F394797

General Info

Members Datasets Scaffolds Average Seq Length
299 173 598 367

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10003288|Ga0099795_100032882
Length 406
Sequence MANGIPPCRIDAITQQINSKSTADQRQIKRTLNMRTKLLHTTAAALATILISAAPSAAQTRTTLDIYVIDVEGGNATLFVTPSGESVLIDTGNVGEGAVRDAERIMAAVKDARLTQIDHLITTHWHGDHFGGMAEVAKRIPIKHYIDHGPTVQPQPASDEFLGKVYQTLYGAARRTIAKPGDKIPVAGLDWQIVASAGETIKTPLAGAGAPNPYCAAHKPKDPDPSENAQSVASIVTFGKFRVAHLGDLTWNKEFDLMCPVNRTGPVDLFVVTHHGQPISNAEVAVHALRPRVAILNNGTRKGGQPDAMKVLYSSPGLEDLWQIHFSQLSGQEYTRPGMFIANLTDEPTTAMPVQPIAAPAPGPQTXXXXAHNGAAFWIKASAQQDGTVTVTNQRNGFSKTYAAKP

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
98 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
99 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
100 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
101 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
119 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
120 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
126 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
140 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
141 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
154 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
155 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
156 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
157 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
158 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
159 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 2.68
Rhizosphere 96.99
Stem 0
Stem Tuber 0
Unclassified 24.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10003288 3300007788 Bacteria 3977
2 Ga0065715_10090783 3300005293 Bacteria 6465
3 Ga0065715_10112925 3300005293 Unclassified 2510
4 Ga0065707_10142703 3300005295 Bacteria 1735
5 Ga0070683_100014946 3300005329 Bacteria 6807
6 Ga0070690_100087789 3300005330 Unclassified 2043
7 Ga0070670_100011168 3300005331 Bacteria 7675
8 Ga0068869_100078051 3300005334 Unclassified 2465
9 Ga0070666_10011128 3300005335 Bacteria 5639
10 Ga0070689_100037223 3300005340 Bacteria 3721
11 Ga0070661_100080451 3300005344 Bacteria 2405
12 Ga0070669_100001275 3300005353 Bacteria 18269
13 Ga0070669_100161685 3300005353 Bacteria 1740
14 Ga0070675_100000361 3300005354 Bacteria 30742
15 Ga0070675_100385445 3300005354 Unclassified 1248
16 Ga0070671_100005625 3300005355 Bacteria 9975
17 Ga0070674_100309056 3300005356 Bacteria 1263
18 Ga0070673_100005725 3300005364 Bacteria 7991
19 Ga0070667_100000959 3300005367 Bacteria 26538
20 Ga0070667_100217692 3300005367 Bacteria 1699
21 Ga0070711_100220297 3300005439 Unclassified 1474
22 Ga0070705_100122551 3300005440 Unclassified 1681
23 Ga0070663_100057208 3300005455 Unclassified 2797
24 Ga0070662_100032428 3300005457 Bacteria 3672
25 Ga0070662_100257032 3300005457 Unclassified 1406
26 Ga0070698_100002918 3300005471 Bacteria 18812
27 Ga0070684_100001496 3300005535 Bacteria 16858
28 Ga0070684_100032044 3300005535 Bacteria 4478
29 Ga0070672_100004994 3300005543 Bacteria 8738
30 Ga0070672_100038327 3300005543 Bacteria 3661
31 Ga0070693_100020735 3300005547 Bacteria 3472
32 Ga0070704_100188571 3300005549 Bacteria 1656
33 Ga0070664_100000344 3300005564 Bacteria 34004
34 Ga0070664_100031246 3300005564 Bacteria 4448
35 Ga0068856_100010049 3300005614 Bacteria 9192
36 Ga0068859_100008893 3300005617 Bacteria 10137
37 Ga0068859_100097259 3300005617 Unclassified 2997
38 Ga0068864_100026321 3300005618 Bacteria 4906
39 Ga0068870_10108094 3300005840 Unclassified 1583
40 Ga0068863_100001376 3300005841 Bacteria 24143
41 Ga0068858_100034595 3300005842 Bacteria 4687
42 Ga0068860_100004985 3300005843 Bacteria 13530
43 Ga0068862_100063021 3300005844 Bacteria 3190
44 Ga0068862_100185755 3300005844 Unclassified 1868
45 Ga0081455_10001711 3300005937 Bacteria 26559
46 Ga0081455_10187516 3300005937 Bacteria 1561
47 Ga0081540_1061641 3300005983 Bacteria 1787
48 Ga0070717_10007562 3300006028 Bacteria 8074
49 Ga0070712_100136982 3300006175 Bacteria 1863
50 Ga0075367_10015843 3300006178 Bacteria 4107
51 Ga0097621_100090639 3300006237 Unclassified 2558
52 Ga0068871_100234352 3300006358 Unclassified 1594
53 Ga0075428_100007985 3300006844 Bacteria 11739
54 Ga0075428_100009309 3300006844 Bacteria 10893
55 Ga0075428_100019920 3300006844 Bacteria 7429
56 Ga0075428_100179785 3300006844 Bacteria 2290
57 Ga0075428_100297894 3300006844 Unclassified 1734
58 Ga0075430_100009174 3300006846 Bacteria 8359
59 Ga0075430_100010662 3300006846 Bacteria 7787
60 Ga0075430_100054582 3300006846 Bacteria 3362
61 Ga0075430_100197095 3300006846 Bacteria 1673
62 Ga0075431_100011982 3300006847 Bacteria 8748
63 Ga0075431_100031542 3300006847 Bacteria 5459
64 Ga0075431_100076031 3300006847 Unclassified 3465
65 Ga0075431_100090663 3300006847 Bacteria 3155
66 Ga0075431_100357863 3300006847 Bacteria 1467
67 Ga0075431_100359201 3300006847 Unclassified 1463
68 Ga0075433_10037664 3300006852 Bacteria 4173
69 Ga0075433_10047698 3300006852 Unclassified 3726
70 Ga0075433_10079748 3300006852 Unclassified 2885
71 Ga0075434_100011843 3300006871 Bacteria 8242
72 Ga0075434_100014870 3300006871 Bacteria 7445
73 Ga0075434_100032839 3300006871 Bacteria 5120
74 Ga0075434_100066994 3300006871 Unclassified 3577
75 Ga0075434_100071819 3300006871 Unclassified 3453
76 Ga0075429_100009059 3300006880 Bacteria 8644
77 Ga0075429_100067418 3300006880 Bacteria 3114
78 Ga0075429_100173972 3300006880 Unclassified 1886
79 Ga0075429_100208824 3300006880 Unclassified 1711
80 Ga0068865_100054571 3300006881 Unclassified 2777
81 Ga0097620_100008893 3300006931 Bacteria 10137
82 Ga0097620_100097265 3300006931 Unclassified 2997
83 Ga0075435_100026668 3300007076 Bacteria 4511
84 Ga0075435_100091470 3300007076 Bacteria 2511
85 Ga0099794_10003409 3300007265 Bacteria 6055
86 Ga0099794_10008315 3300007265 Bacteria 4303
87 Ga0111539_10000878 3300009094 Bacteria 39274
88 Ga0111539_10002291 3300009094 Bacteria 25481
89 Ga0111539_10013872 3300009094 Bacteria 10076
90 Ga0111539_10016823 3300009094 Bacteria 9058
91 Ga0111539_10023529 3300009094 Bacteria 7569
92 Ga0111539_10038335 3300009094 Bacteria 5780
93 Ga0111539_10063668 3300009094 Bacteria 4363
94 Ga0111539_10067730 3300009094 Bacteria 4215
95 Ga0111539_10069835 3300009094 Bacteria 4147
96 Ga0111539_10096794 3300009094 Bacteria 3467
97 Ga0111539_10104718 3300009094 Unclassified 3320
98 Ga0111539_10191611 3300009094 Unclassified 2385
99 Ga0105245_10007073 3300009098 Bacteria 9843
100 Ga0114129_10004224 3300009147 Bacteria 20296
101 Ga0114129_10006205 3300009147 Bacteria 16952
102 Ga0114129_10021440 3300009147 Bacteria 9171
103 Ga0114129_10030818 3300009147 Bacteria 7585
104 Ga0114129_10042806 3300009147 Bacteria 6373
105 Ga0114129_10120033 3300009147 Unclassified 3621
106 Ga0114129_10353855 3300009147 Bacteria 1945
107 Ga0105248_10000578 3300009177 Bacteria 41772
108 Ga0105248_10066329 3300009177 Bacteria 4053
109 Ga0105249_10019468 3300009553 Bacteria 6056
110 Ga0105249_10024670 3300009553 Bacteria 5405
111 Ga0099796_10002888 3300010159 Bacteria 3872
112 Ga0157374_10016573 3300013296 Bacteria 6481
113 Ga0157374_10029177 3300013296 Bacteria 4992
114 Ga0157374_10142564 3300013296 Unclassified 2326
115 Ga0157378_10000390 3300013297 Bacteria 43243
116 Ga0163162_10011612 3300013306 Bacteria 8587
117 Ga0157375_10000278 3300013308 Bacteria 46490
118 Ga0163163_10048734 3300014325 Bacteria 4166
119 Ga0157380_10145198 3300014326 Bacteria 2044
120 Ga0157379_10000331 3300014968 Bacteria 37876
121 Ga0157376_10104119 3300014969 Unclassified 2486
122 Ga0163161_10101851 3300017792 Unclassified 2138
123 Ga0207697_10021628 3300025315 Bacteria 2634
124 Ga0207680_10009629 3300025903 Bacteria 4801
125 Ga0207695_10182001 3300025913 Bacteria 2022
126 Ga0207693_10213507 3300025915 Bacteria 1516
127 Ga0207663_10054959 3300025916 Unclassified 2496
128 Ga0207652_10109678 3300025921 Bacteria 2447
129 Ga0207650_10007834 3300025925 Bacteria 7277
130 Ga0207659_10000327 3300025926 Bacteria 28725
131 Ga0207659_10016558 3300025926 Bacteria 4799
132 Ga0207644_10037852 3300025931 Bacteria 3395
133 Ga0207644_10104660 3300025931 Bacteria 2131
134 Ga0207706_10054817 3300025933 Bacteria 3518
135 Ga0207670_10034577 3300025936 Bacteria 3268
136 Ga0207691_10014672 3300025940 Bacteria 7470
137 Ga0207691_10031271 3300025940 Bacteria 4969
138 Ga0207711_10001524 3300025941 Bacteria 21542
139 Ga0207711_10020892 3300025941 Bacteria 5465
140 Ga0207661_10004097 3300025944 Bacteria 10188
141 Ga0207679_10037388 3300025945 Bacteria 3450
142 Ga0207712_10147821 3300025961 Bacteria 1811
143 Ga0207658_10014687 3300025986 Bacteria 5366
144 Ga0207703_10006219 3300026035 Bacteria 9556
145 Ga0207678_10042259 3300026067 Bacteria 3950
146 Ga0207678_10052974 3300026067 Unclassified 3498
147 Ga0207702_10039286 3300026078 Bacteria 3964
148 Ga0207641_10002217 3300026088 Bacteria 18231
149 Ga0207676_10061276 3300026095 Unclassified 2978
150 Ga0207674_10051025 3300026116 Bacteria 4223
151 Ga0209179_1017156 3300027512 Unclassified 1368
152 Ga0209588_1004827 3300027671 Bacteria 3829
153 Ga0207428_10001216 3300027907 Bacteria 27630
154 Ga0207428_10002559 3300027907 Bacteria 18167
155 Ga0207428_10012484 3300027907 Bacteria 7461
156 Ga0207428_10024278 3300027907 Bacteria 5093
157 Ga0207428_10080052 3300027907 Unclassified 2553
158 Ga0207428_10113846 3300027907 Bacteria 2079
159 Ga0207428_10125457 3300027907 Bacteria 1966
160 Ga0268265_10155985 3300028380 Unclassified 1932
161 Ga0265319_1000393 3300028563 Bacteria 31705
162 Ga0265319_1009420 3300028563 Bacteria 4160
163 Ga0265318_10000092 3300028577 Bacteria 82224
164 Ga0265318_10001119 3300028577 Bacteria 16770
165 Ga0265332_10034237 3300031238 Bacteria 2209
166 Ga0265332_10067675 3300031238 Bacteria 1523
167 Ga0265320_10000067 3300031240 Bacteria 93425
168 Ga0265320_10010743 3300031240 Bacteria 5428
169 Ga0265329_10000155 3300031242 Bacteria 33754
170 Ga0265329_10001954 3300031242 Bacteria 9676
171 Ga0265340_10001836 3300031247 Bacteria 12139
172 Ga0265340_10076187 3300031247 Bacteria 1584
173 Ga0265339_10010301 3300031249 Bacteria 5815
174 Ga0265331_10000047 3300031250 Bacteria 183230
175 Ga0265331_10000522 3300031250 Bacteria 35513
176 Ga0265316_10004278 3300031344 Bacteria 14250
177 Ga0265316_10042946 3300031344 Bacteria 3609
178 Ga0307408_100006203 3300031548 Bacteria 7940
179 Ga0307408_100019132 3300031548 Bacteria 4609
180 Ga0307408_100077056 3300031548 Bacteria 2482
181 Ga0307408_100077180 3300031548 Bacteria 2480
182 Ga0265313_10003874 3300031595 Bacteria 11796
183 Ga0265314_10083807 3300031711 Bacteria 2095
184 Ga0265342_10000247 3300031712 Bacteria 60566
185 Ga0265342_10009425 3300031712 Bacteria 6885
186 Ga0307411_10172419 3300032005 Bacteria 1633
187 Ga0307411_10230142 3300032005 Unclassified 1444
188 Ga0373926_0023732 3300035083 Unclassified 2131
189 Ga0373923_0066995 3300035111 Unclassified 1535
190 Ga0373941_0005597 3300035115 Bacteria 2969
191 Ga0373935_0012867 3300035692 Bacteria 5040
192 Ga0373927_0011052 3300035695 Bacteria 6014
193 Ga0373927_0062217 3300035695 Bacteria 2414
194 Ga0373947_0040873 3300035725 Bacteria 2764
195 Ga0373947_0094233 3300035725 Bacteria 1872
196 Ga0373925_0061004 3300037068 Bacteria 2832
197 Ga0495603_0045694 3300046455 Bacteria 2611
198 Ga0495651_0000328 3300046462 Bacteria 36948
199 Ga0495651_0012110 3300046462 Bacteria 6636
200 Ga0495653_0026097 3300046463 Unclassified 4688
201 Ga0495580_0066632 3300046472 Bacteria 2520
202 Ga0495580_0074098 3300046472 Bacteria 2376
203 Ga0495582_0046783 3300046473 Bacteria 2383
204 Ga0495664_0024579 3300046477 Unclassified 3503
205 Ga0495607_0184761 3300046501 Unclassified 1043
206 Ga0495608_0016729 3300046511 Bacteria 5074
207 Ga0495618_0016986 3300046514 Unclassified 4460
208 Ga0495630_0002145 3300046517 Bacteria 13725
209 Ga0495630_0106931 3300046517 Bacteria 2119
210 Ga0495630_0152453 3300046517 Unclassified 1759
211 Ga0495666_0022665 3300046526 Unclassified 3109
212 Ga0495665_0014723 3300046531 Unclassified 4215
213 Ga0495640_0012328 3300046533 Bacteria 6535
214 Ga0495587_0036415 3300046536 Unclassified 2960
215 Ga0495645_0093252 3300046543 Bacteria 2149
216 Ga0495667_0019468 3300046559 Bacteria 4580
217 Ga0495667_0053303 3300046559 Unclassified 2664
218 Ga0495659_0029931 3300046664 Bacteria 1892
219 Ga0495613_0012598 3300046689 Bacteria 6288
220 Ga0495624_0018139 3300046690 Unclassified 4709
221 Ga0495624_0037618 3300046690 Bacteria 3112
222 Ga0495581_0015942 3300047315 Bacteria 4367
223 Ga0495674_0006500 3300047319 Bacteria 11214
224 Ga0495674_0106006 3300047319 Unclassified 2387
225 Ga0495674_0196739 3300047319 Unclassified 1674
226 Ga0495680_0000269 3300047322 Bacteria 57801
227 Ga0495675_0001622 3300047444 Bacteria 13525
228 Ga0495675_0024549 3300047444 Bacteria 3844
229 Ga0495684_0022190 3300047471 Unclassified 4887
230 Ga0495593_0033138 3300047673 Unclassified 2814
231 Ga0495602_0013377 3300048088 Bacteria 8389
232 Ga0495614_0018108 3300048089 Unclassified 3052
233 Ga0496104_0013426 3300048907 Bacteria 7380
234 Ga0496108_0005897 3300048911 Bacteria 9929
235 Ga0496109_0002987 3300048912 Bacteria 14127
236 Ga0496110_0060464 3300048913 Unclassified 3341
237 Ga0496110_0134301 3300048913 Bacteria 2236
238 Ga0496111_0047974 3300048914 Unclassified 3076
239 Ga0496112_0003315 3300048915 Bacteria 13287
240 Ga0496113_0091612 3300048916 Bacteria 2344
241 Ga0501034_0010244 3300049571 Bacteria 9778
242 Ga0501040_0163823 3300049576 Unclassified 1572
243 Ga0501046_0214252 3300049580 Bacteria 1428
244 Ga0501047_0020963 3300049581 Bacteria 6278
245 Ga0501047_0138325 3300049581 Bacteria 2314
246 Ga0501070_0074451 3300049586 Bacteria 2811
247 Ga0501072_0112198 3300049588 Unclassified 2171
248 Ga0501073_0075444 3300049589 Unclassified 2347
249 Ga0501073_0107624 3300049589 Bacteria 1934
250 Ga0501075_0113945 3300049591 Bacteria 2056
251 Ga0501076_0075692 3300049592 Bacteria 2699
252 Ga0501077_0064845 3300049593 Bacteria 2317
253 Ga0501083_0006648 3300049744 Bacteria 8202
254 Ga0501083_0044458 3300049744 Bacteria 3006
255 Ga0501045_0177975 3300049824 Unclassified 1585
256 nmdc:mga05p37_110930_c1 3300050507 Unclassified 3374
257 nmdc:mga05p37_191048_c1 3300050507 Bacteria 2486
258 nmdc:mga05p37_21392_c1 3300050507 Bacteria 7834
259 nmdc:mga05p37_229403_c1 3300050507 Unclassified 2238
260 nmdc:mga05p37_45548_c1 3300050507 Bacteria 5394
261 nmdc:mga05p37_58882_c1 3300050507 Bacteria 4731
262 nmdc:mga09592_18614_c1 3300050508 Bacteria 5695
263 nmdc:mga09592_201688_c1 3300050508 Unclassified 1723
264 nmdc:mga09592_23786_c1 3300050508 Bacteria 5062
265 nmdc:mga09592_45639_c1 3300050508 Unclassified 3691
266 nmdc:mga0qj67_186549_c1 3300050509 Bacteria 1685
267 nmdc:mga0qj67_94200_c1 3300050509 Unclassified 2409
268 nmdc:mga06r32_158836_c1 3300050510 Unclassified 2243
269 nmdc:mga06r32_21767_c1 3300050510 Bacteria 5919
270 nmdc:mga06r32_26351_c1 3300050510 Bacteria 5419
271 nmdc:mga08y16_11300_c1 3300050511 Bacteria 9378
272 nmdc:mga08y16_20613_c1 3300050511 Bacteria 6957
273 nmdc:mga08y16_320457_c1 3300050511 Unclassified 1596
274 nmdc:mga08y16_32149_c1 3300050511 Bacteria 5518
275 nmdc:mga08y16_51084_c1 3300050511 Bacteria 4325
276 nmdc:mga08y16_70652_c1 3300050511 Unclassified 3639
277 nmdc:mga08y16_769_c1 3300050511 Bacteria 30542
278 nmdc:mga08y16_84364_c1 3300050511 Bacteria 3311
279 nmdc:mga08y16_8517_c1 3300050511 Bacteria 10742
280 nmdc:mga08y16_9011_c1 3300050511 Bacteria 10480
281 nmdc:mga0n895_27214_c1 3300050512 Bacteria 5429
282 nmdc:mga0n895_410916_c1 3300050512 Unclassified 1368
283 nmdc:mga0n895_428776_c1 3300050512 Bacteria 1336
284 nmdc:mga0n895_64544_c1 3300050512 Unclassified 3622
285 nmdc:mga0n895_73718_c1 3300050512 Unclassified 3389
286 nmdc:mga0n895_97623_c1 3300050512 Bacteria 2944
287 nmdc:mga0rr50_252413_c1 3300050513 Bacteria 1465
288 nmdc:mga0rr50_26119_c1 3300050513 Bacteria 4069
289 nmdc:mga0a205_17538_c2 3300050515 Bacteria 5914
290 nmdc:mga0a205_23422_c1 3300050515 Bacteria 5857
291 nmdc:mga0a205_38883_c1 3300050515 Bacteria 4578
292 nmdc:mga0a205_45315_c1 3300050515 Bacteria 4240
293 nmdc:mga0a205_52161_c1 3300050515 Bacteria 3948
294 Ga0501084_0059852 3300054114 Bacteria 3189
295 Ga0590071_000234 3300059421 Bacteria 16221
296 Ga0590075_000039 3300059424 Bacteria 33839
297 Ga0590077_001412 3300059426 Bacteria 5631
298 Ga0530510_0046370 3300061734 Unclassified 3140
299 Ga0530510_0156637 3300061734 Bacteria 1684
300 Ga0099795_10003288
301 Ga0065715_10090783
302 Ga0065715_10112925
303 Ga0065707_10142703
304 Ga0070683_100014946
305 Ga0070690_100087789
306 Ga0070670_100011168
307 Ga0068869_100078051
308 Ga0070666_10011128
309 Ga0070689_100037223
310 Ga0070661_100080451
311 Ga0070669_100001275
312 Ga0070669_100161685
313 Ga0070675_100000361
314 Ga0070675_100385445
315 Ga0070671_100005625
316 Ga0070674_100309056
317 Ga0070673_100005725
318 Ga0070667_100000959
319 Ga0070667_100217692
320 Ga0070711_100220297
321 Ga0070705_100122551
322 Ga0070663_100057208
323 Ga0070662_100032428
324 Ga0070662_100257032
325 Ga0070698_100002918
326 Ga0070684_100001496
327 Ga0070684_100032044
328 Ga0070672_100004994
329 Ga0070672_100038327
330 Ga0070693_100020735
331 Ga0070704_100188571
332 Ga0070664_100000344
333 Ga0070664_100031246
334 Ga0068856_100010049
335 Ga0068859_100008893
336 Ga0068859_100097259
337 Ga0068864_100026321
338 Ga0068870_10108094
339 Ga0068863_100001376
340 Ga0068858_100034595
341 Ga0068860_100004985
342 Ga0068862_100063021
343 Ga0068862_100185755
344 Ga0081455_10001711
345 Ga0081455_10187516
346 Ga0081540_1061641
347 Ga0070717_10007562
348 Ga0070712_100136982
349 Ga0075367_10015843
350 Ga0097621_100090639
351 Ga0068871_100234352
352 Ga0075428_100007985
353 Ga0075428_100009309
354 Ga0075428_100019920
355 Ga0075428_100179785
356 Ga0075428_100297894
357 Ga0075430_100009174
358 Ga0075430_100010662
359 Ga0075430_100054582
360 Ga0075430_100197095
361 Ga0075431_100011982
362 Ga0075431_100031542
363 Ga0075431_100076031
364 Ga0075431_100090663
365 Ga0075431_100357863
366 Ga0075431_100359201
367 Ga0075433_10037664
368 Ga0075433_10047698
369 Ga0075433_10079748
370 Ga0075434_100011843
371 Ga0075434_100014870
372 Ga0075434_100032839
373 Ga0075434_100066994
374 Ga0075434_100071819
375 Ga0075429_100009059
376 Ga0075429_100067418
377 Ga0075429_100173972
378 Ga0075429_100208824
379 Ga0068865_100054571
380 Ga0097620_100008893
381 Ga0097620_100097265
382 Ga0075435_100026668
383 Ga0075435_100091470
384 Ga0099794_10003409
385 Ga0099794_10008315
386 Ga0111539_10000878
387 Ga0111539_10002291
388 Ga0111539_10013872
389 Ga0111539_10016823
390 Ga0111539_10023529
391 Ga0111539_10038335
392 Ga0111539_10063668
393 Ga0111539_10067730
394 Ga0111539_10069835
395 Ga0111539_10096794
396 Ga0111539_10104718
397 Ga0111539_10191611
398 Ga0105245_10007073
399 Ga0114129_10004224
400 Ga0114129_10006205
401 Ga0114129_10021440
402 Ga0114129_10030818
403 Ga0114129_10042806
404 Ga0114129_10120033
405 Ga0114129_10353855
406 Ga0105248_10000578
407 Ga0105248_10066329
408 Ga0105249_10019468
409 Ga0105249_10024670
410 Ga0099796_10002888
411 Ga0157374_10016573
412 Ga0157374_10029177
413 Ga0157374_10142564
414 Ga0157378_10000390
415 Ga0163162_10011612
416 Ga0157375_10000278
417 Ga0163163_10048734
418 Ga0157380_10145198
419 Ga0157379_10000331
420 Ga0157376_10104119
421 Ga0163161_10101851
422 Ga0207697_10021628
423 Ga0207680_10009629
424 Ga0207695_10182001
425 Ga0207693_10213507
426 Ga0207663_10054959
427 Ga0207652_10109678
428 Ga0207650_10007834
429 Ga0207659_10000327
430 Ga0207659_10016558
431 Ga0207644_10037852
432 Ga0207644_10104660
433 Ga0207706_10054817
434 Ga0207670_10034577
435 Ga0207691_10014672
436 Ga0207691_10031271
437 Ga0207711_10001524
438 Ga0207711_10020892
439 Ga0207661_10004097
440 Ga0207679_10037388
441 Ga0207712_10147821
442 Ga0207658_10014687
443 Ga0207703_10006219
444 Ga0207678_10042259
445 Ga0207678_10052974
446 Ga0207702_10039286
447 Ga0207641_10002217
448 Ga0207676_10061276
449 Ga0207674_10051025
450 Ga0209179_1017156
451 Ga0209588_1004827
452 Ga0207428_10001216
453 Ga0207428_10002559
454 Ga0207428_10012484
455 Ga0207428_10024278
456 Ga0207428_10080052
457 Ga0207428_10113846
458 Ga0207428_10125457
459 Ga0268265_10155985
460 Ga0265319_1000393
461 Ga0265319_1009420
462 Ga0265318_10000092
463 Ga0265318_10001119
464 Ga0265332_10034237
465 Ga0265332_10067675
466 Ga0265320_10000067
467 Ga0265320_10010743
468 Ga0265329_10000155
469 Ga0265329_10001954
470 Ga0265340_10001836
471 Ga0265340_10076187
472 Ga0265339_10010301
473 Ga0265331_10000047
474 Ga0265331_10000522
475 Ga0265316_10004278
476 Ga0265316_10042946
477 Ga0307408_100006203
478 Ga0307408_100019132
479 Ga0307408_100077056
480 Ga0307408_100077180
481 Ga0265313_10003874
482 Ga0265314_10083807
483 Ga0265342_10000247
484 Ga0265342_10009425
485 Ga0307411_10172419
486 Ga0307411_10230142
487 Ga0373926_0023732
488 Ga0373923_0066995
489 Ga0373941_0005597
490 Ga0373935_0012867
491 Ga0373927_0011052
492 Ga0373927_0062217
493 Ga0373947_0040873
494 Ga0373947_0094233
495 Ga0373925_0061004
496 Ga0495603_0045694
497 Ga0495651_0000328
498 Ga0495651_0012110
499 Ga0495653_0026097
500 Ga0495580_0066632
501 Ga0495580_0074098
502 Ga0495582_0046783
503 Ga0495664_0024579
504 Ga0495607_0184761
505 Ga0495608_0016729
506 Ga0495618_0016986
507 Ga0495630_0002145
508 Ga0495630_0106931
509 Ga0495630_0152453
510 Ga0495666_0022665
511 Ga0495665_0014723
512 Ga0495640_0012328
513 Ga0495587_0036415
514 Ga0495645_0093252
515 Ga0495667_0019468
516 Ga0495667_0053303
517 Ga0495659_0029931
518 Ga0495613_0012598
519 Ga0495624_0018139
520 Ga0495624_0037618
521 Ga0495581_0015942
522 Ga0495674_0006500
523 Ga0495674_0106006
524 Ga0495674_0196739
525 Ga0495680_0000269
526 Ga0495675_0001622
527 Ga0495675_0024549
528 Ga0495684_0022190
529 Ga0495593_0033138
530 Ga0495602_0013377
531 Ga0495614_0018108
532 Ga0496104_0013426
533 Ga0496108_0005897
534 Ga0496109_0002987
535 Ga0496110_0060464
536 Ga0496110_0134301
537 Ga0496111_0047974
538 Ga0496112_0003315
539 Ga0496113_0091612
540 Ga0501034_0010244
541 Ga0501040_0163823
542 Ga0501046_0214252
543 Ga0501047_0020963
544 Ga0501047_0138325
545 Ga0501070_0074451
546 Ga0501072_0112198
547 Ga0501073_0075444
548 Ga0501073_0107624
549 Ga0501075_0113945
550 Ga0501076_0075692
551 Ga0501077_0064845
552 Ga0501083_0006648
553 Ga0501083_0044458
554 Ga0501045_0177975
555 nmdc:mga05p37_110930_c1
556 nmdc:mga05p37_191048_c1
557 nmdc:mga05p37_21392_c1
558 nmdc:mga05p37_229403_c1
559 nmdc:mga05p37_45548_c1
560 nmdc:mga05p37_58882_c1
561 nmdc:mga09592_18614_c1
562 nmdc:mga09592_201688_c1
563 nmdc:mga09592_23786_c1
564 nmdc:mga09592_45639_c1
565 nmdc:mga0qj67_186549_c1
566 nmdc:mga0qj67_94200_c1
567 nmdc:mga06r32_158836_c1
568 nmdc:mga06r32_21767_c1
569 nmdc:mga06r32_26351_c1
570 nmdc:mga08y16_11300_c1
571 nmdc:mga08y16_20613_c1
572 nmdc:mga08y16_320457_c1
573 nmdc:mga08y16_32149_c1
574 nmdc:mga08y16_51084_c1
575 nmdc:mga08y16_70652_c1
576 nmdc:mga08y16_769_c1
577 nmdc:mga08y16_84364_c1
578 nmdc:mga08y16_8517_c1
579 nmdc:mga08y16_9011_c1
580 nmdc:mga0n895_27214_c1
581 nmdc:mga0n895_410916_c1
582 nmdc:mga0n895_428776_c1
583 nmdc:mga0n895_64544_c1
584 nmdc:mga0n895_73718_c1
585 nmdc:mga0n895_97623_c1
586 nmdc:mga0rr50_252413_c1
587 nmdc:mga0rr50_26119_c1
588 nmdc:mga0a205_17538_c2
589 nmdc:mga0a205_23422_c1
590 nmdc:mga0a205_38883_c1
591 nmdc:mga0a205_45315_c1
592 nmdc:mga0a205_52161_c1
593 Ga0501084_0059852
594 Ga0590071_000234
595 Ga0590075_000039
596 Ga0590077_001412
597 Ga0530510_0046370
598 Ga0530510_0156637

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

69

215

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xci-assembly1.cif.gz_B structure of ndm-1 in complex with macrocycle inhibitor ndm1i-3d 0.7959 38 109
8bda-assembly1.cif.gz_I ifta complex in anterograde intraflagellar transport trains (chlamydomonas reinhardtii) 0.7489 351 378
4rm5-assembly6.cif.gz_D-2 structural and mechanistic insights into ndm-1 catalyzed hydrolysis of cephalosporins 0.7407 40 106
1qh5-assembly1.cif.gz_B human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl)glutathione 0.7342 40 231
8ewo-assembly2.cif.gz_B crystal structure of putative glyoxylase ii from pseudomonas aeruginosa 0.7312 28 231
ID Description Score Start End Superfamily
af_Q9BZH6_665_948_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8855 351 374 2.130.10.10
af_Q54IY5_171_477_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8323 351 374 2.130.10.10
af_Q4DAR3_273_622_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8199 351 377 2.130.10.10
af_Q2FXY4_446_708_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8035 26 307 3.60.15.10
af_Q6PII5_1_211_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7953 29 231 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A7Y5U0Z9-F1-model_v4 MBL fold metallo-hydrolase 0.9644 25 335 GO:0016787
AF-A0A2V8VZF5-F1-model_v4 MBL fold metallo-hydrolase 0.9523 154 305 GO:0016787
AF-A0A2V8ISB8-F1-model_v4 MBL fold metallo-hydrolase 0.9501 26 378 GO:0016787
AF-A0A2V9XZ17-F1-model_v4 MBL fold metallo-hydrolase 0.9472 29 377 GO:0016787
AF-A0A2V8VZF5-F1-model_v4 MBL fold metallo-hydrolase 0.946 154 305 GO:0016787

Map