F394850

General Info

Members Datasets Scaffolds Average Seq Length
299 199 598 424

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10012284|Ga0157380_100122842
Length 453
Sequence MTNMTTTRSARLWRRFASAGAVLALLTALPAAQQLAPASRTATAXXASRAGFSVERLKRVDALLQRYVDEQRLAGAVALVLRDGQPVYERAVGWSDKEAGRPMAMDTVFRIASQTKAITSAVVLSLMEEGRLGLGDPVSRFVPAFATTTVSVAGPGAATIVPAKRAITIRDLLTHTAGISYGTEPRVAAAYEAKGLGPAAGRGWYFADKDDGVCPSIDRLATVPFLSQPGEEWVYGYNTDILGCVVERITGQSLDAVVRARVTGPLGLTDTQFFLPPSQRTRLAALYGSGPDGTIARAAEGSSGQGHYVEGPRRSFSGGAGLLSTARDYSRFLEMIRLGGALDGTRVLAPRTVQLMTTNQVGTLHSTTGLGFGLGFETTDRYGANGMDSAGSFGWSGAYGTMYRVDPEARLVMVLMIQLMPNTSDIRTTFPTAVYQALIETPSRPVPRAAGTQ

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
101 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
102 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
103 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
104 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
105 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
106 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
107 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
110 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
125 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.34
Nodule 0
Rhizoplane 3.68
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 6.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10012284 3300014326 Bacteria 6208
2 Ga0065715_10143085 3300005293 Bacteria 1818
3 Ga0070676_10012092 3300005328 Unclassified 4706
4 Ga0070690_100003759 3300005330 Bacteria 8365
5 Ga0070690_100009141 3300005330 Bacteria 5734
6 Ga0070670_100008180 3300005331 Bacteria 8907
7 Ga0070677_10036538 3300005333 Bacteria 1912
8 Ga0068869_100017765 3300005334 Unclassified 4831
9 Ga0070687_100005595 3300005343 Bacteria 5100
10 Ga0070669_100036902 3300005353 Bacteria 3543
11 Ga0070675_100001817 3300005354 Bacteria 15793
12 Ga0070675_100081704 3300005354 Bacteria 2695
13 Ga0070671_100021450 3300005355 Bacteria 5275
14 Ga0070671_100207021 3300005355 Bacteria 1664
15 Ga0070674_100019274 3300005356 Bacteria 4332
16 Ga0070674_100152826 3300005356 Bacteria 1743
17 Ga0070673_100005850 3300005364 Bacteria 7929
18 Ga0070688_100007016 3300005365 Bacteria 6057
19 Ga0070713_100005356 3300005436 Bacteria 8760
20 Ga0070700_100012255 3300005441 Bacteria 4778
21 Ga0070694_100005041 3300005444 Bacteria 7969
22 Ga0070694_100019359 3300005444 Bacteria 4328
23 Ga0070708_100133671 3300005445 Bacteria 2297
24 Ga0070663_100044889 3300005455 Unclassified 3119
25 Ga0068867_100010961 3300005459 Bacteria 6393
26 Ga0070698_100321901 3300005471 Bacteria 1477
27 Ga0070697_100015442 3300005536 Bacteria 5995
28 Ga0070672_100010074 3300005543 Bacteria 6543
29 Ga0070672_100060029 3300005543 Unclassified 2993
30 Ga0070672_100069666 3300005543 Bacteria 2793
31 Ga0070672_100148667 3300005543 Bacteria 1937
32 Ga0070686_100001195 3300005544 Bacteria 14770
33 Ga0070686_100062827 3300005544 Bacteria 2404
34 Ga0070686_100080676 3300005544 Bacteria 2153
35 Ga0070665_100030087 3300005548 Bacteria 5464
36 Ga0070704_100012338 3300005549 Bacteria 5276
37 Ga0070664_100005959 3300005564 Bacteria 9851
38 Ga0068859_100007258 3300005617 Bacteria 11241
39 Ga0068859_100350928 3300005617 Bacteria 1570
40 Ga0068864_100002943 3300005618 Bacteria 14083
41 Ga0068864_100019381 3300005618 Bacteria 5689
42 Ga0068861_100011953 3300005719 Bacteria 6046
43 Ga0068861_100058915 3300005719 Bacteria 2938
44 Ga0068870_10006605 3300005840 Bacteria 5124
45 Ga0068858_100009103 3300005842 Bacteria 9495
46 Ga0068858_100013132 3300005842 Bacteria 7810
47 Ga0068862_100114948 3300005844 Bacteria 2366
48 Ga0075365_10017010 3300006038 Bacteria 4440
49 Ga0075364_10012874 3300006051 Bacteria 5131
50 Ga0075364_10029055 3300006051 Bacteria 3543
51 Ga0075362_10000363 3300006177 Bacteria 13081
52 Ga0075367_10036271 3300006178 Bacteria 2858
53 Ga0075366_10022348 3300006195 Bacteria 3678
54 Ga0097621_100010013 3300006237 Bacteria 6912
55 Ga0097621_100071372 3300006237 Bacteria 2870
56 Ga0075370_10096588 3300006353 Bacteria 1707
57 Ga0068871_100011110 3300006358 Bacteria 6600
58 Ga0068871_100014632 3300006358 Bacteria 5853
59 Ga0068871_100094351 3300006358 Bacteria 2498
60 Ga0075430_100001509 3300006846 Bacteria 19006
61 Ga0075431_100009617 3300006847 Bacteria 9710
62 Ga0075431_100058845 3300006847 Bacteria 3965
63 Ga0075433_10063179 3300006852 Bacteria 3244
64 Ga0075433_10067225 3300006852 Bacteria 3146
65 Ga0075434_100000051 3300006871 Bacteria 57214
66 Ga0075434_100006311 3300006871 Bacteria 10864
67 Ga0075434_100007559 3300006871 Bacteria 10068
68 Ga0075434_100022578 3300006871 Bacteria 6128
69 Ga0075434_100024623 3300006871 Bacteria 5886
70 Ga0075434_100170300 3300006871 Bacteria 2198
71 Ga0075429_100011764 3300006880 Bacteria 7589
72 Ga0068865_100003295 3300006881 Bacteria 9668
73 Ga0068865_100023634 3300006881 Bacteria 4026
74 Ga0075436_100000678 3300006914 Bacteria 22461
75 Ga0075436_100032123 3300006914 Bacteria 3617
76 Ga0097620_100007258 3300006931 Bacteria 11241
77 Ga0097620_100350986 3300006931 Bacteria 1570
78 Ga0075435_100000006 3300007076 Bacteria 119843
79 Ga0075435_100002651 3300007076 Bacteria 11930
80 Ga0075435_100008519 3300007076 Bacteria 7365
81 Ga0111539_10050537 3300009094 Bacteria 4953
82 Ga0111539_10206844 3300009094 Unclassified 2288
83 Ga0111539_10241349 3300009094 Bacteria 2104
84 Ga0105245_10373493 3300009098 Bacteria 1418
85 Ga0105247_10003450 3300009101 Bacteria 10305
86 Ga0105247_10149676 3300009101 Bacteria 1537
87 Ga0114129_10045112 3300009147 Bacteria 6198
88 Ga0114129_10265574 3300009147 Bacteria 2298
89 Ga0114129_10309943 3300009147 Unclassified 2101
90 Ga0105242_10003514 3300009176 Bacteria 12177
91 Ga0105242_10077817 3300009176 Unclassified 2768
92 Ga0105248_10010022 3300009177 Bacteria 10433
93 Ga0105237_10092719 3300009545 Bacteria 3010
94 Ga0157378_10096810 3300013297 Bacteria 2689
95 Ga0163163_10020387 3300014325 Bacteria 6242
96 Ga0163163_10114556 3300014325 Bacteria 2727
97 Ga0157380_10014350 3300014326 Bacteria 5796
98 Ga0157380_10055823 3300014326 Bacteria 3138
99 Ga0157380_10207099 3300014326 Unclassified 1745
100 Ga0157379_10093374 3300014968 Bacteria 2699
101 Ga0207682_10006269 3300025893 Bacteria 4803
102 Ga0207710_10026280 3300025900 Bacteria 2515
103 Ga0207680_10101986 3300025903 Bacteria 1845
104 Ga0207645_10005013 3300025907 Bacteria 9702
105 Ga0207643_10009894 3300025908 Bacteria 5124
106 Ga0207671_10202089 3300025914 Unclassified 1552
107 Ga0207662_10010480 3300025918 Bacteria 5120
108 Ga0207681_10035445 3300025923 Unclassified 3288
109 Ga0207694_10018531 3300025924 Bacteria 5260
110 Ga0207650_10009245 3300025925 Bacteria 6735
111 Ga0207659_10002426 3300025926 Bacteria 11112
112 Ga0207659_10040076 3300025926 Bacteria 3272
113 Ga0207687_10056283 3300025927 Bacteria 2758
114 Ga0207686_10065935 3300025934 Unclassified 2311
115 Ga0207670_10217118 3300025936 Unclassified 1462
116 Ga0207669_10002501 3300025937 Bacteria 7840
117 Ga0207669_10079960 3300025937 Bacteria 2089
118 Ga0207704_10006937 3300025938 Bacteria 5315
119 Ga0207691_10055617 3300025940 Bacteria 3605
120 Ga0207691_10060103 3300025940 Bacteria 3455
121 Ga0207691_10072911 3300025940 Bacteria 3096
122 Ga0207691_10165283 3300025940 Unclassified 1940
123 Ga0207711_10075236 3300025941 Bacteria 2938
124 Ga0207689_10011224 3300025942 Bacteria 7689
125 Ga0207689_10081552 3300025942 Bacteria 2659
126 Ga0207679_10061491 3300025945 Bacteria 2796
127 Ga0207651_10035295 3300025960 Bacteria 3249
128 Ga0207651_10133979 3300025960 Bacteria 1902
129 Ga0207703_10022218 3300026035 Bacteria 4974
130 Ga0207703_10025297 3300026035 Bacteria 4669
131 Ga0207678_10065076 3300026067 Unclassified 3131
132 Ga0207708_10055213 3300026075 Bacteria 3028
133 Ga0207641_10082475 3300026088 Bacteria 2794
134 Ga0207648_10000831 3300026089 Bacteria 34764
135 Ga0207676_10003156 3300026095 Bacteria 11760
136 Ga0207676_10047456 3300026095 Bacteria 3329
137 Ga0207675_100023307 3300026118 Bacteria 5757
138 Ga0207675_100061316 3300026118 Bacteria 3511
139 Ga0207675_100119450 3300026118 Bacteria 2493
140 Ga0207675_100249834 3300026118 Bacteria 1716
141 Ga0207683_10009918 3300026121 Bacteria 8122
142 Ga0207428_10011794 3300027907 Bacteria 7703
143 Ga0207428_10015698 3300027907 Bacteria 6542
144 Ga0268266_10025939 3300028379 Bacteria 4986
145 Ga0265332_10015522 3300031238 Bacteria 3362
146 Ga0265327_10026321 3300031251 Bacteria 3372
147 Ga0307509_10001123 3300031507 Bacteria 45912
148 Ga0307408_100093649 3300031548 Bacteria 2273
149 Ga0307408_100194191 3300031548 Bacteria 1638
150 Ga0265314_10021025 3300031711 Bacteria 5029
151 Ga0307405_10052371 3300031731 Bacteria 2537
152 Ga0307405_10060044 3300031731 Bacteria 2398
153 Ga0307413_10021199 3300031824 Bacteria 3473
154 Ga0307413_10102652 3300031824 Bacteria 1894
155 Ga0307410_10008009 3300031852 Bacteria 5829
156 Ga0307410_10010216 3300031852 Bacteria 5305
157 Ga0307410_10040560 3300031852 Bacteria 3064
158 Ga0307409_100028622 3300031995 Bacteria 3973
159 Ga0307416_100006019 3300032002 Bacteria 7546
160 Ga0307416_100009720 3300032002 Bacteria 6316
161 Ga0307416_100058150 3300032002 Bacteria 3133
162 Ga0307414_10009070 3300032004 Bacteria 5693
163 Ga0307411_10004401 3300032005 Bacteria 6737
164 Ga0307411_10021105 3300032005 Bacteria 3803
165 Ga0307415_100006482 3300032126 Bacteria 6320
166 Ga0373950_0009130 3300034818 Bacteria 1575
167 Ga0373959_0003898 3300034820 Bacteria 2387
168 Ga0373929_0002541 3300035085 Bacteria 3352
169 Ga0373934_0009021 3300035086 Bacteria 3729
170 Ga0373940_0000218 3300035088 Bacteria 8078
171 Ga0373951_0000529 3300035091 Bacteria 10769
172 Ga0373923_0000791 3300035111 Bacteria 8242
173 Ga0373932_0001891 3300035112 Bacteria 5594
174 Ga0373939_0016470 3300035114 Bacteria 1949
175 Ga0373953_0010042 3300035117 Bacteria 3281
176 Ga0373956_0000569 3300035119 Bacteria 15103
177 Ga0373956_0066560 3300035119 Bacteria 1639
178 Ga0373943_0085327 3300035170 Bacteria 1626
179 Ga0373955_0004583 3300035172 Bacteria 6123
180 Ga0373942_0000766 3300035207 Bacteria 8834
181 Ga0373931_0014328 3300035691 Bacteria 3872
182 Ga0373933_0000530 3300035724 Bacteria 23770
183 Ga0373947_0087282 3300035725 Bacteria 1940
184 Ga0373937_0000631 3300036401 Bacteria 30842
185 Ga0373937_0207388 3300036401 Bacteria 1843
186 Ga0373937_0263381 3300036401 Bacteria 1626
187 Ga0395905_0070374 3300037471 Bacteria 3278
188 Ga0439453_0008670 3300041408 Bacteria 1638
189 Ga0450916_006471 3300042530 Bacteria 1380
190 Ga0451576_0006510 3300045051 Bacteria 14302
191 Ga0451576_0013619 3300045051 Bacteria 9091
192 Ga0451576_0016367 3300045051 Bacteria 8188
193 Ga0451576_0017477 3300045051 Bacteria 7885
194 Ga0451576_0039248 3300045051 Bacteria 5011
195 Ga0451576_0042437 3300045051 Bacteria 4801
196 Ga0495592_0017731 3300046454 Bacteria 5410
197 Ga0495603_0052907 3300046455 Bacteria 2410
198 Ga0495629_0107029 3300046459 Bacteria 1951
199 Ga0495638_0098236 3300046460 Bacteria 1754
200 Ga0495651_0005843 3300046462 Bacteria 9385
201 Ga0495653_0000979 3300046463 Bacteria 21970
202 Ga0495580_0000651 3300046472 Bacteria 29510
203 Ga0495608_0000171 3300046511 Bacteria 46179
204 Ga0495618_0019943 3300046514 Bacteria 4127
205 Ga0495628_0005914 3300046516 Bacteria 10708
206 Ga0495628_0059577 3300046516 Bacteria 2997
207 Ga0495628_0085992 3300046516 Bacteria 2439
208 Ga0495630_0008246 3300046517 Bacteria 7483
209 Ga0495652_0002938 3300046529 Bacteria 17158
210 Ga0495586_0113979 3300046535 Bacteria 1506
211 Ga0495586_0138244 3300046535 Bacteria 1366
212 Ga0495587_0001549 3300046536 Bacteria 15276
213 Ga0495645_0001886 3300046543 Bacteria 14253
214 Ga0495645_0017443 3300046543 Bacteria 5142
215 Ga0495667_0001252 3300046559 Bacteria 16648
216 Ga0495667_0056182 3300046559 Bacteria 2589
217 Ga0495668_0000278 3300046616 Bacteria 71019
218 Ga0495635_0000238 3300046663 Bacteria 34935
219 Ga0495657_0000272 3300046675 Bacteria 46662
220 Ga0495599_0001030 3300046678 Bacteria 15641
221 Ga0495623_0003495 3300046679 Bacteria 10398
222 Ga0495646_0044108 3300046680 Bacteria 2727
223 Ga0495658_0029182 3300046683 Bacteria 2983
224 Ga0495669_0000991 3300046684 Bacteria 11866
225 Ga0495613_0010088 3300046689 Bacteria 7019
226 Ga0495670_0092655 3300046691 Bacteria 1548
227 Ga0495600_0000187 3300046809 Bacteria 35919
228 Ga0495674_0007101 3300047319 Bacteria 10716
229 Ga0495680_0011246 3300047322 Bacteria 7934
230 Ga0495675_0015271 3300047444 Bacteria 4855
231 Ga0495684_0002431 3300047471 Bacteria 14843
232 Ga0495684_0009037 3300047471 Bacteria 7694
233 Ga0495602_0029457 3300048088 Bacteria 5227
234 Ga0496100_0002376 3300048903 Bacteria 9522
235 Ga0496104_0051925 3300048907 Bacteria 3871
236 Ga0496105_0063841 3300048908 Bacteria 3039
237 Ga0496106_0018889 3300048909 Bacteria 5108
238 Ga0496107_0079572 3300048910 Bacteria 2389
239 Ga0496108_0089743 3300048911 Bacteria 2612
240 Ga0496112_0324190 3300048915 Bacteria 1484
241 Ga0496113_0054270 3300048916 Bacteria 2999
242 Ga0496114_0009826 3300048917 Bacteria 7603
243 Ga0496114_0045671 3300048917 Bacteria 3640
244 Ga0496114_0213254 3300048917 Bacteria 1694
245 Ga0501040_0135616 3300049576 Unclassified 1733
246 Ga0501041_0088998 3300049577 Bacteria 1906
247 Ga0501042_0013945 3300049578 Bacteria 5476
248 Ga0501071_0117680 3300049587 Unclassified 1968
249 Ga0501072_0112878 3300049588 Bacteria 2163
250 Ga0501074_0018485 3300049590 Bacteria 5064
251 Ga0501075_0048247 3300049591 Bacteria 3200
252 Ga0501076_0009897 3300049592 Bacteria 7047
253 Ga0501076_0021734 3300049592 Bacteria 4926
254 Ga0501076_0137624 3300049592 Bacteria 1983
255 Ga0501079_0030206 3300049741 Bacteria 4164
256 Ga0501081_0076191 3300049743 Unclassified 2342
257 Ga0501081_0115170 3300049743 Bacteria 1911
258 Ga0501035_0157209 3300049822 Bacteria 1970
259 nmdc:mga00v17_1424_c1 3300050491 Bacteria 12554
260 nmdc:mga0k408_12629_c1 3300050493 Bacteria 4617
261 nmdc:mga04h51_18632_c1 3300050495 Bacteria 2047
262 nmdc:mga05p37_15497_c1 3300050507 Bacteria 9163
263 nmdc:mga05p37_8284_c1 3300050507 Bacteria 12290
264 nmdc:mga05p37_85509_c2 3300050507 Bacteria 2206
265 nmdc:mga09592_5124_c1 3300050508 Bacteria 10646
266 nmdc:mga09592_7189_c1 3300050508 Bacteria 9050
267 nmdc:mga06r32_37218_c1 3300050510 Bacteria 4603
268 nmdc:mga06r32_98402_c1 3300050510 Bacteria 2868
269 nmdc:mga08y16_130508_c1 3300050511 Unclassified 2613
270 nmdc:mga08y16_210517_c1 3300050511 Bacteria 2014
271 nmdc:mga08y16_445249_c1 3300050511 Bacteria 1321
272 nmdc:mga08y16_50651_c1 3300050511 Unclassified 4346
273 nmdc:mga08y16_6711_c1 3300050511 Bacteria 8193
274 nmdc:mga0n895_10840_c1 3300050512 Bacteria 8089
275 nmdc:mga0n895_12945_c1 3300050512 Bacteria 7501
276 nmdc:mga0n895_203839_c1 3300050512 Unclassified 2008
277 nmdc:mga0n895_25511_c1 3300050512 Bacteria 5586
278 nmdc:mga0n895_37427_c1 3300050512 Bacteria 4694
279 nmdc:mga0n895_52_c1 3300050512 Bacteria 69311
280 nmdc:mga0rr50_128821_c1 3300050513 Bacteria 2024
281 nmdc:mga0rr50_15_c1 3300050513 Bacteria 189079
282 nmdc:mga0rr50_23869_c1 3300050513 Bacteria 4228
283 nmdc:mga0rr50_48196_c1 3300050513 Bacteria 3148
284 nmdc:mga0rr50_98514_c1 3300050513 Bacteria 2292
285 nmdc:mga08x19_466_c1 3300050514 Bacteria 27299
286 nmdc:mga0a205_21509_c1 3300050515 Bacteria 6100
287 nmdc:mga0a205_88183_c1 3300050515 Bacteria 2998
288 Ga0495601_0005694 3300053077 Bacteria 7261
289 Ga0495612_0000987 3300053078 Bacteria 11688
290 Ga0495595_0048399 3300053084 Bacteria 1963
291 Ga0495595_0095762 3300053084 Bacteria 1428
292 Ga0590071_000017 3300059421 Bacteria 43985
293 Ga0590074_003122 3300059423 Bacteria 2733
294 Ga0590075_000866 3300059424 Bacteria 7933
295 Ga0590077_000266 3300059426 Bacteria 14827
296 Ga0501082_0001297 3300060353 Bacteria 21917
297 Ga0501082_0122817 3300060353 Bacteria 2252
298 Ga0530510_0002880 3300061734 Bacteria 11818
299 2995954043 2995948881 Bacteria 6358104
300 Ga0157380_10012284
301 Ga0065715_10143085
302 Ga0070676_10012092
303 Ga0070690_100003759
304 Ga0070690_100009141
305 Ga0070670_100008180
306 Ga0070677_10036538
307 Ga0068869_100017765
308 Ga0070687_100005595
309 Ga0070669_100036902
310 Ga0070675_100001817
311 Ga0070675_100081704
312 Ga0070671_100021450
313 Ga0070671_100207021
314 Ga0070674_100019274
315 Ga0070674_100152826
316 Ga0070673_100005850
317 Ga0070688_100007016
318 Ga0070713_100005356
319 Ga0070700_100012255
320 Ga0070694_100005041
321 Ga0070694_100019359
322 Ga0070708_100133671
323 Ga0070663_100044889
324 Ga0068867_100010961
325 Ga0070698_100321901
326 Ga0070697_100015442
327 Ga0070672_100010074
328 Ga0070672_100060029
329 Ga0070672_100069666
330 Ga0070672_100148667
331 Ga0070686_100001195
332 Ga0070686_100062827
333 Ga0070686_100080676
334 Ga0070665_100030087
335 Ga0070704_100012338
336 Ga0070664_100005959
337 Ga0068859_100007258
338 Ga0068859_100350928
339 Ga0068864_100002943
340 Ga0068864_100019381
341 Ga0068861_100011953
342 Ga0068861_100058915
343 Ga0068870_10006605
344 Ga0068858_100009103
345 Ga0068858_100013132
346 Ga0068862_100114948
347 Ga0075365_10017010
348 Ga0075364_10012874
349 Ga0075364_10029055
350 Ga0075362_10000363
351 Ga0075367_10036271
352 Ga0075366_10022348
353 Ga0097621_100010013
354 Ga0097621_100071372
355 Ga0075370_10096588
356 Ga0068871_100011110
357 Ga0068871_100014632
358 Ga0068871_100094351
359 Ga0075430_100001509
360 Ga0075431_100009617
361 Ga0075431_100058845
362 Ga0075433_10063179
363 Ga0075433_10067225
364 Ga0075434_100000051
365 Ga0075434_100006311
366 Ga0075434_100007559
367 Ga0075434_100022578
368 Ga0075434_100024623
369 Ga0075434_100170300
370 Ga0075429_100011764
371 Ga0068865_100003295
372 Ga0068865_100023634
373 Ga0075436_100000678
374 Ga0075436_100032123
375 Ga0097620_100007258
376 Ga0097620_100350986
377 Ga0075435_100000006
378 Ga0075435_100002651
379 Ga0075435_100008519
380 Ga0111539_10050537
381 Ga0111539_10206844
382 Ga0111539_10241349
383 Ga0105245_10373493
384 Ga0105247_10003450
385 Ga0105247_10149676
386 Ga0114129_10045112
387 Ga0114129_10265574
388 Ga0114129_10309943
389 Ga0105242_10003514
390 Ga0105242_10077817
391 Ga0105248_10010022
392 Ga0105237_10092719
393 Ga0157378_10096810
394 Ga0163163_10020387
395 Ga0163163_10114556
396 Ga0157380_10014350
397 Ga0157380_10055823
398 Ga0157380_10207099
399 Ga0157379_10093374
400 Ga0207682_10006269
401 Ga0207710_10026280
402 Ga0207680_10101986
403 Ga0207645_10005013
404 Ga0207643_10009894
405 Ga0207671_10202089
406 Ga0207662_10010480
407 Ga0207681_10035445
408 Ga0207694_10018531
409 Ga0207650_10009245
410 Ga0207659_10002426
411 Ga0207659_10040076
412 Ga0207687_10056283
413 Ga0207686_10065935
414 Ga0207670_10217118
415 Ga0207669_10002501
416 Ga0207669_10079960
417 Ga0207704_10006937
418 Ga0207691_10055617
419 Ga0207691_10060103
420 Ga0207691_10072911
421 Ga0207691_10165283
422 Ga0207711_10075236
423 Ga0207689_10011224
424 Ga0207689_10081552
425 Ga0207679_10061491
426 Ga0207651_10035295
427 Ga0207651_10133979
428 Ga0207703_10022218
429 Ga0207703_10025297
430 Ga0207678_10065076
431 Ga0207708_10055213
432 Ga0207641_10082475
433 Ga0207648_10000831
434 Ga0207676_10003156
435 Ga0207676_10047456
436 Ga0207675_100023307
437 Ga0207675_100061316
438 Ga0207675_100119450
439 Ga0207675_100249834
440 Ga0207683_10009918
441 Ga0207428_10011794
442 Ga0207428_10015698
443 Ga0268266_10025939
444 Ga0265332_10015522
445 Ga0265327_10026321
446 Ga0307509_10001123
447 Ga0307408_100093649
448 Ga0307408_100194191
449 Ga0265314_10021025
450 Ga0307405_10052371
451 Ga0307405_10060044
452 Ga0307413_10021199
453 Ga0307413_10102652
454 Ga0307410_10008009
455 Ga0307410_10010216
456 Ga0307410_10040560
457 Ga0307409_100028622
458 Ga0307416_100006019
459 Ga0307416_100009720
460 Ga0307416_100058150
461 Ga0307414_10009070
462 Ga0307411_10004401
463 Ga0307411_10021105
464 Ga0307415_100006482
465 Ga0373950_0009130
466 Ga0373959_0003898
467 Ga0373929_0002541
468 Ga0373934_0009021
469 Ga0373940_0000218
470 Ga0373951_0000529
471 Ga0373923_0000791
472 Ga0373932_0001891
473 Ga0373939_0016470
474 Ga0373953_0010042
475 Ga0373956_0000569
476 Ga0373956_0066560
477 Ga0373943_0085327
478 Ga0373955_0004583
479 Ga0373942_0000766
480 Ga0373931_0014328
481 Ga0373933_0000530
482 Ga0373947_0087282
483 Ga0373937_0000631
484 Ga0373937_0207388
485 Ga0373937_0263381
486 Ga0395905_0070374
487 Ga0439453_0008670
488 Ga0450916_006471
489 Ga0451576_0006510
490 Ga0451576_0013619
491 Ga0451576_0016367
492 Ga0451576_0017477
493 Ga0451576_0039248
494 Ga0451576_0042437
495 Ga0495592_0017731
496 Ga0495603_0052907
497 Ga0495629_0107029
498 Ga0495638_0098236
499 Ga0495651_0005843
500 Ga0495653_0000979
501 Ga0495580_0000651
502 Ga0495608_0000171
503 Ga0495618_0019943
504 Ga0495628_0005914
505 Ga0495628_0059577
506 Ga0495628_0085992
507 Ga0495630_0008246
508 Ga0495652_0002938
509 Ga0495586_0113979
510 Ga0495586_0138244
511 Ga0495587_0001549
512 Ga0495645_0001886
513 Ga0495645_0017443
514 Ga0495667_0001252
515 Ga0495667_0056182
516 Ga0495668_0000278
517 Ga0495635_0000238
518 Ga0495657_0000272
519 Ga0495599_0001030
520 Ga0495623_0003495
521 Ga0495646_0044108
522 Ga0495658_0029182
523 Ga0495669_0000991
524 Ga0495613_0010088
525 Ga0495670_0092655
526 Ga0495600_0000187
527 Ga0495674_0007101
528 Ga0495680_0011246
529 Ga0495675_0015271
530 Ga0495684_0002431
531 Ga0495684_0009037
532 Ga0495602_0029457
533 Ga0496100_0002376
534 Ga0496104_0051925
535 Ga0496105_0063841
536 Ga0496106_0018889
537 Ga0496107_0079572
538 Ga0496108_0089743
539 Ga0496112_0324190
540 Ga0496113_0054270
541 Ga0496114_0009826
542 Ga0496114_0045671
543 Ga0496114_0213254
544 Ga0501040_0135616
545 Ga0501041_0088998
546 Ga0501042_0013945
547 Ga0501071_0117680
548 Ga0501072_0112878
549 Ga0501074_0018485
550 Ga0501075_0048247
551 Ga0501076_0009897
552 Ga0501076_0021734
553 Ga0501076_0137624
554 Ga0501079_0030206
555 Ga0501081_0076191
556 Ga0501081_0115170
557 Ga0501035_0157209
558 nmdc:mga00v17_1424_c1
559 nmdc:mga0k408_12629_c1
560 nmdc:mga04h51_18632_c1
561 nmdc:mga05p37_15497_c1
562 nmdc:mga05p37_8284_c1
563 nmdc:mga05p37_85509_c2
564 nmdc:mga09592_5124_c1
565 nmdc:mga09592_7189_c1
566 nmdc:mga06r32_37218_c1
567 nmdc:mga06r32_98402_c1
568 nmdc:mga08y16_130508_c1
569 nmdc:mga08y16_210517_c1
570 nmdc:mga08y16_445249_c1
571 nmdc:mga08y16_50651_c1
572 nmdc:mga08y16_6711_c1
573 nmdc:mga0n895_10840_c1
574 nmdc:mga0n895_12945_c1
575 nmdc:mga0n895_203839_c1
576 nmdc:mga0n895_25511_c1
577 nmdc:mga0n895_37427_c1
578 nmdc:mga0n895_52_c1
579 nmdc:mga0rr50_128821_c1
580 nmdc:mga0rr50_15_c1
581 nmdc:mga0rr50_23869_c1
582 nmdc:mga0rr50_48196_c1
583 nmdc:mga0rr50_98514_c1
584 nmdc:mga08x19_466_c1
585 nmdc:mga0a205_21509_c1
586 nmdc:mga0a205_88183_c1
587 Ga0495601_0005694
588 Ga0495612_0000987
589 Ga0495595_0048399
590 Ga0495595_0095762
591 Ga0590071_000017
592 Ga0590074_003122
593 Ga0590075_000866
594 Ga0590077_000266
595 Ga0501082_0001297
596 Ga0501082_0122817
597 Ga0530510_0002880
598 2995954043

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00144

Beta-lactamase

Beta-lactamase

60

436

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7pp8-assembly1.cif.gz_A structure of ester-hydrolase eh7 from metagenome of marine sediments at milazzo harbor (sicily, italy) complexed with a derivative of methyl 4-nitrophenyl hexylphosphonate 0.9069 37 426
4p6b-assembly1.cif.gz_A crystal structure of est-y29,a novel penicillin-binding protein/beta-lactamase homolog from a metagenomic library 0.8999 46 424
5zwr-assembly1.cif.gz_A structural basis for the enantioselectivity of est-y29 toward (s)-ketoprofen 0.8973 46 424
5zwv-assembly1.cif.gz_B structural basis for the enantioselectivity of est-y29 toward (s)-ketoprofen 0.8969 46 424
7uda-assembly1.cif.gz_A structure of the estg 0.8887 33 429
ID Description Score Start End Superfamily
4p6bB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8722 46 422 3.40.710.10
4p6bB00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8568 46 422 3.40.710.10
4ivkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8521 28 426 3.40.710.10
af_P9WLZ3_5_376_3.40.710.10 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8459 49 417 3.40.710.10
4ivkA00 Alpha Beta;3-Layer(aba) Sandwich;Beta-lactamase;DD-peptidase/beta-lactamase superfamily 0.8379 28 426 3.40.710.10
ID Description Score Start End GO Terms
AF-A0A520CNA4-F1-model_v4 Class A beta-lactamase-related serine hydrolase 0.9378 41 426 GO:0016787
AF-A0A2N9N7W3-F1-model_v4 Beta-lactamase 0.9259 44 426
AF-A0A2V7RBN1-F1-model_v4 Serine hydrolase 0.925 1 428 GO:0016787
AF-A0A2D5W403-F1-model_v4 Serine hydrolase 0.9244 50 426 GO:0016787
AF-A0A2V7RBN1-F1-model_v4 Serine hydrolase 0.9207 1 428 GO:0016787

Map