crystal structure of a putative phosphoprotein phosphatase from arabidopsis thaliana gene at1g05000 0.733 14 158
2i6o-assembly1.cif.gz_A crystal structure of the complex of the archaeal sulfolobus ptp-fold phosphatase with phosphopeptides n-g-(p)y-k-n 0.7282 17 165
ID Description Score Start End Superfamily
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7664 17 165 3.90.190.10
af_Q86BN8_31_197_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7636 16 141 3.90.190.10
af_Q553L4_151_315_3.30.420.110 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;MutS, connector domain 0.7425 24 78 3.30.420.110
2q47A00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7396 14 154 3.90.190.10
2dxpA00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.7245 17 165 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A4Q6FBX4-F1-model_v4 deleted 0.9543 11 211
AF-A0A846MZ82-F1-model_v4 Tyrosine specific protein phosphatases domain-containing protein 0.954 11 211
AF-A0A846N111-F1-model_v4 Protein tyrosine/serine phosphatase 0.9462 7 198
AF-A0A2D7SW74-F1-model_v4 Protein tyrosine phosphatase 0.9462 30 198
AF-A0A4Q6FBX4-F1-model_v4 deleted 0.9451 11 211

Map