F394846

General Info

Members Datasets Scaffolds Average Seq Length
299 197 598 127

Family's Representative Sequence

Representative Sequence 3300013307|Ga0157372_10159817|Ga0157372_101598174
Length 154
Sequence MNNLIIKYYYGDFDSPHPNPAQKRETANAQGLLGGETANNTDTPKSEPLQHGTPPPTGGGREGAWPLWEVFIRSKQGLDHKHVGSLHATDAQMAIENARDVYTRRQEGVSIWVVESKYIHASNPDESDSLYEPANDKVYRHPTFYNLPDEVNHM

Samples

Sample ID Description Type Environment
1 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
118 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
119 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
120 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
121 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
122 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
123 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
126 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
146 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
173 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
174 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
175 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
176 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
177 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
185 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
186 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
187 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
188 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
192 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
196 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
197 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.69
Nodule 0
Rhizoplane 1.34
Rhizosphere 88.96
Stem 0
Stem Tuber 0
Unclassified 10.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157372_10159817 3300013307 Bacteria 2603
2 JGI25406J46586_10087795 3300003203 Bacteria 942
3 rootH1_10003614 3300003323 Bacteria 7908
4 rootH1_10060447 3300003323 Unclassified 1315
5 Ga0065714_10115658 3300005288 Bacteria 1413
6 Ga0065712_10220232 3300005290 Bacteria 1043
7 Ga0065707_10102960 3300005295 Unclassified 2776
8 Ga0070676_10266837 3300005328 Unclassified 1148
9 Ga0070683_100006527 3300005329 Bacteria 9796
10 Ga0070683_101134476 3300005329 Bacteria 751
11 Ga0070670_100458518 3300005331 Bacteria 1130
12 Ga0070666_10063604 3300005335 Bacteria 2501
13 Ga0070666_10645128 3300005335 Bacteria 774
14 Ga0068868_100094220 3300005338 Bacteria 2415
15 Ga0068868_100118942 3300005338 Bacteria 2154
16 Ga0068868_100194595 3300005338 Bacteria 1687
17 Ga0068868_100385751 3300005338 Bacteria 1206
18 Ga0070689_100001988 3300005340 Bacteria 13242
19 Ga0070689_100636193 3300005340 Bacteria 927
20 Ga0070661_100002053 3300005344 Bacteria 13879
21 Ga0070675_100017188 3300005354 Bacteria 5749
22 Ga0070675_100066630 3300005354 Bacteria 2979
23 Ga0070674_101777786 3300005356 Bacteria 559
24 Ga0070673_100018637 3300005364 Bacteria 4964
25 Ga0070673_100401453 3300005364 Bacteria 1226
26 Ga0070673_101465395 3300005364 Bacteria 643
27 Ga0070688_100003235 3300005365 Bacteria 8344
28 Ga0070688_100475770 3300005365 Bacteria 938
29 Ga0070659_100195109 3300005366 Bacteria 1665
30 Ga0070667_100009523 3300005367 Bacteria 8054
31 Ga0070667_100055272 3300005367 Bacteria 3353
32 Ga0070667_100068195 3300005367 Bacteria 3026
33 Ga0070667_101396308 3300005367 Bacteria 657
34 Ga0070708_100345909 3300005445 Bacteria 1401
35 Ga0070678_101662530 3300005456 Bacteria 600
36 Ga0070681_10973830 3300005458 Bacteria 768
37 Ga0068867_101425760 3300005459 Bacteria 643
38 Ga0068867_101845049 3300005459 Bacteria 569
39 Ga0070685_10088826 3300005466 Bacteria 1867
40 Ga0070685_10100548 3300005466 Bacteria 1765
41 Ga0070707_100502764 3300005468 Bacteria 1174
42 Ga0070698_100000261 3300005471 Bacteria 53090
43 Ga0070699_100098094 3300005518 Bacteria 2567
44 Ga0070684_100017862 3300005535 Bacteria 5830
45 Ga0070665_100622122 3300005548 Bacteria 1093
46 Ga0068855_100011161 3300005563 Bacteria 10847
47 Ga0070664_100534433 3300005564 Bacteria 1083
48 Ga0070664_100676028 3300005564 Bacteria 960
49 Ga0070664_101169065 3300005564 Bacteria 725
50 Ga0068857_100541227 3300005577 Bacteria 1096
51 Ga0068856_100257578 3300005614 Bacteria 1760
52 Ga0068852_100010395 3300005616 Bacteria 6954
53 Ga0068852_100560077 3300005616 Bacteria 1144
54 Ga0068852_100827642 3300005616 Bacteria 941
55 Ga0068852_101346065 3300005616 Bacteria 736
56 Ga0068859_100000003 3300005617 Bacteria 479218
57 Ga0068859_100015853 3300005617 Bacteria 7573
58 Ga0068859_100213216 3300005617 Bacteria 2018
59 Ga0068864_100005189 3300005618 Bacteria 10670
60 Ga0068864_100008092 3300005618 Bacteria 8672
61 Ga0068864_100194225 3300005618 Bacteria 1862
62 Ga0068861_100029015 3300005719 Bacteria 4042
63 Ga0068851_10044539 3300005834 Bacteria 2240
64 Ga0068863_100001446 3300005841 Bacteria 23574
65 Ga0068863_100072835 3300005841 Bacteria 3250
66 Ga0068863_100196427 3300005841 Bacteria 1939
67 Ga0068858_100010842 3300005842 Bacteria 8616
68 Ga0068858_100937720 3300005842 Bacteria 847
69 Ga0068860_100006378 3300005843 Bacteria 11839
70 Ga0068860_100032916 3300005843 Bacteria 4978
71 Ga0068860_100402953 3300005843 Bacteria 1353
72 Ga0068860_100451852 3300005843 Bacteria 1278
73 Ga0068862_102158809 3300005844 Unclassified 568
74 Ga0081539_10000714 3300005985 Bacteria 66625
75 Ga0081539_10022383 3300005985 Bacteria 4184
76 Ga0070715_10029938 3300006163 Bacteria 2196
77 Ga0075366_10228446 3300006195 Bacteria 1134
78 Ga0097621_100012880 3300006237 Bacteria 6215
79 Ga0097621_100234399 3300006237 Bacteria 1603
80 Ga0097621_100312100 3300006237 Unclassified 1391
81 Ga0097621_100342675 3300006237 Bacteria 1327
82 Ga0097621_100376993 3300006237 Bacteria 1266
83 Ga0097621_100808126 3300006237 Unclassified 869
84 Ga0068871_100006775 3300006358 Bacteria 8139
85 Ga0068871_100041158 3300006358 Bacteria 3703
86 Ga0068871_100650689 3300006358 Bacteria 962
87 Ga0075428_100358971 3300006844 Bacteria 1563
88 Ga0068865_101683662 3300006881 Bacteria 571
89 Ga0097620_100000003 3300006931 Bacteria 479218
90 Ga0097620_100015853 3300006931 Bacteria 7573
91 Ga0097620_100213217 3300006931 Bacteria 2018
92 Ga0105251_10198698 3300009011 Bacteria 904
93 Ga0105240_10173121 3300009093 Bacteria 2555
94 Ga0105247_10002345 3300009101 Bacteria 12924
95 Ga0114129_10016698 3300009147 Bacteria 10455
96 Ga0105243_10103196 3300009148 Bacteria 2371
97 Ga0105241_10007220 3300009174 Bacteria 8178
98 Ga0105241_10114694 3300009174 Bacteria 2162
99 Ga0105242_10036639 3300009176 Bacteria 3936
100 Ga0105242_10093696 3300009176 Bacteria 2533
101 Ga0105242_11200839 3300009176 Bacteria 778
102 Ga0105242_11415190 3300009176 Bacteria 723
103 Ga0105237_10005614 3300009545 Bacteria 14142
104 Ga0105237_10091536 3300009545 Bacteria 3031
105 Ga0105249_10014534 3300009553 Bacteria 6959
106 Ga0105249_11759730 3300009553 Bacteria 692
107 Ga0105239_10003342 3300010375 Bacteria 19721
108 Ga0105239_10013153 3300010375 Bacteria 9196
109 Ga0105239_10037751 3300010375 Bacteria 5294
110 Ga0105246_10042377 3300011119 Bacteria 3082
111 Ga0105246_10593112 3300011119 Unclassified 956
112 Ga0105246_10687990 3300011119 Unclassified 895
113 Ga0157373_10216148 3300013100 Bacteria 1352
114 Ga0157371_10249274 3300013102 Bacteria 1278
115 Ga0157371_11640026 3300013102 Unclassified 504
116 Ga0157370_10291759 3300013104 Bacteria 1506
117 Ga0157374_10000660 3300013296 Bacteria 30313
118 Ga0157374_10040487 3300013296 Bacteria 4291
119 Ga0157374_10070485 3300013296 Bacteria 3294
120 Ga0157374_10246825 3300013296 Bacteria 1756
121 Ga0157374_10374259 3300013296 Bacteria 1418
122 Ga0157374_10766661 3300013296 Bacteria 980
123 Ga0157378_10001166 3300013297 Bacteria 23907
124 Ga0157378_10018304 3300013297 Bacteria 6149
125 Ga0157378_10019780 3300013297 Bacteria 5922
126 Ga0157378_10103419 3300013297 Bacteria 2602
127 Ga0157378_10165724 3300013297 Bacteria 2070
128 Ga0157378_11935356 3300013297 Unclassified 639
129 Ga0163162_10054611 3300013306 Bacteria 4019
130 Ga0163162_10102854 3300013306 Bacteria 2950
131 Ga0163162_10235564 3300013306 Bacteria 1961
132 Ga0163162_10369740 3300013306 Bacteria 1567
133 Ga0157372_10010381 3300013307 Bacteria 9900
134 Ga0157372_10032612 3300013307 Bacteria 5712
135 Ga0157372_11278300 3300013307 Bacteria 847
136 Ga0157375_10003088 3300013308 Bacteria 14452
137 Ga0157375_11593176 3300013308 Bacteria 772
138 Ga0163163_10002002 3300014325 Bacteria 17218
139 Ga0163163_10985843 3300014325 Bacteria 906
140 Ga0163163_11072862 3300014325 Bacteria 868
141 Ga0157380_10043007 3300014326 Bacteria 3534
142 Ga0157380_10152737 3300014326 Bacteria 1998
143 Ga0157377_10087750 3300014745 Unclassified 1831
144 Ga0157379_10165455 3300014968 Bacteria 1996
145 Ga0157379_10335037 3300014968 Bacteria 1383
146 Ga0157379_11626334 3300014968 Unclassified 631
147 Ga0157379_11864877 3300014968 Bacteria 592
148 Ga0157376_10272332 3300014969 Bacteria 1591
149 Ga0157376_10660265 3300014969 Bacteria 1047
150 Ga0163161_10101198 3300017792 Bacteria 2145
151 Ga0163161_10495541 3300017792 Bacteria 994
152 Ga0207642_10649024 3300025899 Bacteria 661
153 Ga0207647_10111885 3300025904 Bacteria 1614
154 Ga0207685_10034150 3300025905 Bacteria 1845
155 Ga0207707_11443763 3300025912 Bacteria 547
156 Ga0207671_10565169 3300025914 Bacteria 907
157 Ga0207660_10489777 3300025917 Bacteria 997
158 Ga0207657_10246689 3300025919 Bacteria 1424
159 Ga0207649_10013680 3300025920 Bacteria 4534
160 Ga0207650_10089131 3300025925 Bacteria 2354
161 Ga0207650_10588285 3300025925 Bacteria 935
162 Ga0207659_10723156 3300025926 Unclassified 853
163 Ga0207706_10037084 3300025933 Bacteria 4329
164 Ga0207670_10020844 3300025936 Bacteria 4034
165 Ga0207691_10011768 3300025940 Bacteria 8398
166 Ga0207691_10292608 3300025940 Bacteria 1400
167 Ga0207689_10001814 3300025942 Bacteria 20165
168 Ga0207661_10002958 3300025944 Bacteria 11754
169 Ga0207679_10916780 3300025945 Bacteria 802
170 Ga0207667_10009678 3300025949 Bacteria 11337
171 Ga0207667_10758041 3300025949 Bacteria 970
172 Ga0207651_10349079 3300025960 Bacteria 1245
173 Ga0207668_10299097 3300025972 Bacteria 1327
174 Ga0207640_10029632 3300025981 Bacteria 3362
175 Ga0207658_10003271 3300025986 Bacteria 11512
176 Ga0207677_10013323 3300026023 Bacteria 4761
177 Ga0207677_10091503 3300026023 Bacteria 2213
178 Ga0207703_11509248 3300026035 Bacteria 647
179 Ga0207678_10045432 3300026067 Bacteria 3798
180 Ga0207648_11826195 3300026089 Bacteria 569
181 Ga0207676_10002233 3300026095 Bacteria 13913
182 Ga0207676_10071617 3300026095 Bacteria 2784
183 Ga0207674_10003496 3300026116 Bacteria 19183
184 Ga0207674_10038441 3300026116 Bacteria 4966
185 Ga0207674_10384352 3300026116 Bacteria 1357
186 Ga0207674_10723708 3300026116 Bacteria 960
187 Ga0207683_10224102 3300026121 Bacteria 1714
188 Ga0207683_10728573 3300026121 Bacteria 920
189 Ga0268266_10170716 3300028379 Bacteria 1974
190 Ga0268265_12537752 3300028380 Unclassified 518
191 Ga0268264_10001931 3300028381 Bacteria 18678
192 Ga0307515_10000031 3300028794 Bacteria 358648
193 Ga0307509_10012169 3300031507 Bacteria 10321
194 Ga0307509_10059111 3300031507 Bacteria 4057
195 Ga0307508_10003011 3300031616 Bacteria 17379
196 Ga0307405_10820786 3300031731 Bacteria 781
197 Ga0373954_0128652 3300035118 Unclassified 1232
198 Ga0373955_0617174 3300035172 Bacteria 664
199 Ga0373924_0033329 3300035410 Unclassified 2079
200 Ga0373927_0063120 3300035695 Bacteria 2396
201 Ga0373933_0292203 3300035724 Unclassified 1054
202 Ga0373937_0250324 3300036401 Unclassified 1670
203 Ga0373925_0154963 3300037068 Unclassified 1801
204 Ga0373925_0446173 3300037068 Bacteria 1059
205 Ga0439436_0002217 3300041404 Bacteria 5820
206 Ga0439439_0026515 3300041406 Bacteria 1461
207 Ga0451804_1090254 3300041463 Unclassified 744
208 Ga0451807_1944106 3300041486 Bacteria 744
209 Ga0451835_0795973 3300041492 Bacteria 577
210 Ga0451847_0768316 3300041503 Bacteria 574
211 Ga0451843_0716219 3300041509 Bacteria 686
212 Ga0451853_2277772 3300041512 Bacteria 1493
213 Ga0439433_0067211 3300041999 Bacteria 860
214 Ga0439449_0056669 3300042007 Bacteria 1447
215 Ga0439449_0257560 3300042007 Bacteria 656
216 Ga0439457_001639 3300042014 Bacteria 6669
217 Ga0439457_005811 3300042014 Bacteria 3063
218 Ga0439457_071803 3300042014 Bacteria 790
219 Ga0439462_0061756 3300042015 Bacteria 1014
220 Ga0439444_0027267 3300042437 Bacteria 1051
221 Ga0466969_0000207 3300044656 Bacteria 32129
222 Ga0466972_0000009 3300044658 Bacteria 256374
223 Ga0466972_0020808 3300044658 Bacteria 3276
224 Ga0466978_0185444 3300044671 Bacteria 1250
225 Ga0466966_0040349 3300044684 Bacteria 3004
226 Ga0466964_0035780 3300044706 Bacteria 1988
227 Ga0453684_2266937 3300044712 Unclassified 541
228 Ga0466971_0448404 3300044719 Bacteria 633
229 Ga0466970_0188309 3300044765 Bacteria 1146
230 Ga0466959_0000236 3300045049 Bacteria 34631
231 Ga0451576_0469349 3300045051 Bacteria 1322
232 Ga0495592_0519667 3300046454 Bacteria 736
233 Ga0495653_0930210 3300046463 Bacteria 517
234 Ga0495608_0208613 3300046511 Bacteria 1229
235 Ga0495618_0025248 3300046514 Bacteria 3687
236 Ga0495630_0129851 3300046517 Unclassified 1913
237 Ga0495640_0376023 3300046533 Unclassified 874
238 Ga0495586_0538476 3300046535 Unclassified 674
239 Ga0495587_0168724 3300046536 Unclassified 1244
240 Ga0495598_0029514 3300046537 Bacteria 1530
241 Ga0495645_0273432 3300046543 Bacteria 1114
242 Ga0495634_0095822 3300046642 Unclassified 1922
243 Ga0495599_0398350 3300046678 Bacteria 820
244 Ga0495600_0336566 3300046809 Unclassified 947
245 Ga0495672_0142886 3300047320 Unclassified 1248
246 Ga0495675_0514380 3300047444 Unclassified 686
247 Ga0495684_1038803 3300047471 Unclassified 518
248 Ga0496102_0429188 3300048905 Bacteria 1241
249 Ga0496109_0131011 3300048912 Bacteria 2341
250 Ga0501034_0035694 3300049571 Bacteria 5039
251 Ga0501034_0156112 3300049571 Bacteria 2256
252 Ga0501036_0010318 3300049572 Bacteria 7708
253 Ga0501037_0044971 3300049573 Bacteria 3241
254 Ga0501038_0011280 3300049574 Bacteria 8159
255 Ga0501039_0048125 3300049575 Bacteria 3296
256 Ga0501043_0228551 3300049579 Bacteria 1437
257 Ga0501046_0001757 3300049580 Bacteria 20707
258 Ga0501047_0037039 3300049581 Bacteria 4715
259 Ga0501047_0065226 3300049581 Bacteria 3510
260 Ga0501047_0248778 3300049581 Bacteria 1626
261 Ga0501047_0349188 3300049581 Bacteria 1316
262 Ga0501048_0062714 3300049582 Bacteria 2630
263 Ga0501067_0118895 3300049583 Bacteria 1470
264 Ga0501069_0255230 3300049585 Bacteria 1023
265 Ga0501070_0007346 3300049586 Bacteria 9356
266 Ga0501074_0002925 3300049590 Bacteria 11992
267 Ga0501077_0133512 3300049593 Bacteria 1574
268 Ga0501209_036051 3300049656 Bacteria 1284
269 Ga0501243_053142 3300049675 Bacteria 735
270 Ga0501253_145037 3300049683 Bacteria 594
271 Ga0501257_002503 3300049686 Bacteria 3880
272 Ga0501257_081322 3300049686 Bacteria 835
273 Ga0501257_186296 3300049686 Bacteria 590
274 Ga0501259_018917 3300049688 Bacteria 1207
275 Ga0501245_022735 3300049708 Bacteria 991
276 Ga0501083_0006365 3300049744 Bacteria 8367
277 Ga0501035_0005022 3300049822 Bacteria 12531
278 Ga0501035_0069392 3300049822 Bacteria 3125
279 Ga0501044_0105404 3300049823 Bacteria 2832
280 Ga0501044_0227462 3300049823 Bacteria 1814
281 Ga0501044_0947619 3300049823 Unclassified 734
282 nmdc:mga0k408_308939_c1 3300050493 Bacteria 944
283 nmdc:mga0k408_620966_c1 3300050493 Bacteria 637
284 nmdc:mga05p37_11042_c1 3300050507 Bacteria 10730
285 Ga0500578_0000386 3300053086 Bacteria 54049
286 Ga0500644_0321448 3300053088 Bacteria 665
287 Ga0500646_0034199 3300053090 Bacteria 1408
288 Ga0500583_0000392 3300053092 Bacteria 14055
289 Ga0500650_0424496 3300053098 Bacteria 573
290 Ga0500555_131594 3300053103 Bacteria 620
291 Ga0500556_0068974 3300053104 Bacteria 1318
292 Ga0500573_0150877 3300053140 Bacteria 1273
293 Ga0500589_011599 3300053147 Bacteria 3823
294 Ga0500603_038581 3300053150 Bacteria 1265
295 Ga0500616_0278202 3300053153 Bacteria 703
296 Ga0500636_0022872 3300053177 Bacteria 3694
297 Ga0500584_173718 3300053726 Bacteria 766
298 Ga0500611_020655 3300053727 Bacteria 1246
299 2738725195 2738541278 Bacteria 9755573
300 Ga0157372_10159817
301 JGI25406J46586_10087795
302 rootH1_10003614
303 rootH1_10060447
304 Ga0065714_10115658
305 Ga0065712_10220232
306 Ga0065707_10102960
307 Ga0070676_10266837
308 Ga0070683_100006527
309 Ga0070683_101134476
310 Ga0070670_100458518
311 Ga0070666_10063604
312 Ga0070666_10645128
313 Ga0068868_100094220
314 Ga0068868_100118942
315 Ga0068868_100194595
316 Ga0068868_100385751
317 Ga0070689_100001988
318 Ga0070689_100636193
319 Ga0070661_100002053
320 Ga0070675_100017188
321 Ga0070675_100066630
322 Ga0070674_101777786
323 Ga0070673_100018637
324 Ga0070673_100401453
325 Ga0070673_101465395
326 Ga0070688_100003235
327 Ga0070688_100475770
328 Ga0070659_100195109
329 Ga0070667_100009523
330 Ga0070667_100055272
331 Ga0070667_100068195
332 Ga0070667_101396308
333 Ga0070708_100345909
334 Ga0070678_101662530
335 Ga0070681_10973830
336 Ga0068867_101425760
337 Ga0068867_101845049
338 Ga0070685_10088826
339 Ga0070685_10100548
340 Ga0070707_100502764
341 Ga0070698_100000261
342 Ga0070699_100098094
343 Ga0070684_100017862
344 Ga0070665_100622122
345 Ga0068855_100011161
346 Ga0070664_100534433
347 Ga0070664_100676028
348 Ga0070664_101169065
349 Ga0068857_100541227
350 Ga0068856_100257578
351 Ga0068852_100010395
352 Ga0068852_100560077
353 Ga0068852_100827642
354 Ga0068852_101346065
355 Ga0068859_100000003
356 Ga0068859_100015853
357 Ga0068859_100213216
358 Ga0068864_100005189
359 Ga0068864_100008092
360 Ga0068864_100194225
361 Ga0068861_100029015
362 Ga0068851_10044539
363 Ga0068863_100001446
364 Ga0068863_100072835
365 Ga0068863_100196427
366 Ga0068858_100010842
367 Ga0068858_100937720
368 Ga0068860_100006378
369 Ga0068860_100032916
370 Ga0068860_100402953
371 Ga0068860_100451852
372 Ga0068862_102158809
373 Ga0081539_10000714
374 Ga0081539_10022383
375 Ga0070715_10029938
376 Ga0075366_10228446
377 Ga0097621_100012880
378 Ga0097621_100234399
379 Ga0097621_100312100
380 Ga0097621_100342675
381 Ga0097621_100376993
382 Ga0097621_100808126
383 Ga0068871_100006775
384 Ga0068871_100041158
385 Ga0068871_100650689
386 Ga0075428_100358971
387 Ga0068865_101683662
388 Ga0097620_100000003
389 Ga0097620_100015853
390 Ga0097620_100213217
391 Ga0105251_10198698
392 Ga0105240_10173121
393 Ga0105247_10002345
394 Ga0114129_10016698
395 Ga0105243_10103196
396 Ga0105241_10007220
397 Ga0105241_10114694
398 Ga0105242_10036639
399 Ga0105242_10093696
400 Ga0105242_11200839
401 Ga0105242_11415190
402 Ga0105237_10005614
403 Ga0105237_10091536
404 Ga0105249_10014534
405 Ga0105249_11759730
406 Ga0105239_10003342
407 Ga0105239_10013153
408 Ga0105239_10037751
409 Ga0105246_10042377
410 Ga0105246_10593112
411 Ga0105246_10687990
412 Ga0157373_10216148
413 Ga0157371_10249274
414 Ga0157371_11640026
415 Ga0157370_10291759
416 Ga0157374_10000660
417 Ga0157374_10040487
418 Ga0157374_10070485
419 Ga0157374_10246825
420 Ga0157374_10374259
421 Ga0157374_10766661
422 Ga0157378_10001166
423 Ga0157378_10018304
424 Ga0157378_10019780
425 Ga0157378_10103419
426 Ga0157378_10165724
427 Ga0157378_11935356
428 Ga0163162_10054611
429 Ga0163162_10102854
430 Ga0163162_10235564
431 Ga0163162_10369740
432 Ga0157372_10010381
433 Ga0157372_10032612
434 Ga0157372_11278300
435 Ga0157375_10003088
436 Ga0157375_11593176
437 Ga0163163_10002002
438 Ga0163163_10985843
439 Ga0163163_11072862
440 Ga0157380_10043007
441 Ga0157380_10152737
442 Ga0157377_10087750
443 Ga0157379_10165455
444 Ga0157379_10335037
445 Ga0157379_11626334
446 Ga0157379_11864877
447 Ga0157376_10272332
448 Ga0157376_10660265
449 Ga0163161_10101198
450 Ga0163161_10495541
451 Ga0207642_10649024
452 Ga0207647_10111885
453 Ga0207685_10034150
454 Ga0207707_11443763
455 Ga0207671_10565169
456 Ga0207660_10489777
457 Ga0207657_10246689
458 Ga0207649_10013680
459 Ga0207650_10089131
460 Ga0207650_10588285
461 Ga0207659_10723156
462 Ga0207706_10037084
463 Ga0207670_10020844
464 Ga0207691_10011768
465 Ga0207691_10292608
466 Ga0207689_10001814
467 Ga0207661_10002958
468 Ga0207679_10916780
469 Ga0207667_10009678
470 Ga0207667_10758041
471 Ga0207651_10349079
472 Ga0207668_10299097
473 Ga0207640_10029632
474 Ga0207658_10003271
475 Ga0207677_10013323
476 Ga0207677_10091503
477 Ga0207703_11509248
478 Ga0207678_10045432
479 Ga0207648_11826195
480 Ga0207676_10002233
481 Ga0207676_10071617
482 Ga0207674_10003496
483 Ga0207674_10038441
484 Ga0207674_10384352
485 Ga0207674_10723708
486 Ga0207683_10224102
487 Ga0207683_10728573
488 Ga0268266_10170716
489 Ga0268265_12537752
490 Ga0268264_10001931
491 Ga0307515_10000031
492 Ga0307509_10012169
493 Ga0307509_10059111
494 Ga0307508_10003011
495 Ga0307405_10820786
496 Ga0373954_0128652
497 Ga0373955_0617174
498 Ga0373924_0033329
499 Ga0373927_0063120
500 Ga0373933_0292203
501 Ga0373937_0250324
502 Ga0373925_0154963
503 Ga0373925_0446173
504 Ga0439436_0002217
505 Ga0439439_0026515
506 Ga0451804_1090254
507 Ga0451807_1944106
508 Ga0451835_0795973
509 Ga0451847_0768316
510 Ga0451843_0716219
511 Ga0451853_2277772
512 Ga0439433_0067211
513 Ga0439449_0056669
514 Ga0439449_0257560
515 Ga0439457_001639
516 Ga0439457_005811
517 Ga0439457_071803
518 Ga0439462_0061756
519 Ga0439444_0027267
520 Ga0466969_0000207
521 Ga0466972_0000009
522 Ga0466972_0020808
523 Ga0466978_0185444
524 Ga0466966_0040349
525 Ga0466964_0035780
526 Ga0453684_2266937
527 Ga0466971_0448404
528 Ga0466970_0188309
529 Ga0466959_0000236
530 Ga0451576_0469349
531 Ga0495592_0519667
532 Ga0495653_0930210
533 Ga0495608_0208613
534 Ga0495618_0025248
535 Ga0495630_0129851
536 Ga0495640_0376023
537 Ga0495586_0538476
538 Ga0495587_0168724
539 Ga0495598_0029514
540 Ga0495645_0273432
541 Ga0495634_0095822
542 Ga0495599_0398350
543 Ga0495600_0336566
544 Ga0495672_0142886
545 Ga0495675_0514380
546 Ga0495684_1038803
547 Ga0496102_0429188
548 Ga0496109_0131011
549 Ga0501034_0035694
550 Ga0501034_0156112
551 Ga0501036_0010318
552 Ga0501037_0044971
553 Ga0501038_0011280
554 Ga0501039_0048125
555 Ga0501043_0228551
556 Ga0501046_0001757
557 Ga0501047_0037039
558 Ga0501047_0065226
559 Ga0501047_0248778
560 Ga0501047_0349188
561 Ga0501048_0062714
562 Ga0501067_0118895
563 Ga0501069_0255230
564 Ga0501070_0007346
565 Ga0501074_0002925
566 Ga0501077_0133512
567 Ga0501209_036051
568 Ga0501243_053142
569 Ga0501253_145037
570 Ga0501257_002503
571 Ga0501257_081322
572 Ga0501257_186296
573 Ga0501259_018917
574 Ga0501245_022735
575 Ga0501083_0006365
576 Ga0501035_0005022
577 Ga0501035_0069392
578 Ga0501044_0105404
579 Ga0501044_0227462
580 Ga0501044_0947619
581 nmdc:mga0k408_308939_c1
582 nmdc:mga0k408_620966_c1
583 nmdc:mga05p37_11042_c1
584 Ga0500578_0000386
585 Ga0500644_0321448
586 Ga0500646_0034199
587 Ga0500583_0000392
588 Ga0500650_0424496
589 Ga0500555_131594
590 Ga0500556_0068974
591 Ga0500573_0150877
592 Ga0500589_011599
593 Ga0500603_038581
594 Ga0500616_0278202
595 Ga0500636_0022872
596 Ga0500584_173718
597 Ga0500611_020655
598 2738725195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06243

PaaB

Phenylacetic acid degradation B

64

152

0.98

Map